Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026712 (Mrc1)
Chromosomal location
Chr 2: 14151041 - 14253416 (+)
Description
mannose receptor, C type 1 Gene [Source:MGI (curated);Acc:Mrc1-001]
RefSeq_dna
NM_008625 
RefSeq_peptide
NP_032651.1 
UniGene
Mm.2019 
MGI
MGI:97142 
Uniprot/SWISSPROT
Q61830 
Uniprot/SPTREMBL
Q2HZ94 
Human Ortholog
ENSG00000120586 (MRC1)
Omim not available
UniTrap UNI31345
Vector Insertion
Chr 2: 14201612 - 14210613
Public Clones (sanger) IST13898A6 (tigm) IST14995C2 (tigm) IST13145G11 (tigm) IST11838C9 (tigm)
IST13601B6 (tigm) IST10090H2 (tigm) IST13177D2 (tigm) IST13845B2 (tigm)
IST14201F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028045
Sequence
GACCTTGGACTGAGCAAAGGGGCAACCTGGGGACCTGGTTGTATTCTTTGCCTTTCCCAGTCTCCCTCTTCTCCCTCATTGGAAGATCCACTCTGGGCCA

TGAGGCTTCTCCTGCTTCTGGCTTTTATCTCTGTCATCCCTGTCTCTGTTCAGCTATTGG ACGCGAGGCAATTTTTAATCTATAATGAAGATCACAAGC

GCTGCGTGGACGCTCTAAGTGCCATCTCAGTTCAGACGGCAACTTGCAACCCGGAAGCTGAATCCCAGAAATTCCGCTGGGTGTCAGATTCTCAGATCAT

GAGTGTTGCTTTCAAATTATGTTTGGGAGTGCCATCAAAAACTGACTGGGCTTCCGTCACCCTGTATGCCTGTGATTCGAAAAGTGAATATCAGAAATGG

GAGTGTAAGAATGACACACTCTTTGGAATCAAGGGCACAGAGTTATATTTTAATTATGGCAACAGACAAGAGAAGAATATCAAGCTTTACAAAGGTTCGG

GATTGTGGAGCAGATGGAAGGTCTATGGAACCACGGATGACCTGTGCTCGAGAGGATATGAAG CCATGTACTCCTTACTGGGCAATGCAAATGGAGCCG

TCTGTGCATTTCCATTCAAGTTTGAAAACAAGTGGTATGCAGACTGCACCTCTGCCGGGCGCTCGGACGGATGGCTCTGGTGTGGAACCACCACTGACTA

CGACAAAGACAAGCTGTTTGGATTTTGTCCATTGCACT TTGAGGGAAGCGAGAGATTATGGAACAAAGATCCACTGACTGGCATTCTTTACCAGATAAA

CTCCAAGTCTGCTTTAACCTGGCATCAGGCAAGGGCAAGCTGCAAGCAGCAGAATGCTGACCTCCTGAGTGTCACGGAGATCCACGAGCAAATGTACCTC

ACAG GATTAACCAGTTCCTTGAGCTCGGGACTCTGGATTGGACTCAACAGTCTGAGTGTACGCAGTGGTTGGCAGTGGGCTGGAGGAAGCCCATTCCGG

TATCTGAACTGGCTACCAG GAAGTCCATCATCAGAGCCTGGAAAGAGCTGTGTGTCACTAAACCCTGGAAAAAATGCCAAGTGGGAAAATCTGGAATGT

GTTCAGAAGCTTGGCTACATTTGTAAAAAGGGAAACAATACCTTGAACCCATTTATCATTCCCTCAG CAAGCGATGTGCCTACCGGCTGCCCTAATCAG

TGGTGGCCCTATGCAGGCCACTGCTACAGGATCCATAGGGAAGAGAAGAAGATCCAGAAATATGCTTTGCAAGCTTGTAGGAAGGAGGGTGGGGACCTGG

CAAGTATCCACAGCATTGAGGAGTTTGACTTCATCTTCTCCCAGCTCGGATATG AGCCAAATGATGAGCTGTGGATTGGTTTAAATGACATCAAGATTC

AGATGTACTTTGAGTGGAGTGATGGAACCCCAGTGACATTTACTAAATGGCTTCCTGGAGAGCCAAGCCATGAGAACAACAGACAGGAGGACTGCGTGGT

TATGAAAGGCAAG GATGGATACTGGGCGGACAGAGCCTGTGAGCAACCACTAGGTTACATCTGTAAGATGGTATCACAAAGCCATGCTGTAGTACCGGA

GGGTGCAGACAAAGGCTGCCGGAAA GGCTGGAAACGGCATGGGTTTTACTGCTACTTGATTGGATCCACTCTATCCACCTTCACTGATGCAAACCACAC

ATGCACAAATGAAAAGGCTTATTTAACAACAGTTGAAGACAG ATATGAACAAGCATTCCTGACTAGTTTGGTTGGATTGAGGCCTGAAAAATATTTTTG

GACAGGACTCTCAGATGTTCAAAACAAAGGGACGTTTCGGTGGACTGTGGACGAGCAGGTGCAGTTTACACACTGGAATGCCGACATGCCAG - UNI31

345 - GACGAAAGGCGGGATGTGTTGCCATGAAAACCGGAGTGGCAGGTGGCTTATGGGATGTTTTGAGTTGTGAAGAAAAGGCAAAATTTGTGTGCAA

ACATTGGGCAGAAGGAGTGACTCGCCCACCAGAGCCCACAACAACTCCTGAACCCAAATGTCCAGAAAACTGGGGTACCACCAGTAAAACCAGCATGTGT

TTCAAA CTGTATGCAAAAGGAAAGCATGAAAAGAAAACGTGGTTTGAATCTCGAGATTTTTGCAAAGCTATAGGTGGAGAGCTGGCGAGCATCAAGAGT

AAAGATGAACAGCAAGTGATTTGGAGGCTGATTAC GAGCAGTGGAAGCTACCATGAGCTGTTTTGGTTGGGACTGACCTATGGAAGTCCTTCAGAGGGG

TTCACCTGGAGTGATGGTTCTCCC GTTTCCTATGAAAATTGGGCTTACGGTGAACCAAATAATTACCAAAATGTTGAATATTGTGGTGAGCTGAAAGGT

GACCCTGGCATGTCCTGGAATGATATCAACTGTGAACACCTCAACAACTGGATTTGTCAGATACAAAAAG GGAAAACACTACTACCTGAGCCCACACCT

GCTCCACAAGACA ATCCACCAGTTACTGCAGATGGGTGGGTTATTTACAAAGACTACCAGTACTATTTTAGCAAAGAGAAGGAAACCATGGACAACGCG

CGAGCATTTTGCAAGAAGAATTTTGGTGATCTTGCTACAATTAAAAGTGAAAGTGAAAAGAAGTTTCTATGGAAATAT ATAAACAAGAATGGTGGGCAG

TCACCATATTTTATTGGCATGTTAATCAGCATGGATAAGAAATTCAT TTGGATGGATGGGAGCAAAGTAGATTTTGTGGCTTGGGCTACAGGAGAACCC

AACTTTGCAAATGATGATGAAAACTGTGTAACGATGTACACAAATTCAG GGTTCTGGAATGACATCAACTGTGGTTATCCAAATAACTTCATCTGCCAG

AGACATAACAGCAGCATCAATGCCACTGCCATGCCTACCACACCCACGACACCAGGTGGCTGCAAGGAAGGTTGGCATTTGTACAAGAACAAG TGCTTT

AAAATTTTTGGATTTGCTAATGAAGAAAAAAAAAGCTGGCAAGACGCACGGCAAGCTTGCAAAGGACTGAAAGGAAACCTGGTGTCCATAGAAAATGCAC

AAGAGCAAG CATTTGTTACCTATCACATGAGAGACTCCACTTTCAATGCCTGGACTGGGCTGAATGATATCAACGCAGAACACATGTTCCTGTGGACAG

CTGGACAAGGAGTTCATTATACAAACTGGGGGAAAGGCTATCCTGGTGGAAGAAGAAGTAGCCTATCTTATGAAGAT GCTGACTGTGTAGTTGTGATTG

GTGGCAATTCACGAGAGGCAGGGACCTGGATGGATGACACCTGTGACAGTAAACAAGGCTATATATGTCAAACACAGACTG ACCCTTCCCTGCCTGTTT

CTCCAACCACTACTCCAAAAGATGGCTTTGTTACATATGGGAAAAGCAGCTATTCCCTTATGAAATTGAAGCTACCATGGCATGAAGCAGAGACATATTG

CAAGGATCATACTTCCCTGCTTGCTAGCATTCTAGACCCCTACAGTAATGCATTTGCATGGATGAAAATGCACCCATTTAATGTACCCATATGGATTGCC

CTGAACAGCAACTTG ACCAATAATGAATATACTTGGACGGATAGATGGAGGGTGCGGTACACTAACTGGGGTGCTGACGAGCCGAAGCTTAAGTCAGCA

TGTGTTTACATGGATGTTGATGGCTACTGGAGAACATCATACTGCAATGAAAGTTTTTATTTTCTCTGCAAAAAATCAGACG AAATCCCTGCTACTGAA

CCTCCTCAACTGCCTGGCAAGTGTCCAGAGTCAGAACAGACTGCGTGGATTCCTTTCTATGGCCATTGCTACTATTTTGAATCTTCTTTTACGAGAAGTT

GGGGTCAGGCTTCTCTGGAATGCCTTCGAATGG GTGCCTCCCTGGTTTCCATCGAGACTGCTGCTGAGTCCAGTTTTCTGTCATACCGTGTTGAACCTC

TTAAAAGTAAAACCAATTTTTGGATAGGCATGTTCCGAAATGTTGAAG GGAAGTGGCTTTGGTTGAACGACAATCCTGTCTCCTTTGTCAACTGGAAAA

CAGGCGATCCCTCTGGTGAACGGAATGATTGTGTAGTTCTAGCTTCATCTTCGGGCCTTTGGAATAATATCCACTGTTCTTCGTACAAAGGATTTATTTG

TAAAATGCCAAAAA TTATTGATCCTGTAACTACACACTCATCCATTACAACCAAAG CTGACCAAAGGAAGATGGATCCTCAACCCAAGGGCTCTTCTA

AAGCAGCAGGAGTGGTCACCGTGGTCCTCCTGATTGTGATAGGTGCCGGCGTTGCAGCCTATTTCTTTTATAAGAAAAGGCATGCGTTGCACATACCTCA

AGAGGCCACCTTTGAAAACACTCTCTACTTCAACAGTAATCTGAGTCCAGGAACAAGTGACACGAAAGATCTCATGGGCAACATCGAGCAGAATGAGCAT

GCGATCATTTAGCATCCTAATCTGACTGTCTCATATTCGAAGTTCAAGAAGTCTGAACTAAAGTTTTCAATTTTTTAATTCAATATGATTGTTTCTTTTT

TTAAAAAAAATTAGCACTGGGTTGCATTGGTTTGTCCTTTTTCTTCGCCTAATTGAACAATAATTGCTCATTTACTATCCTGGCAAGATTAGAGAAACAA

AAAACAGAAGAGGGATAATAATGTTGATTGTTGATTGCCACTTTTGAAGATACCTTTGATGAATACACAGCACTAGCGTCTTAACACTGCTACACTGGTG

GTAGGTCTCATGTCAACCCTGCAGATTTCAAGAGTTCTAGAAACAACCACGTAAGCCACTCAGGGTATTTTCAGGACCTCCCAGAGATATGTTATACACC

GAATTGTAATTCAACATTTAAAAGTCCATGTTAAAATAGACAAGTCCACATAACCCCAGATTGAATAAGAATGTATTCAGGTCTTTTTCAGCAGTCCTGA

TTCATGTCAGTTATTGAGAACTGTATTTATCCACATGTAGAATAATAAAGCTACTGAGAATCTTGTTTGTCCCAGGCAAGGTTTGACAGGCTGAATATTG

CAAATGTGTTCTGTGTTCTGTTGTAT
Translation
MRLLLLLAFISVIPVSVQLLD DARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQ

KWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYEA AMYSLLGNANGAVCAFPFKFENKWYADCTSAGRSDGWLWCGT

TTDYDKDKLFGFCPLHF FEGSERLWNKDPLTGILYQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTG GLTSSLSSGLWIGLNSLSVRSGWQW

AGGSPFRYLNWLPG GSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSA ASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYAL

QACRKEGGDLASIHSIEEFDFIFSQLGYE EPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVVMKGK DGYWADRACEQPLGYI

CKMVSQSHAVVPEGADKGCRK GWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDR RYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDE

QVQFTHWNADMPG - UNI31345 - GRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFK LYAKG

KHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLIT TSSGSYHELFWLGLTYGSPSEGFTWSDGSP VSYENWAYGEPNNYQNVEYCGELKGDPGMS

WNDINCEHLNNWICQIQKG GKTLLPEPTPAPQDN NPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKY INKNGGQS

PYFIGMLISMDKKFI IWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSG GFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNK

 CFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQA AFVTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYED AD

CVVVIGGNSREAGTWMDDTCDSKQGYICQTQTD DPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPF

NVPIWIALNSNL TNNEYTWTDRWRVRYTNWGADEPKLKSACVYMDVDGYWRTSYCNESFYFLCKKSDE EIPATEPPQLPGKCPESEQTAWIPFYGHCY

YFESSFTRSWGQASLECLRMG GASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFRNVEG GKWLWLNDNPVSFVNWKTGDPSGERNDCVVLASSSGLW

NNIHCSSYKGFICKMPKI IIDPVTTHSSITTKA ADQRKMDPQPKGSSKAAGVVTVVLLIVIGAGVAAYFFYKKRHALHIPQEATFENTLYFNSNLSPG

TSDTKDLMGNIEQNEHAII

For any suggestions or comments, please send an email to unitrap@crg.es