Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026739 (Bmi1)
Chromosomal location
Chr 2: 18598645 - 18608256 (+)
Description
Bmi1 polycomb ring finger oncogene Gene [Source:MGI (curated);Acc:Bmi1-001]
RefSeq_dna
NM_007552 
RefSeq_peptide
NP_031578.2 
UniGene
Mm.469658 Mm.289584 
MGI
MGI:88174 
Uniprot/SWISSPROT
P25916 
Uniprot/SPTREMBL
A2ASR5 A2ASR6 A2ASR7 A2ASR8 Q2LC58 Q3ULL2 
Human Ortholog
ENSG00000168283 (BMI1)
Omim not available
UniTrap UNI24960
Vector Insertion
Chr 2: 18603551 - 18603849
Public Clones not available
Private Clones OST199633 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000051929
Sequence
GAGGTACTTTCTGGTGTGGCATTGCTGACAGGTCTCAACTGTGAGTTTCTAAAATGTATCTGCTGGGATTATCCTTTCATCTTGTGATACTGTATGGGAG

TTAG GATCTTTTATCAAGCAGAAATGCATCGAACAACCAGAATCAAGATCACTGAGCTAAATCCCCACTTAATGTGTGTCCTGTGTGGAGGGTACTTCA

TTGATGCCACTACCATAATAGAATGTCTACATTCCT - UNI24960 - TCTGTAAAACATGTATTGTACGTTACTTGGAGACCAGCAAGTATTGTCCT

ATTTGTGATGTCCAGGTTCACAAAACCAGACCACTCCTGAACATAAG GTCAGATAAAACTCTTCAAGATATTGTATACAAATTAGTCCCAGGGCTTTTC

AAAA ATGAGATGAAGAGAAGAAGAGATTTTTATGCAGCTCACCCGTCAGCTGATG CTGCCAATGGCTCCAATGAAGACCGAGGAGAAGTTGCAGATGA

GGAGAAGAGGATTATAACTGATGATGAGATAATAAGCTTGTCTATTGAGTTCTTTGATCAGAGCAG ATTGGATCGGAAAGTAAATAAAGAGAAGCCTAA

GGAAGAG GTGAATGATAAAAGGTACTTACGATGCCCAGCAGCAATGACTGTGATGCACTTGAGAAAGTTTCTCAGGAGTAAAATGGACATACCCAATAC

TTTCCAG ATTGACGTCATGTATGAAGAGGAACCTTTAAAGGATTACTACACGCTAATGGACATTGCCTACATTTATACCTGGAGAAGA AATGGCCCAC

TACCTTTGAAATACAGAGTTCGGCCAACTTGCAAAAGAATGAAGATGAGTCACCAGAGGGATGGACTGACGAATGCTGGAGAGCTGGAAAGTGACTCTGG

GAGTGACAAGGCCAACAGCCCAGCCGGAGGTGTTCCCTCCACCTCTTCCTGTTTGCCCAGTCCCAGCACTCCAGTGCAGTCTCCTCACCCACAGTTCCCT

CACATTTCCAGTACCATGAATGGAACCAGCAACAGCCCCAGTGCTAACCACCAATCTTCCTTTGCCAGTAGACCTCGAAAATCATCACTAAATGGGTCAT

CAGCAACTTCATCTGGTTAGGACTGTTAAGGAAAAGATTTTTCAACCCCCTGATTTAGTTACCTTCATTCATTACAGCTTTATAGATGCTTAATACATGT

GACTGTCGTCCAGTTTGCTTCCTTTTGTAGTGACTTTAAATTTGGCCATAAATGATGGACTAGATGTGATACTTCATATGGATGTTAAGTGGAAAGATTG

ATTCTTTCTCTAAAGAATTGGATTCTGAGAAGGATTCTGTGTTAGGAAAGATGTGAAATGATTTCTGTGACCACTGTTTGGATCTGGAAATGTTCTACAG

TGGGTAGACATTGGGCCATAGTTTGTTAATCTCAATTAATGCCTACATTACATTCTCTTTGATTGTTCTTGTTATTATGCTGTTCTGTGAACCTGTAGAA

AACAAGTGCTTTTTATCTTGAAATTCAGCAAATGGAAAGAATAAGCATAGAATACTGCATTCTGTGCAGCCACGTCACTGTGAATAACAATTTCTTGCAT

ATTTAGCCATTTTAATTCCTGTTTGATTTTTACTTCTCTGTTGCTACACAAAATGATCAAAGGAAACTTGTTTTACAATCTGTATGCCTAAAAAGCGGGT

ACTACCGTTTATTTTACTGACTTGTTGAAATGATTCACTTTTGTAAGAATCAGATGGCATTATGCTTGTTGTACAATGCCATATTGGTATATGACATAAC

AGGAAACAGTATTGTATGATATATTTATAAATACTATGAAAATATTGTGTTTCATGCATTCAAAAACAGTTGTAAACTTCTCCAAATGGGTTCGACCTTT

GCGGATATCACAGTGCACCCAATGCTGAGGCTTACCACCAGCACAGAATTTGTTTTAATGTTGATAACCAGTTTCAAATTCTTTTCCACTTAGAAGCAAA

TGGCAGATCTTCATAGTTCTGGCTTTTCTCCAATAAGACTTTCAAAATTAATATTGCAGTAAAGAAAAATTTTAACCAAGGCAAATATAGTGTTTAATTT

TCCATTGGTTAAAATAGAATTAATGTTTTTAAATTCTGTTTATCAGTGGAATTCTAAAATAGATTTTAAAGTCAACCAGCTAATTGCTGAAGTAAAGCAT

TTTATCTACAATTTTATTTTAGTGTATGTGGCACAAGTGTAATTTCAAATTTAAGAGTTGTTTTCATAGTTAAAGGAATCTGCCTTCACTGTAACGTCTG

GAAACAGAAACAATTTGTTATGATTTCTACAGGGATTTTTAATAGAGCAAACATGTTGAATTTAAAATATGAATGACCCCTCCAAGTCTCAGTTTTGCTT

TGGTCGAACTTAGCGTGTGTTTATCAGCCATCAGTTATTTGTGAGGATGTTAATTCCGTATGAATATTGTTTCATGTTTGTATGGGAAACTGTAGCTAAG

CATTTCATTGTCTGCAGTCTGCAGAAGAAGCACAATTGTATTGCTTTGTCTTGCTTGTAGCCATTAAATCATTACTTTTACACACATTGCTGTTAACTTC

TGCTTTCTTTAAAGATTTAGTAAATGATGTTTTATGAAGCCACAAGATACATATATTTTTATTTTGACCTAAATTTGTACAGTCCCATTGTGTGTGTGTC

ATTTCTAATTATAGATGTAAAATTAAATTTCATTTTTAATTGGAAAATTCAATAAAAAGATATTCATTT
Translation
 MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSF - UNI24960 - FCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR RSDKTLQDIVYKL

VPGLFKN NEMKRRRDFYAAHPSAD     
Transcript ENSMUST00000028071
Sequence
ATAATCGTAGTATTAAAGGCAGAGATCGGGAGAGACAATGGGGAGGTTGGCGAGGGAGCCCCGCGCAGGCTTAGCAACACCTCCCGGCCCCGCAGAATAA

TACGGCTCGGCCCCTCTGCGCGCCCTCCCCCGAGCGCGGCCGGGAGGCGGCGGCTGCGCCGAGGAGGAGGAGAGGCCCCGAGGAGGCGGCGGCGGAGGCC

GCGCGGAGGCGGAGGAGGCCGCGCGGGAGGAGGAGGCCGCAGCGCGCGAGCAGGAGGCCGGCGGGGGAGCGGCATGAGCGGAGCGCGGCGGCCGTGGCTG

CTCTCGGCCGCGCTCGGTGCCCATTGACAGCGGCGGCGGCGGCTCGCTCCAAGATGGCCGCTTGGCTCGCATTCATTTTATGCTGAACGACTTTTAACTT

TCATTGTCTTTTCCGCCCGCTCAGATCGCCTCGCGCCGGCCGCTCTTTCCGG GATCTTTTATCAAGCAGAAATGCATCGAACAACCAGAATCAAGATCA

CTGAGCTAAATCCCCACTTAATGTGTGTCCTGTGTGGAGGGTACTTCATTGATGCCACTACCATAATAGAATGTCTACATTCCT - UNI24960 - TC

TGTAAAACATGTATTGTACGTTACTTGGAGACCAGCAAGTATTGTCCTATTTGTGATGTCCAGGTTCACAAAACCAGACCACTCCTGAACATAAG GTCA

GATAAAACTCTTCAAGATATTGTATACAAATTAGTCCCAGGGCTTTTCAAAA ATGAGATGAAGAGAAGAAGAGATTTTTATGCAGCTCACCCGTCAGCT

GATG CTGCCAATGGCTCCAATGAAGACCGAGGAGAAGTTGCAGATGAGGAGAAGAGGATTATAACTGATGATGAGATAATAAGCTTGTCTATTGAGTTC

TTTGATCAGAGCAG ATTGGATCGGAAAGTAAATAAAGAGAAGCCTAAGGAAGAG GTGAATGATAAAAGGTACTTACGATGCCCAGCAGCAATGACTGT

GATGCACTTGAGAAAGTTTCTCAGGAGTAAAATGGACATACCCAATACTTTCCAG ATTGACGTCATGTATGAAGAGGAACCTTTAAAGGATTACTACAC

GCTAATGGACATTGCCTACATTTATACCTGGAGAAGA AATGGCCCACTACCTTTGAAATACAGAGTTCGGCCAACTTGCAAAAGAATGAAGATGAGTCA

CCAGAGGGATGGACTGACGAATGCTGGAGAGCTGGAAAGTGACTCTGGGAGTGACAAGGCCAACAGCCCAGCCGGAGGTGTTCCCTCCACCTCTTCCTGT

TTGCCCAGTCCCAGCACTCCAGTGCAGTCTCCTCACCCACAGTTCCCTCACATTTCCAGTACCATGAATGGAACCAGCAACAGCCCCAGTGCTAACCACC

AATCTTCCTTTGCCAGTAGACCTCGAAAATCATCACTAAATGGGTCATCAGCAACTTCATCTGGTTAGGACTGTTAAGGAAAAGATTTTTCAACCCCCTG

ATTTAGTTACCTTCATTCATTACAGCTTTATAGATGCTTAATACATGTGACTGTCGTCCAGTTTGCTTCCTTTTGTAGTGACTTTAAATTTGGCCATAAA

TGATGGACTAGATGTGATACTTCATATGGATGTTAAGTGGAAAGATTGATTCTTTCTCTAAAGAATTGGATTCTGAGAAGGATTCTGTGTTAGGAAAGAT

GTGAAATGATTTCTGTGACCACTGTTTGGATCTGGAAATGTTCTACAGTGGGTAGACATTGGGCCATAGTTTGTTAATCTCAATTAATGCCTACATTACA

TTCTCTTTGATTGTTCTTGTTATTATGCTGTTCTGTGAACCTGTAGAAAACAAGTGCTTTTTATCTTGAAATTCAGCAAATGGAAAGAATAAGCATAGAA

TACTGCATTCTGTGCAGCCACGTCACTGTGAATAACAATTTCTTGCATATTTAGCCATTTTAATTCCTGTTTGATTTTTACTTCTCTGTTGCTACACAAA

ATGATCAAAGGAAACTTGTTTTACAATCTGTATGCCTAAAAAGCGGGTACTACCGTTTATTTTACTGACTTGTTGAAATGATTCACTTTTGTAAGAATCA

GATGGCATTATGCTTGTTGTACAATGCCATATTGGTATATGACATAACAGGAAACAGTATTGTATGATATATTTATAAATACTATGAAAATATTGTGTTT

CATGCATTCAAAAACAGTTGTAAACTTCTCCAAATGGGTTCGACCTTTGCGGATATCACAGTGCACCCAATGCTGAGGCTTACCACCAGCACAGAATTTG

TTTTAATGTTGATAACCAGTTTCAAATTCTTTTCCACTTAGAAGCAAATGGCAGATCTTCATAGTTCTGGCTTTTCTCCAATAAGACTTTCAAAATTAAT

ATTGCAGTAAAGAAAAATTTTAACCAAGGCAAATATAGTGTTTAATTTTCCATTGGTTAAAATAGAATTAATGTTTTTAAATTCTGTTTATCAGTGGAAT

TCTAAAATAGATTTTAAAGTCAACCAGCTAATTGCTGAAGTAAAGCATTTTATCTACAATTTTATTTTAGTGTATGTGGCACAAGTGTAATTTCAAATTT

AAGAGTTGTTTTCATAGTTAAAGGAATCTGCCTTCACTGTAACGTCTGGAAACAGAAACAATTTGTTATGATTTCTACAGGGATTTTTAATAGAGCAAAC

ATGTTGAATTTAAAATATGAATGACCCCTCCAAGTCTCAGTTTTGCTTTGGTCGAACTTAGCGTGTGTTTATCAGCCATCAGTTATTTGTGAGGATGTTA

ATTCCGTATGAATATTGTTTCATGTTTGTATGGGAAACTGTAGCTAAGCATTTCATTGTCTGCAGTCTGCAGAAGAAGCACAATTGTATTGCTTTGTCTT

GCTTGTAGCCATTAAATCATTACTTTTACACACATTGCTGTTAACTTCTGCTTTCTTTAAAGATTTAGTAAATGATGTTTTATGAAGCCACAAGATACAT

ATATTTTTATTTTGACCTAAATTTGTACAGTCCCATTGTGTGTGTGTCATTTCTAATTATAGATGTAAAATTAAATTTCATTTTTAATTGGAAAATTCAA

TAAAAAGATATTCATTTAGAAAATACTATGCTCTTTAATTAAAATTTTGCTATGAAAAGCACAGTGTGCAGAAGTTTTGGGAACCCTGTAGTGGATTGTA

AGAGCTAAAACCTAAGGAAAATACTTTGTTGTCTTCAAATGATGTTGTTAGTAAATGCTTTGTTGTATATTGCTCGAAAGCCCAATGAAAGAAGTATCTG

CTTATTTACAATCTTTGAAGCAAAAGTTACCAATGTTTGCCAATTTTGGTGAATTTAACTCATTTTTCTAGACTTTTCTCGAGGTTTTCATGGTGTTACC

TAAGACAAAAGACATCTCACCCTCTATGATGGACTTACTTCTGAGAGTGCGTTTGAGGCACTTATGGCTTACTAAGCAGTGTGTCACCATACTTGAAAAC

ACTTCCATTTATTGTATCTGGGATGAGGCTTTTTACCCTTACTCAATTTGAAAATTGCTTAAGCTTAAATGATATTTCAGTCAAAATTTGTCTTTTAATA

AAACAACAGAAAGATG
Translation
 MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSF - UNI24960 - FCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR RSDKTLQDIVYKL

VPGLFKN NEMKRRRDFYAAHPSADA AANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSR RLDRKVNKEKPKEE VNDKRYLRCPAAMTVMHLRK

FLRSKMDIPNTFQ IDVMYEEEPLKDYYTLMDIAYIYTWRR NGPLPLKYRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSP

STPVQSPHPQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG

For any suggestions or comments, please send an email to unitrap@crg.es