Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026743 (Mllt10)
Chromosomal location
Chr 2: 17976898 - 18134017 (+)
Description
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10 Gene [Source:MGI (curated);Acc:Mllt10-001]
RefSeq_dna
NM_010804 
RefSeq_peptide
NP_034934.2 
MGI
MGI:1329038 
Uniprot/SWISSPROT
O54826 
Uniprot/SPTREMBL
A2AS72 Q8C7B0 A2AS70 Q5DTL6 Q6NSP8 Q6NS43 
Human Ortholog
ENSG00000078403 (MLLT10)
Omim not available
UniTrap UNI30716
Vector Insertion
Chr 2: 17976999 - 17986211
Public Clones (sanger) 3SD067H08 (ggtc) IST11004G12 (tigm) IST13802C1 (tigm) IST12271G4 (tigm)
IST11627H4 (tigm) IST13414C8 (tigm) IST13881A6 (tigm) IST10354C4 (tigm)
IST11735B8 (tigm) IST13937G6 (tigm) IST14149H1 (tigm) IST14075A3 (tigm)
IST10946C3 (tigm) IST14241D2 (tigm) IST14311G9 (tigm) IST11842F6 (tigm)
IST12937E6 (tigm) IST14527B12 (tigm) IST11617G4 (tigm) IST14654D6 (tigm)
IST14840D6 (tigm) IST12694F6 (tigm) IST11574A2 (tigm) IST14041H3 (tigm)
IST14607C3 (tigm) IST13061B3 (tigm) IST12066A3 (tigm) IST14453A3 (tigm)
IST14529H1 (tigm) IST13320D2 (tigm) IST14239A2 (tigm) IST13884D4 (tigm)
IST11668G2 (tigm) IST14224E11 (tigm) IST14370B3 (tigm) IST13873F9 (tigm)
IST10918H9 (tigm) IST14747G12 (tigm) IST14302A6 (tigm) IST14012F10 (tigm)
IST13412F12 (tigm) IST14379E8 (tigm) IST14557C1 (tigm) IST12375G4 (tigm)
IST14522D2 (tigm) IST10146C9BBF1 (tigm) IST11933B12 (tigm) IST14710D6 (tigm)
IST12476A11 (tigm) IST14073F6 (tigm) IST14563D5 (tigm) IST10799B12 (tigm)
IST13962H6 (tigm) IST11615A4 (tigm) IST14485B4 (tigm) IST12663A6 (tigm)
IST11293G2 (tigm) IST12521A10 (tigm) IST11728A1 (tigm) IST13125C8 (tigm)
IST13886F12 (tigm) IST12054F11 (tigm) IST13576B8 (tigm) IST11469B7 (tigm)
IST14157D7 (tigm) IST14704D6 (tigm) IST11004F12 (tigm) IST10785G3 (tigm)
IST14963A12 (tigm) IST14571H7 (tigm) IST14396H4 (tigm) IST11057A8 (tigm)
IST13173F6 (tigm) IST13054H2 (tigm) IST11793H2 (tigm) IST13134F3 (tigm)
IST14069D6 (tigm) IST11606G2 (tigm) IST12752E1 (tigm) IST10141B3 (tigm)
IST14319F6 (tigm) IST11884H2 (tigm) IST11627F4 (tigm) IST14311F9 (tigm)
IST14763A10 (tigm) IST14482B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20629
Vector Insertion
Chr 2: 17986492 - 17986661
Public Clones IST11733F10 (tigm)
Private Clones OST356172 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18098
Vector Insertion
Chr 2: 17986822 - 17992751
Public Clones not available
Private Clones OST430385 (lexicon) OST393025 (lexicon) OST388359 (lexicon) OST361204 (lexicon)
OST262316 (lexicon) OST261341 (lexicon) OST256584 (lexicon) OST199578 (lexicon)
OST169396 (lexicon) OST168672 (lexicon) OST159622 (lexicon) OST135089 (lexicon)
OST123056 (lexicon) OST54481 (lexicon) OST48944 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20513
Vector Insertion
Chr 2: 17992832 - 18014410
Public Clones IST14438B10 (tigm) IST14593E2 (tigm) IST14958G5 (tigm) IST14410G11 (tigm)
Private Clones OST360216 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29684
Vector Insertion
Chr 2: 18014462 - 18022630
Public Clones E118D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18978
Vector Insertion
Chr 2: 18022634 - 18023084
Public Clones not available
Private Clones OST407846 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12672
Vector Insertion
Chr 2: 18023140 - 18031408
Public Clones A019C02 (ggtc) IST10062E4 (tigm) IST14393H10 (tigm) IST11260G8 (tigm)
IST14940A2 (tigm) IST14587H4 (tigm) IST10260D3 (tigm) IST10936F12 (tigm)
IST10190B9 (tigm) IST13963F4 (tigm) IST10683G8 (tigm) IST13992E11 (tigm)
IST15018A11 (tigm) IST10120A3 (tigm) IST15019C9 (tigm) IST15077G7 (tigm)
IST11023C3 (tigm) IST10238D1 (tigm) IST14989A1 (tigm) IST14920D11 (tigm)
IST14180E4 (tigm) IST13052A9 (tigm) IST13558E7 (tigm) IST11652B9 (tigm)
IST10756G11 (tigm) IST10752B9 (tigm) IST11160C3 (tigm) IST10874A4 (tigm)
IST12543E3 (tigm) IST10190B8 (tigm) IST11793F8 (tigm) IST12343C10 (tigm)
IST11857F3 (tigm) IST13293H8 (tigm) IST13031B2 (tigm) IST10062D3 (tigm)
IST14121G1 (tigm) IST10105C7 (tigm) IST14610C6 (tigm) IST13459G4 (tigm)
IST14162D10 (tigm) IST12951A4 (tigm) IST10114G1 (tigm) IST13788A2 (tigm)
IST10873E7 (tigm) IST11309B5 (tigm) IST12878A6 (tigm) IST11845E2 (tigm)
IST14940D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16765
Vector Insertion
Chr 2: 18031408 - 18031519
Public Clones not available
Private Clones OST454727 (lexicon) OST395679 (lexicon) OST365673 (lexicon) OST65695 (lexicon)
OST31143 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31024
Vector Insertion
Chr 2: 18031519 - 18043871
Public Clones IST12973C2 (tigm) IST10034E8 (tigm) IST13069D5 (tigm) IST12355H12 (tigm)
IST13102A1 (tigm) IST11031D2 (tigm) IST14705A1 (tigm) IST14935H6 (tigm)
IST13351D4 (tigm) IST13075A8 (tigm) IST10361C4 (tigm) IST12677B2 (tigm)
IST11722H1 (tigm) IST13846B2 (tigm) IST13405B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16459
Vector Insertion
Chr 2: 18043871 - 18043976
Public Clones not available
Private Clones OST460799 (lexicon) OST436588 (lexicon) OST391492 (lexicon) OST378899 (lexicon)
OST286721 (lexicon) OST267189 (lexicon) OST217995 (lexicon) OST57108 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21077
Vector Insertion
Chr 2: 18045345 - 18045440
Public Clones not available
Private Clones OST341855 (lexicon) OST279617 (lexicon) OST242750 (lexicon) OST222028 (lexicon)
OST215484 (lexicon) OST43804 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21228
Vector Insertion
Chr 2: 18047760 - 18047857
Public Clones not available
Private Clones OST337843 (lexicon) OST337137 (lexicon) OST209975 (lexicon) OST59944 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36642
Vector Insertion
Chr 2: 18047857 - 18068403
Public Clones IST11958D2 (tigm) IST13270G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27618
Vector Insertion
Chr 2: 18068403 - 18068500
Public Clones not available
Private Clones OST55160 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28149
Vector Insertion
Chr 2: 18084514 - 18091880
Public Clones not available
Private Clones OST38588 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6447
Vector Insertion
Chr 2: 18084514 - 18091880
Public Clones CSA108 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4062
Vector Insertion
Chr 2: 18107844 - 18108024
Public Clones AP1029 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12358
Vector Insertion
Chr 2: 18119551 - 18119625
Public Clones W091F05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12366
Vector Insertion
Chr 2: 18125383 - 18127627
Public Clones W084A04 (ggtc) W066E01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114669
Sequence
ATAGGTCATATGAGCAAAGTTTAAGTGACTCTTCCTCTCACTCTCAGGATAAGCATCATGAGAAAGAGAAAAAA - UNI21228 - - UNI27618 -

 - UNI36642 - AAATATAAAGAAAAGGACAAACACAAACAAAAACACAAGAAGCAACCAGAACCGTCACCTGCCTTGGTTCCTTCTTTGACTGTTAC

TACAGAAAAA - UNI27618 - ACTTATACAAGCACTAGCAACAACTCCATATCTGGATCATTGAAGCGCTTGGAAGATACTGCAGCAAGATTTACAA

ATGCAAATTTCCAGGAAGTCTCTGCCCATACCTCTAGTGGAAAAGATGTTTCAGAGGCTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAG

CTCAGGTCAAAGGGGAAGGAAGCCTGGTGCAGGAAGAAATCCAGGAACAGCTGTGTCAGCATCTAGCCCCTTTCCACAAG CAGGATATAAGCGGGCTCA

GACTTCTGGTATAGAAGAAGAAGCTGTAAAGGAAAAGAAACGAAAAGGAAATAAGCAAAGCAAACATGGCCCCGGCCGACCCAAAGGAAACAAAAATCAA

GAAAATGTTTCTCACCTCTCAGTTTCTTCTGCTTCACCAACATCGTCCGTAGCATCAGCTGCAGGAAGTGTAACAAGCTCTAGTCTTCAGAAATCTCCTA

CGCTGCTCAGGAATGGAAGTTTGCAGAGTCTTAGTGTTGGCTCGTCTCCAGTTGGCTCAG - UNI6447 - - UNI28149 - AAATTTCCATGCAG

TATCGACATGATGGAGCTTGTCCAACAACTA CCTTCTCAGAGTTGCTGAATGCAATACACAATG - UNI4062 - GTATTTATAACAGCAATGATGT

AGCCGTATCCTTTCCAAACGTGGTGTCTGGCTCAGGATCTAGTACTCCTGTCTCTAGCTCTCATATACCTCAGCAGTCATCTGGTCATTTGCAACAGGTG

GGAGCTCTCTCCCCCTCAGCTGCGTCATCTGTAACCCCTGCTGCTGCTACAACTCAG - UNI4062 - GCAAATACCGTTTCTGGATCTTCTCTCAGT

CAGGCACCAGCCCATATGTATGGCAGTAGATTAAATCAGAATCCATCCATGGCAGTTCTCATAGCTCAGTCTGAAAGCAGCCAAACAG - UNI12358 

- ATCAAGATCTTGGAGACAATGCCCGTAGCCTGGGTGGCCGAGGAAGCTCGCCCCGAGGAAGCCTCTCTCCGAG - UNI12358 - ATCCCCTGTGA

GCAACTTACAGCTTCGCTATGATCAACCGAGCAATAGCAGTTTGGAAACTGTGCCTCCAGTAGCAGCAAGTATTGAACAGCTCTTGGAGAGGCAGTGGAG

TGAAGGACAGCAGTTTTTACTAGAGCAGGGGACTCCTGGTGACA - UNI12366 - TTCTAGGAATGTTAAAGTCATTACATCAACTTCAAGTTGAAA

ATCGAAGATTAGAAGAACAGATCAAAAATTTGACTGCCAAGAAAGAACGTCTTCAGTTGTTGAATGCACAGCTTTCAGTGCCTTTCCCAGCCATAACGAC

AAACCCCAGTCCGTCCCATCAGATGCACACATACACAGCACAGACTG CTCCTCCTCCTGATTCCCTGAACAGCAGTAAGAGCCCACATATAGGAAACAG

CTTTTTACCTGACAATTCTCTTCCTGTATTAAATCAG GACTTGACCTCCAGTGGACAAAGCACCAGCAGTTCTTCTGCTCTTTCTACTCCCCCTCCTGC

TGGCCAGAGTCCTGCTCAGCAGAGCTCTGGAGTCAGTGGGGTTCAGCAGGTGAATGGCGTGACAGTGGGGGCACTAGCTAGTGGGATGCAGACCGTCACA

TCCACCATCCCAGCTGTGTCCGCAGTGGGTGGAATAATTGGAGCTCTGCCAGGTAACCAACTGGCAATTAACGGCATTGTGGGAGCTTTAAATGGTGTGA

TTCAGACTCCAGTCACAATCTCCCAGAACCCTGCCCCTCTCACCCACACCAGTGTACCACCTAATGCAGCGCATCCAATGCCGGCCGCCGCACTGACCAA

CAG TGCCTCGGGACTAGGGCTGCTGTCGGACCAGCAGAGACAGATGTTTATCCAGCAGCAGCAGTTCCAGCAGCTGTTAAACTCCCAGCAGCTCACACC

C GAACAGCATCAGGCCTTCCTATACCAGCTGATGCAGCAGCAGCACCACCCGCCTGAGCTCCAGCAGCTGCAGCTCCCGGGACCCACGCAGATCCCCAT

CAACAATCTCCTTGCAGGTGCTCAGGCGCCTCCACTCCACACAGCTACCACCAACCCCTTCCTCACCATCCACGGGGACAGCACGAGCCAGAAGGTCACA

 AGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACTTGAAAATGGCCAGAACTCGCCTTTCCTGCTGTTCTGTGCTTCACTGGCTG

CTGCAGTGTCTGCCACAGCTATGAAGAATGGAGGCGGGAACACACAGGGGAGGATGCCACACACTCCCTTGTAAGGCTCTGATTTTCTTGTTGCTTTGTT

GCACTGAAATGGAATTCCTATATACCCATCCCCTACCAAAGTGTTTGAACTTCGGAAGAAAAATTAATAACTTTTTGTCAATGAAATAATTCATATGCAA

TGAGTTTATCAATCCAAGAAAAATGTAATGTGCTTGCTGCACAGCTAGTTTTGTTATAAATTGGAAACATAAAACTAAAGACTATTCTATTTGGAAACCA

CTTGGTTATATCATAAAAGTTGGAATATAACTATCTTATTGGGATAGAGTGTGCTTGTTCCACGGGGCAGATCTTAAGTTTTGAGAACTGTCTAATATCT

TCTCTTGGAGTTGTATTCATTAAATATTGTTATTATACAGATCCTCAACTGGGGCTTTGCAAATGTTTTAAAGAATTCCTTTCTAATGAGATTTGTCCAT

TTGGAGATCAAATTAGGATGGAGACAACTGCTTCTGCTAACAGTAGTTTTCTTTTGCAAAAGAAAAAAATTTTGTGTGTGTGTTAAAACCTACTCTTGAG

TTAAGGGAGCTGTAAGGCTGCTGGGAGAACTAGATCAATTGGATGAGAACAGTTTCTTTCAGAAAGATACACCAATGTGGAAACTGCTGCAAGGTTCTAG

CATCAAATTGCCTGTTGGGACCTCCCTGGATAGAAAGGGCTCTGTACTGCCGGGCAGGCCACTTGTGCCAGCAGCTTCCCCGTGCTTCTGTCTCTGTTGA

ACCTTTCTGTGCCACCAGAGAGAGCTCAGGCAAACTGACTGTCCACAAGGAAACAAGTAGACCTGGGAAGAGTCTACATGCTTGCTTATCTCATCAGCCT

CAAACCACCCACTGGAACAGGCACACCACCACAGTTCCTAAAACCTGTCCCACAGCCTTCCGACTTAGCCATGCCCCGAGTAGCCATGCTCTTGATTGTG

ACAATATGGCAGCCTAGTAGGTTAGACAGTTGGGGATATAATCATTGGTCTGTTTCTGAAACACATGAATTACTGGTGGGAAAGGCCCAACTGCAGTTCG

ACCTCCACTGTGTGCTTAGCTGGAAGACCATGTGCACGGCTTAGCAGTCTGTCTTCTGTGACACTGCACACCTCTTACCTCACTTCTGTAAATAAGGTTG

TGAATCTGTTTTGTAATGTGAAAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTT

ATTTTTATATGTTCAGGGGAATTTTAAAGAAAGTCAAACCTTTTGTAGATAATTTAAAAGAATCAGTGTGGTTTATTTTATATATGTAACCCACTGGTTG

TTATTCTGTAACAATTTGTATAAATGGTAAATTTTTGAATGTGCTGTTATTTTACTTAGATGTAAAATTCCACATGTATTAAAATGTACAAAGTTTTTGT

TAATAAAATTTAATGATGTT
Translation
 - UNI21228 - - UNI27618 - - UNI36642 -  - UNI27618 -   - UNI6447 - - UNI28149 - MQYRHDGACPTTT TFSEL

LNAIHNG - UNI4062 - GIYNSNDVAVSFPNVVSGSGSSTPVSSSHIPQQSSGHLQQVGALSPSAASSVTPAAATTQ - UNI4062 - ANTVSGS

SLSQAPAHMYGSRLNQNPSMAVLIAQSESSQTD - UNI12358 - DQDLGDNARSLGGRGSSPRGSLSPR - UNI12358 - RSPVSNLQLRYDQP

SNSSLETVPPVAASIEQLLERQWSEGQQFLLEQGTPGDI - UNI12366 - ILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPAIT

TNPSPSHQMHTYTAQTA APPPDSLNSSKSPHIGNSFLPDNSLPVLNQ DLTSSGQSTSSSSALSTPPPAGQSPAQQSSGVSGVQQVNGVTVGALASGMQ

TVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVIQTPVTISQNPAPLTHTSVPPNAAHPMPAAALTNS SASGLGLLSDQQRQMFIQQQQFQQLLNS

QQLTP EQHQAFLYQLMQQQHHPPELQQLQLPGPTQIPINNLLAGAQAPPLHTATTNPFLTIHGDSTSQKVT RLSDKTGPVAQEKS
Transcript ENSMUST00000114670
Sequence
AAA - UNI18978 - AGATGTGAGCTGTGTCCCCATAAAGATGGAGCTTTAAAAAGAACAGATAATGGGG - UNI12672 - - UNI16765 - G

TTGGGCTCATGTGGTTTGTGCCCTCTATATTCCAGAGGTACAATTTGCCAATGTTTCTACAATGGAGCCAATCGTTTTACAGTCTGTCCCACATGATCGT

TATAATAAG - UNI16459 - - UNI16765 - - UNI31024 - ACTTGCTATATATGTGATGAACAAGGACGAGAAAGCAAAGCAGCCACTGGT

GCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATG - UNI16459 - - UNI21077 - TGCTCAGTTTGCCGGGCTGC

TTTGTGAAGAAGAAGGGAATGGCGCAGACAATGTTCAATACTGTGGCTACTGTAAATACCACTTTAGTAAGCTG - UNI21077 - - UNI21228 -

 AAAAAGAGCAAACGGGGATCTAATAGGTCATATGAGCAAAGTTTAAGTGACTCTTCCTCTCACTCTCAGGATAAGCATCATGAGAAAGAGAAAAAA - 

UNI21228 - - UNI27618 - - UNI36642 - AAATATAAAGAAAAGGACAAACACAAACAAAAACACAAGAAGCAACCAGAACCGTCACCTGCC

TTGGTTCCTTCTTTGACTGTTACTACAGAAAAA - UNI27618 - ACTTATACAAGCACTAGCAACAACTCCATATCTGGATCATTGAAGCGCTTGGA

AGATACTGCAGCAAGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCCCATACCTCTAGTGGAAAAGATGTTTCAGAGGCTAGAGGGTCAGAGGGCAAA

GGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGGAAGCCTGGTGCAGGAAGAAATCCAGGAACAGCTGTGTCAGCATCTAGCCCCTTTCCAC

AAG GCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGACTTCTTAAGCTTTACAGACTCAGATCTGC

GAAGTGACAGTTACACTCACACCCAGCAGCCATCATCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGCGGCAGTAAACAGTTTTAGCTC

TTTAGTTGGTCACCCTGTGACCTCGACTGTTATTTCACAGCCTAAAAGCTTTGACAATTCACCTGGAGAGTTGGGTAGTTCGAGCCTCCCTACAGCAGGA

TATAAGCGGGCTCAGACTTCTGGTATAGAAGAAGAAGCTGTAAAGGAAAAGAAACGAAAAGGAAATAAGCAAAGCAAACATGGCCCCGGCCGACCCAAAG

GAAACAAAAATCAAGAAAATGTTTCTCACCTCTCAGTTTCTTCTGCTTCACCAACATCGTCCGTAGCATCAGCTGCAGGAAGTGTAACAAGCTCTAGTCT

TCAGAAATCTCCTACGCTGCTCAGGAATGGAAGTTTGCAGAGTCTTAGTGTTGGCTCGTCTCCAGTTGGCTCAG - UNI6447 - - UNI28149 - 

AAATTTCCATGCAGTATCGACATGATGGAGCTTGTCCAACAACTA CCTTCTCAGAGTTGCTGAATGCAATACACAATG - UNI4062 - GTATTTAT

AACAGCAATGATGTAGCCGTATCCTTTCCAAACGTGGTGTCTGGCTCAGGATCTAGTACTCCTGTCTCTAGCTCTCATATACCTCAGCAGTCATCTGGTC

ATTTGCAACAGGTGGGAGCTCTCTCCCCCTCAGCTGCGTCATCTGTAACCCCTGCTGCTGCTACAACTCAG - UNI4062 - GCAAATACCGTTTCTG

GATCTTCTCTCAGTCAGGCACCAGCCCATATGTATGGCAGTAGATTAAATCAGAATCCATCCATGGCAGTTCTCATAGCTCAGTCTGAAAGCAGCCAAAC

AG - UNI12358 - ATCAAGATCTTGGAGACAATGCCCGTAGCCTGGGTGGCCGAGGAAGCTCGCCCCGAGGAAGCCTCTCTCCGAG - UNI12358

 - ATCCCCTGTGAGCAACTTACAGCTTCGCTATGATCAACCGAGCAATAGCAGTTTGGAAACTGTGCCTCCAGTAGCAGCAAGTATTGAACAGCTCTTG

GAGAGGCAGTGGAGTGAAGGACAGCAGTTTTTACTAGAGCAGGGGACTCCTGGTGACA - UNI12366 - TTCTAGGAATGTTAAAGTCATTACATCA

ACTTCAAGTTGAAAATCGAAGATTAGAAGAACAGATCAAAAATTTGACTGCCAAGAAAGAACGTCTTCAGTTGTTGAATGCACAGCTTTCAGTGCCTTTC

CCAGCCATAACGACAAACCCCAGTCCGTCCCATCAGATGCACACATACACAGCACAGACTG CTCCTCCTCCTGATTCCCTGAACAGCAGTAAGAGCCCA

CATATAGGAAACAGCTTTTTACCTGACAATTCTCTTCCTGTATTAAATCAG GACTTGACCTCCAGTGGACAAAGCACCAGCAGTTCTTCTGCTCTTTCT

ACTCCCCCTCCTGCTGGCCAGAGTCCTGCTCAGCAGAGCTCTGGAGTCAGTGGGGTTCAGCAGGTGAATGGCGTGACAGTGGGGGCACTAGCTAGTGGGA

TGCAGACCGTCACATCCACCATCCCAGCTGTGTCCGCAGTGGGTGGAATAATTGGAGCTCTGCCAGGTAACCAACTGGCAATTAACGGCATTGTGGGAGC

TTTAAATGGTGTGATTCAGACTCCAGTCACAATCTCCCAGAACCCTGCCCCTCTCACCCACACCAGTGTACCACCTAATGCAGCGCATCCAATGCCGGCC

GCCGCACTGACCAACAG TGCCTCGGGACTAGGGCTGCTGTCGGACCAGCAGAGACAGATGTTTATCCAGCAGCAGCAGTTCCAGCAGCTGTTAAACTCC

CAGCAGCTCACACCC GAACAGCATCAGGCCTTCCTATACCAGCTGATGCAGCAGCAGCACCACCCGCCTGAGCTCCAGCAGCTGCAGCTCCCGGGACCC

ACGCAGATCCCCATCAACAATCTCCTTGCAGGTGCTCAGGCGCCTCCACTCCACACAGCTACCACCAACCCCTTCCTCACCATCCACGGGGACAGCACGA

GCCAGAAGGTCACA AGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACTTGAAAATGGCCAGAACTCGCCTTTCCTGCTGTTCTG

TGCTTCACTGGCTGCTGCAGTGTCTGCCACAGCTATGAAGAATGGAGGCGGGAACACACAGGGGAGGATGCCACACACTCCCTTGTAAGGCTCTGATTTT

CTTGTTGCTTTGTTGCACTGAAATGGAATTCCTATATACCCATCCCCTACCAAAGTGTTTGAACTTCGGAAGAAAAATTAATAACTTTTTGTCAATGAAA

TAATTCATATGCAATGAGTTTATCAATCCAAGAAAAATGTAATGTGCTTGCTGCACAGCTAGTTTTGTTATAAATTGGAAACATAAAACTAAAGACTATT

CTATTTGGAAACCACTTGGTTATATCATAAAAGTTGGAATATAACTATCTTATTGGGATAGAGTGTGCTTGTTCCACGGGGCAGATCTTAAGTTTTGAGA

ACTGTCTAATATCTTCTCTTGGAGTTGTATTCATTAAATATTGTTATTATACAGATCCTCAACTGGGGCTTTGCAAATGTTTTAAAGAATTCCTTTCTAA

TGAGATTTGTCCATTTGGAGATCAAATTAGGATGGAGACAACTGCTTCTGCTAACAGTAGTTTTCTTTTGCAAAAGAAAAAAATTTTGTGTGTGTGTTAA

AACCTACTCTTGAGTTAAGGGAGCTGTAAGGCTGCTGGGAGAACTAGATCAATTGGATGAGAACAGTTTCTTTCAGAAAGATACACCAATGTGGAAACTG

CTGCAAGGTTCTAGCATCAAATTGCCTGTTGGGACCTCCCTGGATAGAAAGGGCTCTGTACTGCCGGGCAGGCCACTTGTGCCAGCAGCTTCCCCGTGCT

TCTGTCTCTGTTGAACCTTTCTGTGCCACCAGAGAGAGCTCAGGCAAACTGACTGTCCACAAGGAAACAAGTAGACCTGGGAAGAGTCTACATGCTTGCT

TATCTCATCAGCCTCAAACCACCCACTGGAACAGGCACACCACCACAGTTCCTAAAACCTGTCCCACAGCCTTCCGACTTAGCCATGCCCCGAGTAGCCA

TGCTCTTGATTGTGACAATATGGCAGCCTAGTAGGTTAGACAGTTGGGGATATAATCATTGGTCTGTTTCTGAAACACATGAATTACTGGTGGGAAAGGC

CCAACTGCAGTTCGACCTCCACTGTGTGCTTAGCTGGAAGACCATGTGCACGGCTTAGCAGTCTGTCTTCTGTGACACTGCACACCTCTTACCTCACTTC

TGTAAATAAGGTTGTGAATCTGTTTTGTAATGTGAAAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAA

AGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGAAAGTCAAACCTTTTGTAGATAATTTAAAAGAATCAGTGTGGTTTATTTTATATATG

TAACCCACTGGTTGTTATTCTGTAACAATTTGTATAAATGGTAAATTTTTGAATGTGCTGTTATTTTACTTAGATGTAAAATTCCACATGTATTAAAATG

TACAAAGTTTTTGTTAATAAAATTTAATGATGTTTAT
Translation
K - UNI18978 - RCELCPHKDGALKRTDNGG - UNI12672 - - UNI16765 - GWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNK -

 UNI16459 - - UNI16765 - - UNI31024 - TCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC - UNI16459 - - UNI21077 - 

CAQFAGLLCEEEGNGADNVQYCGYCKYHFSKL - UNI21077 - - UNI21228 - KKSKRGSNRSYEQSLSDSSSHSQDKHHEKEKK - UNI212

28 - - UNI27618 - - UNI36642 - KYKEKDKHKQKHKKQPEPSPALVPSLTVTTEK - UNI27618 - TYTSTSNNSISGSLKRLEDTAAR

FTNANFQEVSAHTSSGKDVSEARGSEGKGKKSSAHSSGQRGRKPGAGRNPGTAVSASSPFPQG GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRSDS

YTHTQQPSSTKDVHKGESGSQEAAVNSFSSLVGHPVTSTVISQPKSFDNSPGELGSSSLPTAGYKRAQTSGIEEEAVKEKKRKGNKQSKHGPGRPKGNKN

QENVSHLSVSSASPTSSVASAAGSVTSSSLQKSPTLLRNGSLQSLSVGSSPVGSE - UNI6447 - - UNI28149 - EISMQYRHDGACPTTT TF

SELLNAIHNG - UNI4062 - GIYNSNDVAVSFPNVVSGSGSSTPVSSSHIPQQSSGHLQQVGALSPSAASSVTPAAATTQ - UNI4062 - ANTV

SGSSLSQAPAHMYGSRLNQNPSMAVLIAQSESSQTD - UNI12358 - DQDLGDNARSLGGRGSSPRGSLSPR - UNI12358 - RSPVSNLQLRY

DQPSNSSLETVPPVAASIEQLLERQWSEGQQFLLEQGTPGDI - UNI12366 - ILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFP

AITTNPSPSHQMHTYTAQTA APPPDSLNSSKSPHIGNSFLPDNSLPVLNQ DLTSSGQSTSSSSALSTPPPAGQSPAQQSSGVSGVQQVNGVTVGALAS

GMQTVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVIQTPVTISQNPAPLTHTSVPPNAAHPMPAAALTNS SASGLGLLSDQQRQMFIQQQQFQQL

LNSQQLTP EQHQAFLYQLMQQQHHPPELQQLQLPGPTQIPINNLLAGAQAPPLHTATTNPFLTIHGDSTSQKVT RLSDKTGPVAQEKS
Transcript ENSMUST00000114671
Sequence
CGCCGCCCCGGGCCCAGCGGGAGCCCCCCAGTGCGCCTGTGCGGAGGCCTGCTTGATTATGTGTGCCCTCCTCGGGCGGCGGCGTTAGCGGCCGGGTGGA

GGTGGGGAGGGAGGACGCCGCGGAGGAGGAGGAGGAGGAGGAGACGGTGGCGGGGAGGTGGGGGGAGTCAGCAAGGACATGGCTCCTGACTCCTGTGCGG

AACGTGAGTGACTGAGCGGCAAAGCCCGA - UNI20629 - ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAG

GAAATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATC

AAG - UNI18098 - CTTGCTATGGCATTGTTCAAGTACCTACTGGACCGTGGTTTTGTAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTG - 

UNI20513 - TTGTTGCTTACTGTGAGCTAAGACACTTTGCCTAACCCTGAAGTCATGAAG - UNI18978 - - UNI29684 - AGATGTGAGCT

GTGTCCCCATAAAGATGGAGCTTTAAAAAGAACAGATAATGGGG - UNI12672 - - UNI16765 - GTTGGGCTCATGTGGTTTGTGCCCTCTAT

ATTCCAGAGGTACAATTTGCCAATGTTTCTACAATGGAGCCAATCGTTTTACAGTCTGTCCCACATGATCGTTATAATAAG - UNI16459 - - UNI

16765 - - UNI31024 - ACTTGCTATATATGTGATGAACAAGGACGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGAT

GTCGACAGGCTTTCCATGTAACATG - UNI16459 - - UNI21077 - TGCTCAGTTTGCCGGGCTGCTTTGTGAAGAAGAAGGGAATGGCGCAGA

CAATGTTCAATACTGTGGCTACTGTAAATACCACTTTAGTAAGCTG - UNI21077 - - UNI21228 - AAAAAGAGCAAACGGGGATCTAATAGG

TCATATGAGCAAAGTTTAAGTGACTCTTCCTCTCACTCTCAGGATAAGCATCATGAGAAAGAGAAAAAA - UNI21228 - - UNI27618 - - UN

I36642 - AAATATAAAGAAAAGGACAAACACAAACAAAAACACAAGAAGCAACCAGAACCGTCACCTGCCTTGGTTCCTTCTTTGACTGTTACTACAG

AAAAA - UNI27618 - ACTTATACAAGCACTAGCAACAACTCCATATCTGGATCATTGAAGCGCTTGGAAGATACTGCAGCAAGATTTACAAATGCA

AATTTCCAGGAAGTCTCTGCCCATACCTCTAGTGGAAAAGATGTTTCAGAGGCTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAG

GTCAAAGGGGAAGGAAGCCTGGTGCAGGAAGAAATCCAGGAACAGCTGTGTCAGCATCTAGCCCCTTTCCACAAG GCAGTTTTTCAGGAACTCCAGGCA

GTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGACTTCTTAAGCTTTACAGACTCAGATCTGCGAAGTGACAGTTACACTCACACCCAGCA

GCCATCATCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGCGGCAGTAAACAGTTTTAGCTCTTTAGTTGGTCACCCTGTGACCTCGACT

GTTATTTCACAGCCTAAAAGCTTTGACAATTCACCTGGAGAGTTGGGTAGTTCGAGCCTCCCTACAGCAGGATATAAGCGGGCTCAGACTTCTGGTATAG

AAGAAGAAGCTGTAAAGGAAAAGAAACGAAAAGGAAATAAGCAAAGCAAACATGGCCCCGGCCGACCCAAAGGAAACAAAAATCAAGAAAATGTTTCTCA

CCTCTCAGTTTCTTCTGCTTCACCAACATCGTCCGTAGCATCAGCTGCAGGAAGTGTAACAAGCTCTAGTCTTCAGAAATCTCCTACGCTGCTCAGGAAT

GGAAGTTTGCAGAGTCTTAGTGTTGGCTCGTCTCCAGTTGGCTCAG - UNI6447 - - UNI28149 - AAATTTCCATGCAGTATCGACATGATGG

AGCTTGTCCAACAACTA CCTTCTCAGAGTTGCTGAATGCAATACACAATG - UNI4062 - GTATTTATAACAGCAATGATGTAGCCGTATCCTTTC

CAAACGTGGTGTCTGGCTCAGGATCTAGTACTCCTGTCTCTAGCTCTCATATACCTCAGCAGTCATCTGGTCATTTGCAACAGGTGGGAGCTCTCTCCCC

CTCAGCTGCGTCATCTGTAACCCCTGCTGCTGCTACAACTCAG - UNI4062 - GCAAATACCGTTTCTGGATCTTCTCTCAGTCAGGCACCAGCCCA

TATGTATGGCAGTAGATTAAATCAGAATCCATCCATGGCAGTTCTCATAGCTCAGTCTGAAAGCAGCCAAACAG - UNI12358 - ATCAAGATCTTG

GAGACAATGCCCGTAGCCTGGGTGGCCGAGGAAGCTCGCCCCGAGGAAGCCTCTCTCCGAG - UNI12358 - ATCCCCTGTGAGCAACTTACAGCTT

CGCTATGATCAACCGAGCAATAGCAGTTTGGAAACTGTGCCTCCAGTAGCAGCAAGTATTGAACAGCTCTTGGAGAGGCAGTGGAGTGAAGGACAGCAGT

TTTTACTAGAGCAGGGGACTCCTGGTGACA - UNI12366 - TTCTAGGAATGTTAAAGTCATTACATCAACTTCAAGTTGAAAATCGAAGATTAGAA

GAACAGATCAAAAATTTGACTGCCAAGAAAGAACGTCTTCAGTTGTTGAATGCACAGCTTTCAGTGCCTTTCCCAGCCATAACGACAAACCCCAGTCCGT

CCCATCAGATGCACACATACACAGCACAGACTG CTCCTCCTCCTGATTCCCTGAACAGCAGTAAGAGCCCACATATAGGAAACAGCTTTTTACCTGACA

ATTCTCTTCCTGTATTAAATCAG GACTTGACCTCCAGTGGACAAAGCACCAGCAGTTCTTCTGCTCTTTCTACTCCCCCTCCTGCTGGCCAGAGTCCTG

CTCAGCAGAGCTCTGGAGTCAGTGGGGTTCAGCAGGTGAATGGCGTGACAGTGGGGGCACTAGCTAGTGGGATGCAGACCGTCACATCCACCATCCCAGC

TGTGTCCGCAGTGGGTGGAATAATTGGAGCTCTGCCAGGTAACCAACTGGCAATTAACGGCATTGTGGGAGCTTTAAATGGTGTGATTCAGACTCCAGTC

ACAATCTCCCAGAACCCTGCCCCTCTCACCCACACCAGTGTACCACCTAATGCAGCGCATCCAATGCCGGCCGCCGCACTGACCAACAG TGCCTCGGGA

CTAGGGCTGCTGTCGGACCAGCAGAGACAGATGTTTATCCAGCAGCAGCAGTTCCAGCAGCTGTTAAACTCCCAGCAGCTCACACCC GAACAGCATCAG

GCCTTCCTATACCAGCTGATGCAGCAGCAGCACCACCCGCCTGAGCTCCAGCAGCTGCAGCTCCCGGGACCCACGCAGATCCCCATCAACAATCTCCTTG

CAGGTGCTCAGGCGCCTCCACTCCACACAGCTACCACCAACCCCTTCCTCACCATCCACGGGGACAGCACGAGCCAGAAGGTCACA AGACTTAGTGATA

AAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACTTGAAAATGGCCAGAACTCGCCTTTCCTGCTGTTCTGTGCTTCACTGGCTGCTGCAGTGTCTGCC

ACAGCTATGAAGAATGGAGGCGGGAACACACAGGGGAGGATGCCACACACTCCCTTGTAAGGCTCTGATTTTCTTGTTGCTTTGTTGCACTGAAATGGAA

TTCCTATATACCCATCCCCTACCAAAGTGTTTGAACTTCGGAAGAAAAATTAATAACTTTTTGTCAATGAAATAATTCATATGCAATGAGTTTATCAATC

CAAGAAAAATGTAATGTGCTTGCTGCACAGCTAGTTTTGTTATAAATTGGAAACATAAAACTAAAGACTATTCTATTTGGAAACCACTTGGTTATATCAT

AAAAGTTGGAATATAACTATCTTATTGGGATAGAGTGTGCTTGTTCCACGGGGCAGATCTTAAGTTTTGAGAACTGTCTAATATCTTCTCTTGGAGTTGT

ATTCATTAAATATTGTTATTATACAGATCCTCAACTGGGGCTTTGCAAATGTTTTAAAGAATTCCTTTCTAATGAGATTTGTCCATTTGGAGATCAAATT

AGGATGGAGACAACTGCTTCTGCTAACAGTAGTTTTCTTTTGCAAAAGAAAAAAATTTTGTGTGTGTGTTAAAACCTACTCTTGAGTTAAGGGAGCTGTA

AGGCTGCTGGGAGAACTAGATCAATTGGATGAGAACAGTTTCTTTCAGAAAGATACACCAATGTGGAAACTGCTGCAAGGTTCTAGCATCAAATTGCCTG

TTGGGACCTCCCTGGATAGAAAGGGCTCTGTACTGCCGGGCAGGCCACTTGTGCCAGCAGCTTCCCCGTGCTTCTGTCTCTGTTGAACCTTTCTGTGCCA

CCAGAGAGAGCTCAGGCAAACTGACTGTCCACAAGGAAACAAGTAGACCTGGGAAGAGTCTACATGCTTGCTTATCTCATCAGCCTCAAACCACCCACTG

GAACAGGCACACCACCACAGTTCCTAAAACCTGTCCCACAGCCTTCCGACTTAGCCATGCCCCGAGTAGCCATGCTCTTGATTGTGACAATATGGCAGCC

TAGTAGGTTAGACAGTTGGGGATATAATCATTGGTCTGTTTCTGAAACACATGAATTACTGGTGGGAAAGGCCCAACTGCAGTTCGACCTCCACTGTGTG

CTTAGCTGGAAGACCATGTGCACGGCTTAGCAGTCTGTCTTCTGTGACACTGCACACCTCTTACCTCACTTCTGTAAATAAGGTTGTGAATCTGTTTTGT

AATGTGAAAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTC

AGGGGAATTTTAAAGAAAGTCAAACCTTTTGTAGATAATTTAAAAGAATCAGTGTGGTTTATTTTATATATGTAACCCACTGGTTGTTATTCTGTAACAA

TTTGTATAAATGGTAAATTTTTGAATGTGCTGTTATTTTACTTAGATGTAAAATTCCACATGTATTAAAATGTACAAAGTTTTTGTTAATAAAATTTAAT

GATGTTTA
Translation
 - UNI20629 -  - UNI18098 -  - UNI20513 - MK - UNI18978 - - UNI29684 - RCELCPHKDGALKRTDNGG - UNI1267

2 - - UNI16765 - GWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNK - UNI16459 - - UNI16765 - - UNI31024 - TCYICD

EQGRESKAATGACMTCNKHGCRQAFHVTC - UNI16459 - - UNI21077 - CAQFAGLLCEEEGNGADNVQYCGYCKYHFSKL - UNI21077 

- - UNI21228 - KKSKRGSNRSYEQSLSDSSSHSQDKHHEKEKK - UNI21228 - - UNI27618 - - UNI36642 - KYKEKDKHKQKHK

KQPEPSPALVPSLTVTTEK - UNI27618 - TYTSTSNNSISGSLKRLEDTAARFTNANFQEVSAHTSSGKDVSEARGSEGKGKKSSAHSSGQRGRKP

GAGRNPGTAVSASSPFPQG GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRSDSYTHTQQPSSTKDVHKGESGSQEAAVNSFSSLVGHPVTSTVISQP

KSFDNSPGELGSSSLPTAGYKRAQTSGIEEEAVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSVTSSSLQKSPTLLRNGSLQS

LSVGSSPVGSE - UNI6447 - - UNI28149 - EISMQYRHDGACPTTT TFSELLNAIHNG - UNI4062 - GIYNSNDVAVSFPNVVSGSGS

STPVSSSHIPQQSSGHLQQVGALSPSAASSVTPAAATTQ - UNI4062 - ANTVSGSSLSQAPAHMYGSRLNQNPSMAVLIAQSESSQTD - UNI12

358 - DQDLGDNARSLGGRGSSPRGSLSPR - UNI12358 - RSPVSNLQLRYDQPSNSSLETVPPVAASIEQLLERQWSEGQQFLLEQGTPGDI -

 UNI12366 - ILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPAITTNPSPSHQMHTYTAQTA APPPDSLNSSKSPHIGNSFLPDN

SLPVLNQ DLTSSGQSTSSSSALSTPPPAGQSPAQQSSGVSGVQQVNGVTVGALASGMQTVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVIQTPV

TISQNPAPLTHTSVPPNAAHPMPAAALTNS SASGLGLLSDQQRQMFIQQQQFQQLLNSQQLTP EQHQAFLYQLMQQQHHPPELQQLQLPGPTQIPINN

LLAGAQAPPLHTATTNPFLTIHGDSTSQKVT RLSDKTGPVAQEKS
Transcript ENSMUST00000091418
Sequence
CTTGATTATGTGTGCCCTCCTCGGGCGGCGGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAGGACGCCGCGGAGGAGGAGGAGGAGGAGGAGACGGTGGC

GGGGAGGTGGGGGGAGTCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGA - UNI20629 - ATGGTCTC

TAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAAATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGGGCCGAG

AACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAG - UNI18098 - CTTGCTATGGCATTGTTCAAGTACCTACTGGACC

GTGGTTTTGTAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTG - UNI12672 - - UNI16765 - - UNI18978 - - UNI20513 - -

 UNI29684 - GTTGGGCTCATGTGGTTTGTGCCCTCTATATTCCAGAGGTACAATTTGCCAATGTTTCTACAATGGAGCCAATCGTTTTACAGTCTGT

CCCACATGATCGTTATAATAAG - UNI16459 - - UNI16765 - - UNI31024 - ACTTGCTATATATGTGATGAACAAGGACGAGAAAGCAA

AGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATG - UNI16459 - - UNI21077 - TGCTCAG

TTTGCCGGGCTGCTTTGTGAAGAAGAAGGGAATGGCGCAGACAATGTTCAATACTGTGGCTACTGTAAATACCACTTTAGTAAGCTG - UNI21077 -

 - UNI21228 - AAAAAGAGCAAACGGGGATCTAATAGGTCATATGAGCAAAGTTTAAGTGACTCTTCCTCTCACTCTCAGGATAAGCATCATGAGAA

AGAGAAAAAA - UNI21228 - - UNI27618 - - UNI36642 - AAATATAAAGAAAAGGACAAACACAAACAAAAACACAAGAAGCAACCAGA

ACCGTCACCTGCCTTGGTTCCTTCTTTGACTGTTACTACAGAAAAA - UNI27618 - ACTTATACAAGCACTAGCAACAACTCCATATCTGGATCAT

TGAAGCGCTTGGAAGATACTGCAGCAAGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCCCATACCTCTAGTGGAAAAGATGTTTCAGAGGCTAGAGG

GTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGGAAGCCTGGTGCAGGAAGAAATCCAGGAACAGCTGTGTCAGCATCT

AGCCCCTTTCCACAAG GCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGACTTCTTAAGCTTTACA

GACTCAGATCTGCGAAGTGACAGTTACACTCACACCCAGCAGCCATCATCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGCGGCAGTAA

ACAGTTTTAGCTCTTTAGTTGGTCACCCTGTGACCTCGACTGTTATTTCACAGCCTAAAAGCTTTGACAATTCACCTGGAGAGTTGGGTAGTTCGAGCCT

CCCTACAGCAGGATATAAGCGGGCTCAGACTTCTGGTATAGAAGAAGAAGCTGTAAAGGAAAAGAAACGAAAAGGAAATAAGCAAAGCAAACATGGCCCC

GGCCGACCCAAAGGAAACAAAAATCAAGAAAATGTTTCTCACCTCTCAGTTTCTTCTGCTTCACCAACATCGTCCGTAGCATCAGCTGCAGGAAGTGTAA

CAAGCTCTAGTCTTCAGAAATCTCCTACGCTGCTCAGGAATGGAAGTTTGCAGAGTCTTAGTGTTGGCTCGTCTCCAGTTGGCTCAG - UNI6447 - 

- UNI28149 - AAATTTCCATGCAGTATCGACATGATGGAGCTTGTCCAACAACTA CCTTCTCAGAGTTGCTGAATGCAATACACAATG - UNI40

62 - GTATTTATAACAGCAATGATGTAGCCGTATCCTTTCCAAACGTGGTGTCTGGCTCAGGATCTAGTACTCCTGTCTCTAGCTCTCATATACCTCAG

CAGTCATCTGGTCATTTGCAACAGGTGGGAGCTCTCTCCCCCTCAGCTGCGTCATCTGTAACCCCTGCTGCTGCTACAACTCAG - UNI4062 - GCA

AATACCGTTTCTGGATCTTCTCTCAGTCAGGCACCAGCCCATATGTATGGCAGTAGATTAAATCAGAATCCATCCATGGCAGTTCTCATAGCTCAGTCTG

AAAGCAGCCAAACAG - UNI12358 - ATCAAGATCTTGGAGACAATGCCCGTAGCCTGGGTGGCCGAGGAAGCTCGCCCCGAGGAAGCCTCTCTCCG

AG - UNI12358 - ATCCCCTGTGAGCAACTTACAGCTTCGCTATGATCAACCGAGCAATAGCAGTTTGGAAACTGTGCCTCCAGTAGCAGCAAGTAT

TGAACAGCTCTTGGAGAGGCAGTGGAGTGAAGGACAGCAGTTTTTACTAGAGCAGGGGACTCCTGGTGACA - UNI12366 - TTCTAGGAATGTTAA

AGTCATTACATCAACTTCAAGTTGAAAATCGAAGATTAGAAGAACAGATCAAAAATTTGACTGCCAAGAAAGAACGTCTTCAGTTGTTGAATGCACAGCT

TTCAGTGCCTTTCCCAGCCATAACGACAAACCCCAGTCCGTCCCATCAGATGCACACATACACAGCACAGACTG CTCCTCCTCCTGATTCCCTGAACAG

CAGTAAGAGCCCACATATAGGAAACAGCTTTTTACCTGACAATTCTCTTCCTGTATTAAATCAG GACTTGACCTCCAGTGGACAAAGCACCAGCAGTTC

TTCTGCTCTTTCTACTCCCCCTCCTGCTGGCCAGAGTCCTGCTCAGCAGAGCTCTGGAGTCAGTGGGGTTCAGCAGGTGAATGGCGTGACAGTGGGGGCA

CTAGCTAGTGGGATGCAGACCGTCACATCCACCATCCCAGCTGTGTCCGCAGTGGGTGGAATAATTGGAGCTCTGCCAGGTAACCAACTGGCAATTAACG

GCATTGTGGGAGCTTTAAATGGTGTGATTCAGACTCCAGTCACAATCTCCCAGAACCCTGCCCCTCTCACCCACACCAGTGTACCACCTAATGCAGCGCA

TCCAATGCCGGCCGCCGCACTGACCAACAG TGCCTCGGGACTAGGGCTGCTGTCGGACCAGCAGAGACAGATGTTTATCCAGCAGCAGCAGTTCCAGCA

GCTGTTAAACTCCCAGCAGCTCACACCC GAACAGCATCAGGCCTTCCTATACCAGCTGATGCAGCAGCAGCACCACCCGCCTGAGCTCCAGCAGCTGCA

GCTCCCGGGACCCACGCAGATCCCCATCAACAATCTCCTTGCAGGTGCTCAGGCGCCTCCACTCCACACAGCTACCACCAACCCCTTCCTCACCATCCAC

GGGGACAGCACGAGCCAGAAGGTCACA AGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACTTGAAAATGGCCAGAACTCGCCTT

TCCTGCTGTTCTGTGCTTCACTGGCTGCTGCAGTGTCTGCCACAGCTATGAAGAATGGAGGCGGGAACACACAGGGGAGGATGCCACACACTCCCTTGTA

AGGCTCTGATTTTCTTGTTGCTTTGTTGCAC
Translation
 - UNI20629 - MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQA - UNI18098 - ACYGIVQVPTGPWFCRKC

ESQERAARV - UNI12672 - - UNI16765 - - UNI18978 - - UNI20513 - - UNI29684 - VGLMWFVPSIFQRYNLPMFLQWSQS

FYSLSHMIVIIR - UNI16459 - - UNI16765 - - UNI31024 - RLAIYVMNKDEKAKQPLVLA - UNI16459 - - UNI21077 -  

- UNI21077 - - UNI21228 -  - UNI21228 - - UNI27618 - - UNI36642 -  - UNI27618 -   - UNI6447 - - UNI2

8149 -   - UNI4062 -  - UNI4062 -  - UNI12358 -  - UNI12358 -  - UNI12366 -      
Transcript ENSMUST00000114680
Sequence
GCGTACGCCGGGTGACGCTCGGAGGAGGAAGCGCAGCCCCTTCCCCTCCCTCGCCGCCCCGGGCCCAGCGGGAGCCCCCCAGTGCGCCTGTGCGGAGGCC

TGCTTGATTATGTGTGCCCTCCTCGGGCGGCGGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAGGACGCCGCGGAGGAGGAGGAGGAGGAGGAGACGGTG

GCGGGGAGGTGGGGGGAGTCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGA - UNI20629 - ATGGTC

TCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAAATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGGGCCG

AGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAG - UNI18098 - CTTGCTATGGCATTGTTCAAGTACCTACTGGA

CCGTGGTTTTGTAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTG - UNI18978 - - UNI20513 - - UNI29684 - AGATGTGAGCTG

TGTCCCCATAAAGATGGAGCTTTAAAAAGAACAGATAATGGGG - UNI12672 - - UNI16765 - GTTGGGCTCATGTGGTTTGTGCCCTCTATA

TTCCAGAGGTACAATTTGCCAATGTTTCTACAATGGAGCCAATCGTTTTACAGTCTGTCCCACATGATCGTTATAATAAG - UNI16459 - - UNI1

6765 - - UNI31024 - ACTTGCTATATATGTGATGAACAAGGACGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATG

TCGACAGGCTTTCCATGTAACATG - UNI16459 - - UNI21077 - TGCTCAGTTTGCCGGGCTGCTTTGTGAAGAAGAAGGGAATGGCGCAGAC

AATGTTCAATACTGTGGCTACTGTAAATACCACTTTAGTAAGCTG - UNI21077 - - UNI21228 - AAAAAGAGCAAACGGGGATCTAATAGGT

CATATGAGCAAAGTTTAAGTGACTCTTCCTCTCACTCTCAGGATAAGCATCATGAGAAAGAGAAAAAA - UNI21228 - - UNI27618 - - UNI

36642 - AAATATAAAGAAAAGGACAAACACAAACAAAAACACAAGAAGCAACCAGAACCGTCACCTGCCTTGGTTCCTTCTTTGACTGTTACTACAGA

AAAA - UNI27618 - ACTTATACAAGCACTAGCAACAACTCCATATCTGGATCATTGAAGCGCTTGGAAGATACTGCAGCAAGATTTACAAATGCAA

ATTTCCAGGAAGTCTCTGCCCATACCTCTAGTGGAAAAGATGTTTCAGAGGCTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGG

TCAAAGGGGAAGGAAGCCTGGTGCAGGAAGAAATCCAGGAACAGCTGTGTCAGCATCTAGCCCCTTTCCACAAG GCAGTTTTTCAGGAACTCCAGGCAG

TGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGACTTCTTAAGCTTTACAGACTCAGATCTGCGAAGTGACAGTTACACTCACACCCAGCAG

CCATCATCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGCGGCAGTAAACAGTTTTAGCTCTTTAGTTGGTCACCCTGTGACCTCGACTG

TTATTTCACAGCCTAAAAGCTTTGACAATTCACCTGGAGAGTTGGGTAGTTCGAGCCTCCCTACAGCAGGATATAAGCGGGCTCAGACTTCTGGTATAGA

AGAAGAAGCTGTAAAGGAAAAGAAACGAAAAGGAAATAAGCAAAGCAAACATGGCCCCGGCCGACCCAAAGGAAACAAAAATCAAGAAAATGTTTCTCAC

CTCTCAGTTTCTTCTGCTTCACCAACATCGTCCGTAGCATCAGCTGCAGGAAGTGTAACAAGCTCTAGTCTTCAGAAATCTCCTACGCTGCTCAGGAATG

GAAGTTTGCAGAGTCTTAGTGTTGGCTCGTCTCCAGTTGGCTCAG - UNI6447 - - UNI28149 - AAATTTCCATGCAGTATCGACATGATGGA

GCTTGTCCAACAACTA CCTTCTCAGAGTTGCTGAATGCAATACACAATG - UNI4062 - GTATTTATAACAGCAATGATGTAGCCGTATCCTTTCC

AAACGTGGTGTCTGGCTCAGGATCTAGTACTCCTGTCTCTAGCTCTCATATACCTCAGCAGTCATCTGGTCATTTGCAACAGGTGGGAGCTCTCTCCCCC

TCAGCTGCGTCATCTGTAACCCCTGCTGCTGCTACAACTCAG - UNI4062 - GCAAATACCGTTTCTGGATCTTCTCTCAGTCAGGCACCAGCCCAT

ATGTATGGCAGTAGATTAAATCAGAATCCATCCATGGCAGTTCTCATAGCTCAGTCTGAAAGCAGCCAAACAG - UNI12358 - ATCAAGATCTTGG

AGACAATGCCCGTAGCCTGGGTGGCCGAGGAAGCTCGCCCCGAGGAAGCCTCTCTCCGAG - UNI12358 - ATCCCCTGTGAGCAACTTACAGCTTC

GCTATGATCAACCGAGCAATAGCAGTTTGGAAACTGTGCCTCCAGTAGCAGCAAGTATTGAACAGCTCTTGGAGAGGCAGTGGAGTGAAGGACAGCAGTT

TTTACTAGAGCAGGGGACTCCTGGTGACA - UNI12366 - TTCTAGGAATGTTAAAGTCATTACATCAACTTCAAGTTGAAAATCGAAGATTAGAAG

AACAGATCAAAAATTTGACTGCCAAGAAAGAACGTCTTCAGTTGTTGAATGCACAGCTTTCAGTGCCTTTCCCAGCCATAACGACAAACCCCAGTCCGTC

CCATCAGATGCACACATACACAGCACAGACTG CTCCTCCTCCTGATTCCCTGAACAGCAGTAAGAGCCCACATATAGGAAACAGCTTTTTACCTGACAA

TTCTCTTCCTGTATTAAATCAG GACTTGACCTCCAGTGGACAAAGCACCAGCAGTTCTTCTGCTCTTTCTACTCCCCCTCCTGCTGGCCAGAGTCCTGC

TCAGCAGAGCTCTGGAGTCAGTGGGGTTCAGCAGGTGAATGGCGTGACAGTGGGGGCACTAGCTAGTGGGATGCAGACCGTCACATCCACCATCCCAGCT

GTGTCCGCAGTGGGTGGAATAATTGGAGCTCTGCCAGGTAACCAACTGGCAATTAACGGCATTGTGGGAGCTTTAAATGGTGTGATTCAGACTCCAGTCA

CAATCTCCCAGAACCCTGCCCCTCTCACCCACACCAGTGTACCACCTAATGCAGCGCATCCAATGCCGGCCGCCGCACTGACCAACAG TGCCTCGGGAC

TAGGGCTGCTGTCGGACCAGCAGAGACAGATGTTTATCCAGCAGCAGCAGTTCCAGCAGCTGTTAAACTCCCAGCAGCTCACACCC GAACAGCATCAGG

CCTTCCTATACCAGCTGATGCAGCAGCAGCACCACCCGCCTGAGCTCCAGCAGCTGCAGCTCCCGGGACCCACGCAGATCCCCATCAACAATCTCCTTGC

AGGTGCTCAGGCGCCTCCACTCCACACAGCTACCACCAACCCCTTCCTCACCATCCACGGGGACAGCACGAGCCAGAAGGTCACA AGACTTAGTGATAA

AACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACTTGAAAATGGCCAGAACTCGCCTTTCCTGCTGTTCTGTGCTTCACTGGCTGCTGCAGTGTCTGCCA

CAGCTATGAAGAATGGAGGCGGGAACACACAGGGGAGGATGCCACACACTCCCTTGTAAGGCTCTGATTTTCTTGTTGCTTTGTTGCACTGAAATGGAAT

TCCTATATACCCATCCCCTACCAAAGTGTTTGAACTTCGGAAGAAAAATTAATAACTTTTTGTCAATGAAATAATTCATATGCAATGAGTTTATCAATCC

AAGAAAAATGTAATGTGCTTGCTGCACAGCTAGTTTTGTTATAAATTGGAAACATAAAACTAAAGACTATTCTATTTGGAAACCACTTGGTTATATCATA

AAAGTTGGAATATAACTATCTTATTGGGATAGAGTGTGCTTGTTCCACGGGGCAGATCTTAAGTTTTGAGAACTGTCTAATATCTTCTCTTGGAGTTGTA

TTCATTAAATATTGTTATTATACAGATCCTCAACTGGGGCTTTGCAAATGTTTTAAAGAATTCCTTTCTAATGAGATTTGTCCATTTGGAGATCAAATTA

GGATGGAGACAACTGCTTCTGCTAACAGTAGTTTTCTTTTGCAAAAGAAAAAAATTTTGTGTGTGTGTTAAAACCTACTCTTGAGTTAAGGGAGCTGTAA

GGCTGCTGGGAGAACTAGATCAATTGGATGAGAACAGTTTCTTTCAGAAAGATACACCAATGTGGAAACTGCTGCAAGGTTCTAGCATCAAATTGCCTGT

TGGGACCTCCCTGGATAGAAAGGGCTCTGTACTGCCGGGCAGGCCACTTGTGCCAGCAGCTTCCCCGTGCTTCTGTCTCTGTTGAACCTTTCTGTGCCAC

CAGAGAGAGCTCAGGCAAACTGACTGTCCACAAGGAAACAAGTAGACCTGGGAAGAGTCTACATGCTTGCTTATCTCATCAGCCTCAAACCACCCACTGG

AACAGGCACACCACCACAGTTCCTAAAACCTGTCCCACAGCCTTCCGACTTAGCCATGCCCCGAGTAGCCATGCTCTTGATTGTGACAATATGGCAGCCT

AGTAGGTTAGACAGTTGGGGATATAATCATTGGTCTGTTTCTGAAACACATGAATTACTGGTGGGAAAGGCCCAACTGCAGTTCGACCTCCACTGTGTGC

TTAGCTGGAAGACCATGTGCACGGCTTAGCAGTCTGTCTTCTGTGACACTGCACACCTCTTACCTCACTTCTGTAAATAAGGTTGTGAATCTGTTTTGTA

ATGTGAAAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCA

GGGGAATTTTAAAGAAAGTCAAACCTTTTGTAGATAATTTAAAAGAATCAGTGTGGTTTATTTTATATATGTAACCCACTGGTTGTTATTCTGTAACAAT

TTGTATAAATGGTAAATTTTTGAATGTGCTGTTATTTTACTTAGATGTAAAATTCCACATGTATTAAAATGTACAAAGTTTTTGTTAATAAAATTTAATG

ATGTTTAT
Translation
 - UNI20629 - MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQA - UNI18098 - ACYGIVQVPTGPWFCRKC

ESQERAARV - UNI18978 - - UNI20513 - - UNI29684 - RCELCPHKDGALKRTDNGG - UNI12672 - - UNI16765 - GWAHV

VCALYIPEVQFANVSTMEPIVLQSVPHDRYNK - UNI16459 - - UNI16765 - - UNI31024 - TCYICDEQGRESKAATGACMTCNKHGCR

QAFHVTC - UNI16459 - - UNI21077 - CAQFAGLLCEEEGNGADNVQYCGYCKYHFSKL - UNI21077 - - UNI21228 - KKSKRGS

NRSYEQSLSDSSSHSQDKHHEKEKK - UNI21228 - - UNI27618 - - UNI36642 - KYKEKDKHKQKHKKQPEPSPALVPSLTVTTEK - 

UNI27618 - TYTSTSNNSISGSLKRLEDTAARFTNANFQEVSAHTSSGKDVSEARGSEGKGKKSSAHSSGQRGRKPGAGRNPGTAVSASSPFPQG GS

FSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRSDSYTHTQQPSSTKDVHKGESGSQEAAVNSFSSLVGHPVTSTVISQPKSFDNSPGELGSSSLPTAGYKR

AQTSGIEEEAVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSVTSSSLQKSPTLLRNGSLQSLSVGSSPVGSE - UNI6447 

- - UNI28149 - EISMQYRHDGACPTTT TFSELLNAIHNG - UNI4062 - GIYNSNDVAVSFPNVVSGSGSSTPVSSSHIPQQSSGHLQQVGA

LSPSAASSVTPAAATTQ - UNI4062 - ANTVSGSSLSQAPAHMYGSRLNQNPSMAVLIAQSESSQTD - UNI12358 - DQDLGDNARSLGGRGS

SPRGSLSPR - UNI12358 - RSPVSNLQLRYDQPSNSSLETVPPVAASIEQLLERQWSEGQQFLLEQGTPGDI - UNI12366 - ILGMLKSLHQ

LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPAITTNPSPSHQMHTYTAQTA APPPDSLNSSKSPHIGNSFLPDNSLPVLNQ DLTSSGQSTSSSSA

LSTPPPAGQSPAQQSSGVSGVQQVNGVTVGALASGMQTVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVIQTPVTISQNPAPLTHTSVPPNAAHPM

PAAALTNS SASGLGLLSDQQRQMFIQQQQFQQLLNSQQLTP EQHQAFLYQLMQQQHHPPELQQLQLPGPTQIPINNLLAGAQAPPLHTATTNPFLTIH

GDSTSQKVT RLSDKTGPVAQEKS
Transcript ENSMUST00000028076
Sequence
TGGAATATAAGCTCTCCCGACGTTCCTAGTTACTTTCAAGGTGGATTGTGTATTTTAAGGCTGATGGGAGCGTCTGGTTTTTGGAGGAAAAAGAAGAGAA

G - UNI20629 - - UNI30716 - ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAAATGATTGGAGGC

TGTTGCGTTTGCTCAGACGAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAG - UNI18098 

- CTTGCTATGGCATTGTTCAAGTACCTACTGGACCGTGGTTTTGTAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTG - UNI18978 - - UN

I20513 - - UNI29684 - AGATGTGAGCTGTGTCCCCATAAAGATGGAGCTTTAAAAAGAACAGATAATGGGG - UNI12672 - - UNI1676

5 - GTTGGGCTCATGTGGTTTGTGCCCTCTATATTCCAGAGGTACAATTTGCCAATGTTTCTACAATGGAGCCAATCGTTTTACAGTCTGTCCCACATG

ATCGTTATAATAAG - UNI16459 - - UNI16765 - - UNI31024 - ACTTGCTATATATGTGATGAACAAGGACGAGAAAGCAAAGCAGCCA

CTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATG - UNI16459 - - UNI21077 - TGCTCAGTTTGCCGG

GCTGCTTTGTGAAGAAGAAGGGAATGGCGCAGACAATGTTCAATACTGTGGCTACTGTAAATACCACTTTAGTAAGCTG - UNI21077 - - UNI21

228 - AAAAAGAGCAAACGGGGATCTAATAGGTCATATGAGCAAAGTTTAAGTGACTCTTCCTCTCACTCTCAGGATAAGCATCATGAGAAAGAGAAAA

AA - UNI21228 - - UNI27618 - - UNI36642 - AAATATAAAGAAAAGGACAAACACAAACAAAAACACAAGAAGCAACCAGAACCGTCAC

CTGCCTTGGTTCCTTCTTTGACTGTTACTACAGAAAAA - UNI27618 - ACTTATACAAGCACTAGCAACAACTCCATATCTGGATCATTGAAGCGC

TTGGAAGATACTGCAGCAAGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCCCATACCTCTAGTGGAAAAGATGTTTCAGAGGCTAGAGGGTCAGAGG

GCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGGAAGCCTGGTGCAGGAAGAAATCCAGGAACAGCTGTGTCAGCATCTAGCCCCTT

TCCACAAG GCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGACTTCTTAAGCTTTACAGACTCAGA

TCTGCGAAGTGACAGTTACACTCACACCCAGCAGCCATCATCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGCGGCAGTAAACAGTTTT

AGCTCTTTAGTTGGTCACCCTGTGACCTCGACTGTTATTTCACAGCCTAAAAGCTTTGACAATTCACCTGGAGAGTTGGGTAGTTCGAGCCTCCCTACAG

CAGGATATAAGCGGGCTCAGACTTCTGGTATAGAAGAAGAAGCTGTAAAGGAAAAGAAACGAAAAGGAAATAAGCAAAGCAAACATGGCCCCGGCCGACC

CAAAGGAAACAAAAATCAAGAAAATGTTTCTCACCTCTCAGTTTCTTCTGCTTCACCAACATCGTCCGTAGCATCAGCTGCAGGAAGTGTAACAAGCTCT

AGTCTTCAGAAATCTCCTACGCTGCTCAGGAATGGAAGTTTGCAGAGTCTTAGTGTTGGCTCGTCTCCAGTTGGCTCAG - UNI6447 - - UNI281

49 - AAATTTCCATGCAGTATCGACATGATGGAGCTTGTCCAACAACTA CCTTCTCAGAGTTGCTGAATGCAATACACAATG - UNI4062 - GTA

TTTATAACAGCAATGATGTAGCCGTATCCTTTCCAAACGTGGTGTCTGGCTCAGGATCTAGTACTCCTGTCTCTAGCTCTCATATACCTCAGCAGTCATC

TGGTCATTTGCAACAGGTGGGAGCTCTCTCCCCCTCAGCTGCGTCATCTGTAACCCCTGCTGCTGCTACAACTCAG - UNI4062 - GCAAATACCGT

TTCTGGATCTTCTCTCAGTCAGGCACCAGCCCATATGTATGGCAGTAGATTAAATCAGAATCCATCCATGGCAGTTCTCATAGCTCAGTCTGAAAGCAGC

CAAACAG - UNI12358 - ATCAAGATCTTGGAGACAATGCCCGTAGCCTGGGTGGCCGAGGAAGCTCGCCCCGAGGAAGCCTCTCTCCGAG - UNI

12358 - ATCCCCTGTGAGCAACTTACAGCTTCGCTATGATCAACCGAGCAATAGCAGTTTGGAAACTGTGCCTCCAGTAGCAGCAAGTATTGAACAGC

TCTTGGAGAGGCAGTGGAGTGAAGGACAGCAGTTTTTACTAGAGCAGGGGACTCCTGGTGACA - UNI12366 - TTCTAGGAATGTTAAAGTCATTA

CATCAACTTCAAGTTGAAAATCGAAGATTAGAAGAACAGATCAAAAATTTGACTGCCAAGAAAGAACGTCTTCAGTTGTTGAATGCACAGCTTTCAGTGC

CTTTCCCAGCCATAACGACAAACCCCAGTCCGTCCCATCAGATGCACACATACACAGCACAGACTG CTCCTCCTCCTGATTCCCTGAACAGCAGTAAGA

GCCCACATATAGGAAACAGCTTTTTACCTGACAATTCTCTTCCTGTATTAAATCAG GACTTGACCTCCAGTGGACAAAGCACCAGCAGTTCTTCTGCTC

TTTCTACTCCCCCTCCTGCTGGCCAGAGTCCTGCTCAGCAGAGCTCTGGAGTCAGTGGGGTTCAGCAGGTGAATGGCGTGACAGTGGGGGCACTAGCTAG

TGGGATGCAGACCGTCACATCCACCATCCCAGCTGTGTCCGCAGTGGGTGGAATAATTGGAGCTCTGCCAGGTAACCAACTGGCAATTAACGGCATTGTG

GGAGCTTTAAATGGTGTGATTCAGACTCCAGTCACAATCTCCCAGAACCCTGCCCCTCTCACCCACACCAGTGTACCACCTAATGCAGCGCATCCAATGC

CGGCCGCCGCACTGACCAACAG TGCCTCGGGACTAGGGCTGCTGTCGGACCAGCAGAGACAGATGTTTATCCAGCAGCAGCAGTTCCAGCAGCTGTTAA

ACTCCCAGCAGCTCACACCC GAACAGCATCAGGCCTTCCTATACCAGCTGATGCAGCAGCAGCACCACCCGCCTGAGCTCCAGCAGCTGCAGCTCCCGG

GACCCACGCAGATCCCCATCAACAATCTCCTTGCAGGTGCTCAGGCGCCTCCACTCCACACAGCTACCACCAACCCCTTCCTCACCATCCACGGGGACAG

CACGAGCCAGAAGGTCACA AGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACTTGAAAATGGCCAGAACTCGCCTTTCCTGCTG

TTCTGTGCTTCACTGGCTGCTGCAGTGTCTGCCACAGCTATGAAGAATGGAGGCGGGAACACACAGGGGAGGATGCCACACACTCCCTTGTAAGGCTCTG

ATTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCTATATACCCATCCCCTACCAAAGTGTTTGAACTTCGGAAGAAAAATTAATAACTTTTTGTCAA

TGAAATAATTCATATGCAATGAGTTTATCAATCCAAGAAAAATGTAATGTGCTTGCTGCACAGCTAGTTTTGTTATAAATTGGAAACATAAAACTAAAGA

CTATTCTATTTGGAAACCACTTGGTTATATCATAAAAGTTGGAATATAACTATCTTATTGGGATAGAGTGTGCTTGTTCCACGGGGCAGATCTTAAGTTT

TGAGAACTGTCTAATATCTTCTCTTGGAGTTGTATTCATTAAATATTGTTATTATACAGATCCTCAACTGGGGCTTTGCAAATGTTTTAAAGAATTCCTT

TCTAATGAGATTTGTCCATTTGGAGATCAAATTAGGATGGAGACAACTGCTTCTGCTAACAGTAGTTTTCTTTTGCAAAAGAAAAAAATTTTGTGTGTGT

GTTAAAACCTACTCTTGAGTTAAGGGAGCTGTAAGGCTGCTGGGAGAACTAGATCAATTGGATGAGAACAGTTTCTTTCAGAAAGATACACCAATGTGGA

AACTGCTGCAAGGTTCTAGCATCAAATTGCCTGTTGGGACCTCCCTGGATAGAAAGGGCTCTGTACTGCCGGGCAGGCCACTTGTGCCAGCAGCTTCCCC

GTGCTTCTGTCTCTGTTGAACCTTTCTGTGCCACCAGAGAGAGCTCAGGCAAACTGACTGTCCACAAGGAAACAAGTAGACCTGGGAAGAGTCTACATGC

TTGCTTATCTCATCAGCCTCAAACCACCCACTGGAACAGGCACACCACCACAGTTCCTAAAACCTGTCCCACAGCCTTCCGACTTAGCCATGCCCCGAGT

AGCCATGCTCTTGATTGTGACAATATGGCAGCCTAGTAGGTTAGACAGTTGGGGATATAATCATTGGTCTGTTTCTGAAACACATGAATTACTGGTGGGA

AAGGCCCAACTGCAGTTCGACCTCCACTGTGTGCTTAGCTGGAAGACCATGTGCACGGCTTAGCAGTCTGTCTTCTGTGACACTGCACACCTCTTACCTC

ACTTCTGTAAATAAGGTTGTGAATCTGTTTTGTAATGTGAAAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAAT

TGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGAAAGTCAAACCTTTTGTAGATAATTTAAAAGAATCAGTGTGGTTTATTTTAT

ATATGTAACCCACTGGTTGTTATTCTGTAACAATTTGTATAAATGGTAAATTTTTGAATGTGCTGTTATTTTACTTAGATGTAAAATTCCACATGTATTA

AAATGTACAAAGTTTTTGTTAATAAAATTTAATGATGTTTATA
Translation
 - UNI20629 - - UNI30716 - MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQA - UNI18098 - ACYGI

VQVPTGPWFCRKCESQERAARV - UNI18978 - - UNI20513 - - UNI29684 - RCELCPHKDGALKRTDNGG - UNI12672 - - UNI

16765 - GWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNK - UNI16459 - - UNI16765 - - UNI31024 - TCYICDEQGRESKAA

TGACMTCNKHGCRQAFHVTC - UNI16459 - - UNI21077 - CAQFAGLLCEEEGNGADNVQYCGYCKYHFSKL - UNI21077 - - UNI21

228 - KKSKRGSNRSYEQSLSDSSSHSQDKHHEKEKK - UNI21228 - - UNI27618 - - UNI36642 - KYKEKDKHKQKHKKQPEPSPAL

VPSLTVTTEK - UNI27618 - TYTSTSNNSISGSLKRLEDTAARFTNANFQEVSAHTSSGKDVSEARGSEGKGKKSSAHSSGQRGRKPGAGRNPGTA

VSASSPFPQG GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRSDSYTHTQQPSSTKDVHKGESGSQEAAVNSFSSLVGHPVTSTVISQPKSFDNSPGE

LGSSSLPTAGYKRAQTSGIEEEAVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSVTSSSLQKSPTLLRNGSLQSLSVGSSPVG

SE - UNI6447 - - UNI28149 - EISMQYRHDGACPTTT TFSELLNAIHNG - UNI4062 - GIYNSNDVAVSFPNVVSGSGSSTPVSSSHI

PQQSSGHLQQVGALSPSAASSVTPAAATTQ - UNI4062 - ANTVSGSSLSQAPAHMYGSRLNQNPSMAVLIAQSESSQTD - UNI12358 - DQD

LGDNARSLGGRGSSPRGSLSPR - UNI12358 - RSPVSNLQLRYDQPSNSSLETVPPVAASIEQLLERQWSEGQQFLLEQGTPGDI - UNI12366

 - ILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPAITTNPSPSHQMHTYTAQTA APPPDSLNSSKSPHIGNSFLPDNSLPVLNQ D

LTSSGQSTSSSSALSTPPPAGQSPAQQSSGVSGVQQVNGVTVGALASGMQTVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVIQTPVTISQNPAPL

THTSVPPNAAHPMPAAALTNS SASGLGLLSDQQRQMFIQQQQFQQLLNSQQLTP EQHQAFLYQLMQQQHHPPELQQLQLPGPTQIPINNLLAGAQAPP

LHTATTNPFLTIHGDSTSQKVT RLSDKTGPVAQEKS

For any suggestions or comments, please send an email to unitrap@crg.es