Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026667 (Uhmk1)
Chromosomal location
Chr 1: 172129388 - 172145524 (-)
Description
U2AF homology motif (UHM) kinase 1 Gene [Source:MGI Symbol;Acc:MGI:1341908]
RefSeq_dna
NM_010633 
RefSeq_peptide
NP_034763.3 
MGI
MGI:1341908 
Uniprot/SWISSPROT
P97343 
Uniprot/SPTREMBL
Q8C0N6 
Human Ortholog
ENSG00000152332 (UHMK1)
Omim not available
UniTrap UNI1355
Vector Insertion
Chr 1: 172138881 - 172141161
Public Clones CJ0546 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI320
Vector Insertion
Chr 1: 172135335 - 172137244
Public Clones GC0848 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027979
Sequence
GGTGTCATGGCGGCCTGAGGTCCGGGGAGTCGGTCGGAGCGCTGCAGGCCCCTCCCTGCGGAGCGGCGGGTCCGGGCGGGGATGTGACGGCGGGCGCCGC

GGGCCTGCCTGGCGCGTCGTGTCGGCTCGCGTGTCCTCGGCCCAGCCCGCACCATGGCGGGGTCCGGCTGCGCGTGGGGCGCCGAGCCGCCGCGCTTCCT

GGAGGCCTTCGGGCGGCTGTGGCAGGTCCAGAGCCGCCTGGGCAGCGGCTCGTCGGCCTCGGTGTACCGGGTGCGGTGCTGCGGTACCCCGGGCTCGCCC

CCCGGCGCCCTCAAGCAGTTCCTGCCTCCGGGAACCACCGGGGCTGCGGCCTCGGCCGCGGAGTATGGTTTCCGCAAAGAGAGGGCGGCGCTGGAGCAGT

TGCAGGGTCACAGGAACATCG TGACTTTATATGGAGTCTTTACCATACACTTCTCTCCCAATGTGCCATCACGCTGTCTGCTGCTTGAACTCCTGGATG

TCAGTGTTTCGGAATTGCTTTTATATTCCAGTCATCAGGGCTGCTCCATGTGGATGATACAGCACTGTGCCCGAGATGTTCTGGAGGCCCTCGCTTTTCT

TCACCATGAGGGCTACGTCCATGCAGACCTCAAACCACGAAACATCCTGTGGAGTGCGGAGAATGAGTGTTTTAAGCTTATTGACTTTGGACTCAGCTTC

AAAGAAGGCAATCAG GACGTAAAGTATATTCAGACAGACGGGTATCGCGCTCCTGAAGCAGAGCTGCAGAACTGCTTGGCCCAGGCCGGCCTGCAGAGT

GATACAGAATGTACCTCAGCTGTTGATCTGTGGAGCCTCGGAATCATTTTACTGGAAATGTTCTCAGGAATGAAGCTGAAACATACAGTCAGATCTCAGG

AATGGAAG - UNI1355 - GCAAACAGTTCTGCTATTATTGATCATATATTTGCCAGTAAAGCAGTGGTGAATGCCGCAATTCCAGCCTATCACCTCA

GAGACCTTATCAAAAG CATGCTTCATGATGACCCGGGCAGAAGAATCCCTGCTGAGATGGCATTGTGCAGCCCATTCTTTAGCATTCCTTTTG CCCCT

CATATTGAAGATCTGGTGATGCTTCCGACTCCAGTGCTCAGGCTCCTCAATGTGCTGGATGATGATTACCTTGAAAATGAAGATGAATATGAAG - UNI

320 - ATGTTGTAGAAGATGTGAAAGAGGAGTGTCAGAAATATGGACCAGTGGTTTCTCTGCTTGTTCCAAAGGAAAATCCTGGCAGAGGACAA GTCT

TCGTTGAGTACGCGAACGCTGGTGATTCCAAAGCTGCTCAGAAGTTGCTGACTGGGAGGATGTTTGACGGGAAGTTTGTTGTGGCTACATTCTACCCGCT

GAGTGCCTACAAGAGGGGATATCTTTATCAAACCTTGCTTTAATCAGTAACCTAAGGACTACTTCCTGTTTCTCCTCTTCCATTTCTTGGATTATTATAT

TCCACAGCTGAATGCAGGAGCACCCCTTTACCCATTTTAAAGGGTACCTTGTACATTTATTTAATCCTACTAATGTGCAGCCATTGCCCAGACAGTGACT

GCATTGCAAACATGGCACTGAGTAGGACCCGACCTCTCAGCTATACATTGAGGGGGTTAGAGCACCCATGTGGCCACCCTTTATTTGTGCAGTAGGGCAG

GTGCTGCTCTTTACTATGTAACCTAAAAAGATGTCATTTCATGTGATGATGAAGCAAAGATGAGTTGTTTGTCATAGTAAATACTATTAACAAATTTGTT

AGGGTTGGTGACATCACAGAATATTTGTTTGTATTGTCAGGTGTATCTCCTTGTTATTCTAGCTGGCACTGGATGCTCTAATAATGTTAAGTCATTGTCA

AGCAGCAGTTACCTACCGTGTTCTTAACAATGAGTTGTGAATTTTTCTAAAGGAGTACTGTAGGACTTAATATTCCTCCGAAGAAACTGCAGTGAGCCTA

TCAATGTTTTTAAAATTACTATTAAGGCTTTTAAAATAGAAAGCTGATGCTTG
Translation
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGTPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIV VTLYGVFTI

HFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQ DVKYIQTDGY

RAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWK - UNI1355 - ANSSAIIDHIFASKAVVNAAIPAYHLRDLIKS 

SMLHDDPGRRIPAEMALCSPFFSIPFA APHIEDLVMLPTPVLRLLNVLDDDYLENEDEYED - UNI320 - DVVEDVKEECQKYGPVVSLLVPKENP

GRGQ VFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL

For any suggestions or comments, please send an email to unitrap@crg.es