Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026692 (Fmo4)
Chromosomal location
Chr 1: 164724014 - 164743803 (-)
Description
flavin containing monooxygenase 4 Gene [Source:MGI (curated);Acc:Fmo4-001]
RefSeq_dna
NM_144878 
RefSeq_peptide
NP_659127.1 
UniGene
Mm.155164 
MGI
MGI:2429497 
Uniprot/SWISSPROT
Q8VHG0 
Uniprot/SPTREMBL
Q3KP75 
Human Ortholog
ENSG00000076258 (FMO4)
Omim not available
UniTrap UNI28743
Vector Insertion
Chr 1: 164724525 - 164725182
Public Clones not available
Private Clones OST21756 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028014
Sequence
ACAACTCAAGGGAACTCACAG AGCGCACCATGGCCAAGAAGGTGGCAGTGATTGGAGCTGGCGTAAGTGGCCTGTCCTCTATCAAGTGCTGCTTGGACG

AGAACCTGGAGCCCACCTGCTTTGAGAGAACTAGCGACTTTGGCGGACTGTGGAAGTTTGCT GACACTTCCGAGGATGGGATGACCAGGGTTTACAGGT

CACTAGTGACAAATGTCTGCAAAGAAATGTCATGTTACAGTGACTTCCCATTCCGAGAAGATTACCCCAACTTCATGAGCCATGAGAAATTCTGGGACTA

TCTCAGAGAATTTGCTGAGCACTTTGGCCTGCTGAGATATATTCGGTTTAAG ACAACTGTGCTCAGTGTAACAAAGCGCCCAGACTTCTCTGAAACTGG

CCAGTGGGATGTTGTCACAGAGACAGAAGGCAAACGGGACAGGGCAGTATTTGACGCTGTTATGGTTTGCACTGGGCAATTCCTGAGCCCACATTTACCT

CTGGAGTCCTTTCCTG GAATCCATAAGTTTAAAGGACAGATCCTGCACAGCCAAGAGTACAGGATTCCAGATGCCTTCCGGGGCAAGCGCATCCTGGTG

GTTGGTCTTGGAAACACTGGCGGGGACATAGCAGTAGAGCTCAGTGAAATAGCAGCTCAG GTGTTTCTCAGCACTAGAACTGGCACCTGGGTCCTAAGC

CGCTCCTCACCTGGTGGCTACCCTTTCAATATGATACAAACAAGATGGCTCAATTTCCTTGTACGAGTTCTGCCTTCACGTTTTATAAACTGGACTCACG

AGAGGAAAATGAATAAAATACTTAACCATGAGAATTATGGATTAAGCATTGCAAAAGG GAAAAAACCAAAATTTATTGTAAATGATGAACTACCAACCT

GTATACTTTGTGGGAAAGTCACCATGAAAACCAGCGTGAAGGATTTTACAGAATCTTCTGTCATCTTTGAAGATGGTACAACAGAAGCCAACATTGATGT

AGTGATCTTCACTACAGGATATGAATTTTCTTTTCCCTTTTTTGAAGAACCTCTCAAAAGCCTTTGTACAAAGAAGATCATCCTATACAAGCGAGTCTTT

CCCCCAAATTTGGAGAGAGCAACATTAGCCATTATTGGCCTGATCAGCCTTAATGGGTCGATCTTAGTGGGCACAGAGTTCCAAGCACGATGGGCCACAA

GAGTATTCAAAG GACTCTGTAGCATACCTCCATCTCAGAAACTGATGGCCGAAGCCACTAAAACGGAGCAGCTCATTAAAAG - UNI28743 - GGG

TGTGATTAAAGATACCAGCCAAGACAAACTGGACTTCATTACCTACATGGACGAGCTCACTCAGTGCATAGGCGCGAAGCCCAGCATTCCACTTTTGTTC

ATTAAGGATCCAAGATTGGCTTGGGAAGTTTTCTTTGGACCATGTACCCCTTACCAATACCGCCTAGTGGGCCCTGGAAGATGGGATGGAGCCAGAAATG

CCATCCTGACACAGTGGGACAGGACTCTGAAACCATTAAAAACTCGAATTGTTCCTAAGTCCCCCGAGCCTACCTCCCTCTCACATTACTTAATAGCTTG

GGGGGCACCTGTCCTGCTTGTCTCTCTTTTACTTATCTACAAATCTTCACATTTTCTTGAATTGGTACAAGGTAAGCTACCGAGAAGATTTCCCCCTTAC

CGATTACTGTGGTACATGCCCCAGAACTCATGAGTTGGTCTCCAGTTTACCAATGGAGGAAGGTGTCTGGGACACCCTCTTTAAACAGATTGGTGCTGCT

CTCAACAC
Translation
 MAKKVAVIGAGVSGLSSIKCCLDENLEPTCFERTSDFGGLWKFA DTSEDGMTRVYRSLVTNVCKEMSCYSDFPFREDYPNFMSHEKFWDYLREFAEHF

GLLRYIRFK TTVLSVTKRPDFSETGQWDVVTETEGKRDRAVFDAVMVCTGQFLSPHLPLESFPG GIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNT

GGDIAVELSEIAAQ VFLSTRTGTWVLSRSSPGGYPFNMIQTRWLNFLVRVLPSRFINWTHERKMNKILNHENYGLSIAKG GKKPKFIVNDELPTCILC

GKVTMKTSVKDFTESSVIFEDGTTEANIDVVIFTTGYEFSFPFFEEPLKSLCTKKIILYKRVFPPNLERATLAIIGLISLNGSILVGTEFQARWATRVFK

G GLCSIPPSQKLMAEATKTEQLIKR - UNI28743 - RGVIKDTSQDKLDFITYMDELTQCIGAKPSIPLLFIKDPRLAWEVFFGPCTPYQYRLVGP

GRWDGARNAILTQWDRTLKPLKTRIVPKSPEPTSLSHYLIAWGAPVLLVSLLLIYKSSHFLELVQGKLPRRFPPYRLLWYMPQNS
Transcript ENSMUST00000111525
Sequence
AAGAGGAAACTTCCCTAGAAACTGCTCTTGGGAAGGTGAACAGAAAGTGTGTTTTTGCGGAAGGCATGTGATTAGCTTCTGAAGCCCGTTGACTAAG AC

AGGGCATGACGGAGATCTGACAACTTCTGACCTTCATCCAGAAATTCAAGAGTTCTTCACGGTGAAGGCCATTTGTCCCTGGTTAAACACCACCCCATAT

TCACAACTCAAGGGAACTCACAG AGCGCACCATGGCCAAGAAGGTGGCAGTGATTGGAGCTGGCGTAAGTGGCCTGTCCTCTATCAAGTGCTGCTTGGA

CGAGAACCTGGAGCCCACCTGCTTTGAGAGAACTAGCGACTTTGGCGGACTGTGGAAGTTTGCT GACACTTCCGAGGATGGGATGACCAGGGTTTACAG

GTCACTAGTGACAAATGTCTGCAAAGAAATGTCATGTTACAGTGACTTCCCATTCCGAGAAGATTACCCCAACTTCATGAGCCATGAGAAATTCTGGGAC

TATCTCAGAGAATTTGCTGAGCACTTTGGCCTGCTGAGATATATTCGGTTTAAG ACAACTGTGCTCAGTGTAACAAAGCGCCCAGACTTCTCTGAAACT

GGCCAGTGGGATGTTGTCACAGAGACAGAAGGCAAACGGGACAGGGCAGTATTTGACGCTGTTATGGTTTGCACTGGGCAATTCCTGAGCCCACATTTAC

CTCTGGAGTCCTTTCCTG GAATCCATAAGTTTAAAGGACAGATCCTGCACAGCCAAGAGTACAGGATTCCAGATGCCTTCCGGGGCAAGCGCATCCTGG

TGGTTGGTCTTGGAAACACTGGCGGGGACATAGCAGTAGAGCTCAGTGAAATAGCAGCTCAG GTGTTTCTCAGCACTAGAACTGGCACCTGGGTCCTAA

GCCGCTCCTCACCTGGTGGCTACCCTTTCAATATGATACAAACAAGATGGCTCAATTTCCTTGTACGAGTTCTGCCTTCACGTTTTATAAACTGGACTCA

CGAGAGGAAAATGAATAAAATACTTAACCATGAGAATTATGGATTAAGCATTGCAAAAGG GAAAAAACCAAAATTTATTGTAAATGATGAACTACCAAC

CTGTATACTTTGTGGGAAAGTCACCATGAAAACCAGCGTGAAGGATTTTACAGAATCTTCTGTCATCTTTGAAGATGGTACAACAGAAGCCAACATTGAT

GTAGTGATCTTCACTACAGGATATGAATTTTCTTTTCCCTTTTTTGAAGAACCTCTCAAAAGCCTTTGTACAAAGAAGATCATCCTATACAAGCGAGTCT

TTCCCCCAAATTTGGAGAGAGCAACATTAGCCATTATTGGCCTGATCAGCCTTAATGGGTCGATCTTAGTGGGCACAGAGTTCCAAGCACGATGGGCCAC

AAGAGTATTCAAAG GACTCTGTAGCATACCTCCATCTCAGAAACTGATGGCCGAAGCCACTAAAACGGAGCAGCTCATTAAAAG - UNI28743 - G

GGTGTGATTAAAGATACCAGCCAAGACAAACTGGACTTCATTACCTACATGGACGAGCTCACTCAGTGCATAGGCGCGAAGCCCAGCATTCCACTTTTGT

TCATTAAGGATCCAAGATTGGCTTGGGAAGTTTTCTTTGGACCATGTACCCCTTACCAATACCGCCTAGTGGGCCCTGGAAGATGGGATGGAGCCAGAAA

TGCCATCCTGACACAGTGGGACAGGACTCTGAAACCATTAAAAACTCGAATTGTTCCTAAGTCCCCCGAGCCTACCTCCCTCTCACATTACTTAATAGCT

TGGGGGGCACCTGTCCTGCTTGTCTCTCTTTTACTTATCTACAAATCTTCACATTTTCTTGAATTGGTACAAGGTAAGCTACCGAGAAGATTTCCCCCTT

ACCGATTACTGTGGTACATGCCCCAGAACTCATGAGTTGGTCTCCAGTTTACCAATGGAGGAAGGTGTCTGGGACACCCTCTTTAAACAGATTGGTGCTG

CTCTCAACAC
Translation
  MAKKVAVIGAGVSGLSSIKCCLDENLEPTCFERTSDFGGLWKFA DTSEDGMTRVYRSLVTNVCKEMSCYSDFPFREDYPNFMSHEKFWDYLREFAEH

FGLLRYIRFK TTVLSVTKRPDFSETGQWDVVTETEGKRDRAVFDAVMVCTGQFLSPHLPLESFPG GIHKFKGQILHSQEYRIPDAFRGKRILVVGLGN

TGGDIAVELSEIAAQ VFLSTRTGTWVLSRSSPGGYPFNMIQTRWLNFLVRVLPSRFINWTHERKMNKILNHENYGLSIAKG GKKPKFIVNDELPTCIL

CGKVTMKTSVKDFTESSVIFEDGTTEANIDVVIFTTGYEFSFPFFEEPLKSLCTKKIILYKRVFPPNLERATLAIIGLISLNGSILVGTEFQARWATRVF

KG GLCSIPPSQKLMAEATKTEQLIKR - UNI28743 - RGVIKDTSQDKLDFITYMDELTQCIGAKPSIPLLFIKDPRLAWEVFFGPCTPYQYRLVG

PGRWDGARNAILTQWDRTLKPLKTRIVPKSPEPTSLSHYLIAWGAPVLLVSLLLIYKSSHFLELVQGKLPRRFPPYRLLWYMPQNS

For any suggestions or comments, please send an email to unitrap@crg.es