Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026781 (Acbd5)
Chromosomal location
Chr 2: 22923688 - 22970030 (+)
Description
acyl-Coenzyme A binding domain containing 5 Gene [Source:MGI (curated);Acc:Acbd5-002]
RefSeq_peptide
NP_001095906.1 NP_001095908.1 NP_001095907.1 NP_083069.1 
UniGene
Mm.363245 Mm.399559 Mm.460353 Mm.181973 
MGI
MGI:1921409 
Uniprot/SWISSPROT
Q5XG73 
Uniprot/SPTREMBL
Q5CZX6 
Human Ortholog
ENSG00000107897 (ACBD5)
Omim not available
UniTrap UNI36455
Vector Insertion
Chr 2: 22923807 - 22924598
Public Clones IST10916H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5962
Vector Insertion
Chr 2: 22931131 - 22933663
Public Clones CSH335 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5293
Vector Insertion
Chr 2: 22935858 - 22935974
Public Clones YTB029 (baygenomics) CSH348 (baygenomics) CSH323 (baygenomics) CSH336 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9750
Vector Insertion
Chr 2: 22945109 - 22945157
Public Clones XG366 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31660
Vector Insertion
Chr 2: 22950038 - 22955084
Public Clones IST11736D12 (tigm) IST10018A9 (tigm) IST12045G8 (tigm) IST14817D8 (tigm)
IST14286C2 (tigm) IST10374A4 (tigm) IST14440B1 (tigm) IST11801A12 (tigm)
IST11704G5 (tigm) IST10294C7 (tigm) IST12488E4 (tigm) IST11916H7 (tigm)
IST12288H6 (tigm) IST14746C12 (tigm) IST13922B4 (tigm) IST14177E2 (tigm)
IST13572B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8043
Vector Insertion
Chr 2: 22955285 - 22965764
Public Clones RRJ136 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114523
Sequence
AACGGACAGGCCTTGCCAGTCATTTGGCTATATCAAG - UNI36455 - TTTCATGCAGGCTCTTGGGGAAGCTGGTGCTGCTGCTGCTGTGTGATTA

CCGCGGACAGACCTTGGGACCGAGGCCGGCGCTGGCAGCTGGAGATGGCGGACACACCGTCAGTGTATGAAACCAGATTTGAGGCGGCCGTGAAGGTGAT

CCAGAGTTTGCCGAAAAATG GATCATTCCAACCAACAAATGAAATGATGCTTAAGTTCTATAGCTTCTACAAACAGGCAACTGAAGGACCCTGTAAACT

TTCACGGCCTGGATTCTGGGATCCTATTGGAAGATATAAATG - UNI5962 - GGATGCTTGGAGTTCACTGGGTGATATGACTAAAGAAGAAGCCAT

GATTGCATATGTTGAAGAAATGAAAAAG - UNI5293 - ATTATTGAAACCATGCCCATGACTGAGAAAGTGGAAGAGTTGCTGCATGTTATAGGTCC

ATTTTACGAGATTGTAGAAGACAAAAAGAGCAGCAAGAGTTCTGACTTGACCTCAG - UNI5293 - ATCTTGGTAATGTTCTGACCTCTTCAAATGC

CAAAGCTGTTAATGGTAAAGCAGAGAGCAGTGATAGTGGGGCTGAGTCTGAAGAAGAAGAGGCCCAAGAAGAGTTAAAAGGAGCAGAACAGAGCGGCAGT

GATG - UNI9750 - ATAAGAAAACGCTGAAGAAATCAGCAGATAAGAATTTGGAAATCAT
Translation
 - UNI36455 - MADTPSVYETRFEAAVKVIQSLPKNG GSFQPTNEMMLKFYSFYKQATEGPCKL - UNI5962 -  - UNI5293 -  - UNI

5293 -  - UNI9750 - 
Transcript ENSMUST00000028121
Sequence
AGAGGAAGGTGTCCGGAAGCGCCGGGGGACTACAGTTCCCATAAGCCCGCGGGGGCAAGGTGCGGGGCAGGCGTCGAGACAAAACGGACAGGCCTTGCCA

GTCATTTGGCTATATCAAG - UNI36455 - TTTCATGCAGGCTCTTGGGGAAGCTGGTGCTGCTGCTGCTGTGTGATTACCGCGGACAGACCTTGGG

ACCGAGGCCGGCGCTGGCAGCTGGAGATGGCGGACACACCGTCAGTGTATGAAACCAGATTTGAGGCGGCCGTGAAGGTGATCCAGAGTTTGCCGAAAAA

TG GATCATTCCAACCAACAAATGAAATGATGCTTAAGTTCTATAGCTTCTACAAACAGGCAACTGAAGGACCCTGTAAACTTTCACGGCCTGGATTCTG

GGATCCTATTGGAAGATATAAATG - UNI5962 - GGATGCTTGGAGTTCACTGGGTGATATGACTAAAGAAGAAGCCATGATTGCATATGTTGAAGA

AATGAAAAAG - UNI5293 - ATTATTGAAACCATGCCCATGACTGAGAAAGTGGAAGAGTTGCTGCATGTTATAGGTCCATTTTACGAGATTGTAGA

AGACAAAAAGAGCAGCAAGAGTTCTGACTTGACCTCAG - UNI5293 - ATCTTGGTAATGTTCTGACCTCTTCAAATGCCAAAGCTGTTAATGGTAA

AGCAGAGAGCAGTGATAGTGGGGCTGAGTCTGAAGAAGAAGAGGCCCAAGAAGAGTTAAAAGGAGCAGAACAGAGCGGCAGTGATG - UNI9750 - A

TAAGAAAACGCTGAAGAAATCAGCAGATAAGAATTTGGAAATCATTGTTACCAATGGCTATAAAGGTAGCTTTGTTCAGGATATACAGAGTGACATTCAT

ACTGATTCTTCCCGGAGCACCAGAAGCAGTGAAGATGAAAAGCCTGGAGATGAGAGCTCTCAGCAGACAGGACACACCATTGTCTGTGCTCACCAAG AT

AGAAATGAAGATCCCAGTGAAGATGCTTCAGGAATACACCATTTAACAAGTGATTCAGATAGTGAAGTGTACTGTGACTCTATGGAGCAATTTGGACAAG

AAGAG TATTATTTAGGTGGTGATCCTACTCAGCACTTGGAAAGTTCTGGTTTTTGTGAAGATGCTCAGCAATCTCCTGGAAATGGCAGCATTGGGAAAA

TGTGGATGGTAGCAGTCAAAGGAAAAGGCGAAGTGAAACACGGAGGAGAAGATGGCAGAAGTAGCAGTGGAGCACCGCACCGTGAGACGAGAGGTGGAGA

GAGCGAGGACTTCTCCAGTGTCAGGAGAGGGAGAG - UNI31660 - GGAATAGAATACCACATTTGAGCGAAGGACCCAAGGGTCGGCAAGTAGGAA

GTGGAGGTGATGGAGAACGCTGGGGCTCAGACCGGGGGTCCAGAGGCAGCCTCAATGAGCAGATCGCTCTTGTGCTCATTAGATTGCAGGAGGACATGCA

GAATGTCCTTCAGAGACTTCATAAACTGGAAACACTAACTGCTTCGCAG - UNI8043 - GCGAAATTATCTTTGCAGACAAGTAATCAGCCCTCCTC

ACAG AGACCAGCTTGGTGGCCCTTTGAGATGTCCCCTGGTGCATTAGCTTTTGCTATTATATGGCCTTTTATTGCTCAGTGGTTGGCACATTTGTATTA

TCAAAGAAGGAGAAG AAAACTAAATTGAAGAAATGGCTTTTTACTCAAGAAGACTGCTGGGCCTGGACGACCTAAGAGACGGACTGGAAATGAAGTGGA

ATTCAGAAGAAAATCTCAGTTTTGATGATTACGTTGCTTTTTTGTCCAGTAGTTTGGTTTATATACATAAATATTCTTTGCACTACACAAATGGTAACAT

TTTAAAGACTAATATTGCTGATACTTGAAAAATCAATCTCAACTAGATTTTAAGTAGCATCCATAGACTTACTCTTTTTGAGCTTGAAGGACTAAATTAT

TAATTATTGTTCAGTAATGATCACCTAATTTTTCCCATAAGAATTATAAGCTGCATTTCTAAGGCATAGCTCCAATTATGAGATAAAATTTATACTTTTT

ACTTTTCTAAATTAAACACAAGAAAGAATGCAAAAACAAAAGTGATTTTTTAAAAATGAGGTTAAATCGATTTTGCATCAGTCACTGAACTGTCAGCTAC

GTGGCAGGAACCGGACGGAAGAATCCTCTCCAGGAGACTGGGCTTTAGTTAGTGGCTTGATTCCCCGGCTTGCTCAAGGGAACTCAGAAAATCATCGTCC

TTGTACTGCGCTTCTGTTTACAAACGATTCACTGAACAGACTTAACTTGATGATGGAAATGATGAAAAACAGGCCTAATGTAGGTGTAAAAGTGTATTCA

AACTCTAGACACGGCTAATCAGATTTTAATTCAATCATACACACATAATCCTTTGTAATCATTTTTCTTTTAAGTGAGGATATCTACTGTCTGCTTCATA

GGGTGCTTTGCAATAAAATGAAAACGTATTTATACTGTTTTTACTAAGGTAACAAAAGCATGATAATCCTTTTTTTTGCAAGTGTAAACGACAGTCTGGA

CTCTTAACTTCTTAGTGCCTCAGTTTTCCTTTGGGGTATACTTCACAAGGTATCAGAAGTACTTTCAGTCTACAGGTCTCTATGTCCACATAACTAAGGA

ATGCCTAACTAATGGAAACTTAAGTTCCTTCTAGCCATTAAAACAGAGAGAAGATCAATTTAGATCCCGGAACACTGTATTTGAAAAATAATCTTCCTGT

GTACTTTCTCAAACCTGCGCTCAGTAATATACTTTATTCTTTGAAGATTTAATTTAAAAACTTCATAGAAAATCCTTTTTTGCTTTTCCTTTTGAGACAG

AGTTTTGGTAGCTCCTACCAGCCTCCAATTCTCTATGTAGCTGAAGATGACCTTGACTACCTGAGTTTCCTGTCTCTACTTCTTTTCAGCTTCTGGGACC

ACAGGCCTGTACCACCATGGCCAGCTTTAGAGAGTAAAACATTTTAATTTGTTCTTGATTTGTATGATGTTGGGGGCGTTAGCATTACGTGTTGAATATT

TTGAGTAAGAAGAAAAGAATCCATCTTCAGAATATAGGGTTGTTCTTTGGGAAAAAGAGTATAAGAACATAATTTCTTTGTCCTAGACTTTACAAATTTT

TCAAAACTGTAACTTTATTTTAAACTTGTGTATCACAACTTGGTTGATATGCCTAAAATGATCTACTGGCTTTTGCTTATGATTAAAAAACCTCAAATCT

ATCTTCTACATTTTAAAAGGAAGAAAAAAAAGCAAATAACTGAATTATTATAGAAAACTTTAGACCTGTGACATTTTTTTGTTTTAAATTACAAAAGAGG

TTGGTATGATAAAGTGATGGCTTTTTTCTTATATAAATAGAATGCAAATCAAAGATATAACCAGTGTGATTGATTGCAAGTAGTCAAGTGTAACTAACTC

CTAAGGGCAACCATTTGTATCTTATATATCAGAATTACTTTATAGTTTGAAAGCACTTTGCACACATTTCCTGTATATAAAGGATGTAATTACAGGATAT

AGTGGTAATGCATTAAAACATGAACCTCATTTTAGAAATCGACAGCTATGGTATTTTTTTAATGATCAGCTTTTCTGTTTATTGTAAAACTAAGTTAAAA

AATAAAAGGTTAATGAGAAATG
Translation
 - UNI36455 - MADTPSVYETRFEAAVKVIQSLPKNG GSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKW - UNI5962 - WDAWS

SLGDMTKEEAMIAYVEEMKK - UNI5293 - IIETMPMTEKVEELLHVIGPFYEIVEDKKSSKSSDLTSD - UNI5293 - DLGNVLTSSNAKAVN

GKAESSDSGAESEEEEAQEELKGAEQSGSDD - UNI9750 - DKKTLKKSADKNLEIIVTNGYKGSFVQDIQSDIHTDSSRSTRSSEDEKPGDESSQQ

TGHTIVCAHQD DRNEDPSEDASGIHHLTSDSDSEVYCDSMEQFGQEE YYLGGDPTQHLESSGFCEDAQQSPGNGSIGKMWMVAVKGKGEVKHGGEDGR

SSSGAPHRETRGGESEDFSSVRRGRG - UNI31660 - GNRIPHLSEGPKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLIRLQEDMQNVLQRLHKL

ETLTASQ - UNI8043 - AKLSLQTSNQPSSQ RPAWWPFEMSPGALAFAIIWPFIAQWLAHLYYQRRRR RKLN
Transcript ENSMUST00000114526
Sequence
GGGTGGGGTTTGCTGCACGGCGGCCGCGGCGGCGGAGGCTAGTGGGTCCTCCGGTGACTCTGGGGCGGGGCTGTGGGGCGGCTGCCCACCGACGGCAGAA

CTTCTCAGGAATGGGGGGTGTGATTGGTTGGCCGGCATCTTCCGGGTGGGAGAAAGGGTCCGCTATCACGGGCGGCTCAACCTCCAAGGCCTGCTGCTAG

AGATGCTCTTCCTCGCG TTTCATGCAGGCTCTTGGGGAAGCTGGTGCTGCTGCTGCTGTGTGATTACCGCGGACAGACCTTGGGACCGAGGCCGGCGCT

GGCAGCTGGAGATGGCGGACACACCGTCAGTGTATGAAACCAGATTTGAGGCGGCCGTGAAGGTGATCCAGAGTTTGCCGAAAAATG GATCATTCCAAC

CAACAAATGAAATGATGCTTAAGTTCTATAGCTTCTACAAACAGGCAACTGAAGGACCCTGTAAACTTTCACGGCCTGGATTCTGGGATCCTATTGGAAG

ATATAAATG - UNI5962 - GGATGCTTGGAGTTCACTGGGTGATATGACTAAAGAAGAAGCCATGATTGCATATGTTGAAGAAATGAAAAAG - UN

I5293 - ATTATTGAAACCATGCCCATGACTGAGAAAGTGGAAGAGTTGCTGCATGTTATAGGTCCATTTTACGAGATTGTAGAAGACAAAAAGAGCAG

CAAGAGTTCTGACTTGACCTCAG - UNI5293 - ATCTTGGTAATGTTCTGACCTCTTCAAATGCCAAAGCTGTTAATGGTAAAGCAGAGAGCAGTGA

TAGTGGGGCTGAGTCTGAAGAAGAAGAGGCCCAAGAAGAGTTAAAAGGAGCAGAACAGAGCGGCAGTGATG - UNI9750 - ATAAGAAAACGCTGAA

GAAATCAGCAGATAAGAATTTGGAAATCATTGTTACCAATGGCTATAAAGGTAGCTTTGTTCAGGATATACAGAGTGACATTCATACTGATTCTTCCCGG

AGCACCAGAAGCAGTGAAGATGAAAAGCCTGGAGATGAGAGCTCTCAGCAGACAGGACACACCATTGTCTGTGCTCACCAAG ATAGAAATGAAGATCCC

AGTGAAGATGCTTCAGGAATACACCATTTAACAAGTGATTCAGATAGTGAAGTGTACTGTGACTCTATGGAGCAATTTGGACAAGAAGAG TATTATTTA

GGTGGTGATCCTACTCAGCACTTGGAAAGTTCTGGTTTTTGTGAAGATGCTCAGCAATCTCCTGGAAATGGCAGCATTGGGAAAATGTGGATGGTAGCAG

TCAAAGGAAAAGGCGAAGTGAAACACGGAGGAGAAGATGGCAGAAGTAGCAGTGGAGCACCGCACCGTGAGACGAGAGGTGGAGAGAGCGAGGACTTCTC

CAGTGTCAGGAGAGGGAGAG - UNI31660 - GGAATAGAATACCACATTTGAGCGAAGGACCCAAGGGTCGGCAAGTAGGAAGTGGAGGTGATGGAG

AACGCTGGGGCTCAGACCGGGGGTCCAGAGGCAGCCTCAATGAGCAGATCGCTCTTGTGCTCATTAGATTGCAGGAGGACATGCAGAATGTCCTTCAGAG

ACTTCATAAACTGGAAACACTAACTGCTTCGCAG - UNI8043 - GCGAAATTATCTTTGCAGACAAGTAATCAGCCCTCCTCACAG AGACCAGCTT

GGTGGCCCTTTGAGATGTCCCCTGGTGCATTAGCTTTTGCTATTATATGGCCTTTTATTGCTCAGTGGTTGGCACATTTGTATTATCAAAGAAGGAGAAG

 AAAACTAAATTGAAGAAATGGCTTTTTACTCAAGAAGACTGCTGGGCCTGGACGACCTAAGAGACGGACTGGAAATGAAGTGGAATTCAGAAGAAAATC

TCAGTTTTGATGATTACGTTGCTTTTTTGTCCAGTAGTTTGGTTTATATACATAAATATTCTTTGCACTACACAAATGGTAACATTTTAAAGACTAATAT

TGCTGATACTTGAAAAATCAATCTCAACTAGATTTTAAGTAGCATCCATAGACTTACTCTTTTTGAGCTTGAAGGACTAAATTATTAATTATTGTTCAGT

AATGATCACCTAATTTTTCCCATAAGAATTATAAGCTGCATTTCTAAGGCATAGCTCCAATTATGAGATAAAATTTATACTTTTTACTTTTCTAAATTAA

ACACAAGAAAGAATGCAAAAACAAAAGTGATTTTTTAAAAATGAGGTTAAATCGATTTTGCATCAGTCACTGAACTGTCAGCTACGTGGCAGGAACCGGA

CGGAAGAATCCTCTCCAGGAGACTGGGCTTTAGTTAGTGGCTTGATTCCCCGGCTTGCTCAAGGGAACTCAGAAAATCATCGTCCTTGTACTGCGCTTCT

GTTTACAAACGATTCACTGAACAGACTTAACTTGATGATGGAAATGATGAAAAACAGGCCTAATGTAGGTGTAAAAGTGTATTCAAACTCTAGACACGGC

TAATCAGATTTTAATTCAATCATACACACATAATCCTTTGTAATCATTTTTCTTTTAAGTGAGGATATCTACTGTCTGCTTCATAGGGTGCTTTGCAATA

AAATGAAAACGTATTTATACTGTTTTTACTAAGGTAACAAAAGCATGATAATCCTTTTTTTTGCAAGTGTAAACGACAGTCTGGACTCTTAACTTCTTAG

TGCCTCAGTTTTCCTTTGGGGTATACTTCACAAGGTATCAGAAGTACTTTCAGTCTACAGGTCTCTATGTCCACATAACTAAGGAATGCCTAACTAATGG

AAACTTAAGTTCCTTCTAGCCATTAAAACAGAGAGAAGATCAATTTAGATCCCGGAACACTGTATTTGAAAAATAATCTTCCTGTGTACTTTCTCAAACC

TGCGCTCAGTAATATACTTTATTCTTTGAAGATTTAATTTAAAAACTTCATAGAAAATCCTTTTTTGCTTTTCCTTTTGAGACAGAGTTTTGGTAGCTCC

TACCAGCCTCCAATTCTCTATGTAGCTGAAGATGACCTTGACTACCTGAGTTTCCTGTCTCTACTTCTTTTCAGCTTCTGGGACCACAGGCCTGTACCAC

CATGGCCAGCTTTAGAGAGTAAAACATTTTAATTTGTTCTTGATTTGTATGATGTTGGGGGCGTTAGCATTACGTGTTGAATATTTTGAGTAAGAAGAAA

AGAATCCATCTTCAGAATATAGGGTTGTTCTTTGGGAAAAAGAGTATAAGAACATAATTTCTTTGTCCTAGACTTTACAAATTTTTCAAAACTGTAACTT

TATTTTAAACTTGTGTATCACAACTTGGTTGATATGCCTAAAATGATCTACTGGCTTTTGCTTATGATTAAAAAACCTCAAATCTATCTTCTACATTTTA

AAAGGAAGAAAAAAAAGCAAATAACTGAATTATTATAGAAAACTTTAGACCTGTGACATTTTTTTGTTTTAAATTACAAAAGAGGTTGGTATGATAAAGT

GATGGCTTTTTTCTTATATAAATAGAATGCAAATCAAAGATATAACCAGTGTGATTGATTGCAAGTAGTCAAGTGTAACTAACTCCTAAGGGCAACCATT

TGTATCTTATATATCAGAATTACTTTATAGTTTGAAAGCACTTTGCACACATTTCCTGTATATAAAGGATGTAATTACAGGATATAGTGGTAATGCATTA

AAACATGAACCTCATTTTAGAAATCGACAGCTATGGTATTTTTTTAATGATCAGCTTTTCTGTTTATTGTAAAACTAAGTTAAAAAATAAAAGGTTAATG

AGAAA
Translation
MLFLA FHAGSWGSWCCCCCVITADRPWDRGRRWQLEMADTPSVYETRFEAAVKVIQSLPKNG GSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPI

GRYKW - UNI5962 - WDAWSSLGDMTKEEAMIAYVEEMKK - UNI5293 - IIETMPMTEKVEELLHVIGPFYEIVEDKKSSKSSDLTSD - UN

I5293 - DLGNVLTSSNAKAVNGKAESSDSGAESEEEEAQEELKGAEQSGSDD - UNI9750 - DKKTLKKSADKNLEIIVTNGYKGSFVQDIQSDI

HTDSSRSTRSSEDEKPGDESSQQTGHTIVCAHQD DRNEDPSEDASGIHHLTSDSDSEVYCDSMEQFGQEE YYLGGDPTQHLESSGFCEDAQQSPGNGS

IGKMWMVAVKGKGEVKHGGEDGRSSSGAPHRETRGGESEDFSSVRRGRG - UNI31660 - GNRIPHLSEGPKGRQVGSGGDGERWGSDRGSRGSLNE

QIALVLIRLQEDMQNVLQRLHKLETLTASQ - UNI8043 - AKLSLQTSNQPSSQ RPAWWPFEMSPGALAFAIIWPFIAQWLAHLYYQRRRR RKLN

Transcript ENSMUST00000114529
Sequence
GCTGCACGGCGGCCGCGGCGGCGGAGGCTAGTGGGTCCTCCGGTGACTCTGGGGCGGGGCTGTGGGGCGGCTGCCCACCGACGGCAGAACTTCTCAGGAA

TGGGGGGTGTGATTGGTTGGCCGGCATCTTCCGGGTGGGAGAAAGGGTCCGCTATCACGGGCGGCTCAACCTCCAAGGCCTGCTGCTAGAGATGCTCTTC

CTCGCG TTTCATGCAGGCTCTTGGGGAAGCTGGTGCTGCTGCTGCTGTGTGATTACCGCGGACAGACCTTGGGACCGAGGCCGGCGCTGGCAGCTGGAG

ATGGCGGACACACCGTCAGTGTATGAAACCAGATTTGAGGCGGCCGTGAAGGTGATCCAGAGTTTGCCGAAAAATG GATCATTCCAACCAACAAATGAA

ATGATGCTTAAGTTCTATAGCTTCTACAAACAGGCAACTGAAGGACCCTGTAAACTTTCACGGCCTGGATTCTGGGATCCTATTGGAAGATATAAATG -

 UNI5962 - GGATGCTTGGAGTTCACTGGGTGATATGACTAAAGAAGAAGCCATGATTGCATATGTTGAAGAAATGAAAAAG - UNI5293 - ATT

ATTGAAACCATGCCCATGACTGAGAAAGTGGAAGAGTTGCTGCATGTTATAGGTCCATTTTACGAGATTGTAGAAGACAAAAAGAGCAGCAAGAGTTCTG

ACTTGACCTCAG - UNI5293 - ATCTTGGTAATGTTCTGACCTCTTCAAATGCCAAAGCTGTTAATGGTAAAGCAGAGAGCAGTGATAGTGGGGCTG

AGTCTGAAGAAGAAGAGGCCCAAGAAGAGTTAAAAGGAGCAGAACAGAGCGGCAGTGAT - UNI9750 - GATAAGAAAACGCTGAAGAAATCAGCAG

ATAAGAATTTGGAAATCATTGTTACCAATGGCTATAAAGGTAGCTTTGTTCAGGATATACAGAGTGACATTCATACTGATTCTTCCCGGAGCACCAGAAG

CAGTGAAGATGAAAAGCCTGGAGATGAGAGCTCTCAGCAGACAGGACACACCATTGTCTGTGCTCACCAAG ATAGAAATGAAGATCCCAGTGAAGATGC

TTCAGGAATACACCATTTAACAAGTGATTCAGATAGTGAAGTGTACTGTGACTCTATGGAGCAATTTGGACAAGAAGAG TATTATTTAGGTGGTGATCC

TACTCAGCACTTGGAAAGTTCTGGTTTTTGTGAAGATGCTCAGCAATCTCCTGGAAATGGCAGCATTGGGAAAATGTGGATGGTAGCAGTCAAAGGAAAA

GGCGAAGTGAAACACGGAGGAGAAGATGGCAGAAGTAGCAGTGGAGCACCGCACCGTGAGACGAGAGGTGGAGAGAGCGAGGACTTCTCCAGTGTCAGGA

GAGGGAGAG - UNI31660 - TAGGGAATAGAATACCACATTTGAGCGAAGGACCCAAGGGTCGGCAAGTAGGAAGTGGAGGTGATGGAGAACGCTGG

GGCTCAGACCGGGGGTCCAGAGGCAGCCTCAATGAGCAGATCGCTCTTGTGCTCATTAGATTGCAGGAGGACATGCAGAATGTCCTTCAGAGACTTCATA

AACTGGAAACACTAACTGCTTCGCAG - UNI8043 - GCGAAATTATCTTTGCAGACAAGTAATCAGCCCTCCTCACAG AGACCAGCTTGGTGGCCC

TTTGAGATGTCCCCTGGTGCATTAGCTTTTGCTATTATATGGCCTTTTATTGCTCAGTGGTTGGCACATTTGTATTATCAAAGAAGGAGAAG AAAACTA

AATTGAAGAAATGGCTTTTTACTCAAGAAGACTGCTGGGCCTGGACGACCTAAGAGACGGACTGGAAATGAAGTGGAATTCAGAAGAAAATCTCAGTTTT

GATGATTACGTTGCTTTTTTGTCCAGTAGTTTGGTTTATATACATAAATATTCTTTGCACTACACAAATGGTAACATTTTAAAGACTAATATTGCTGATA

CTTGAAAAATCAATCTCAACTAGATTTTAAGTAGCATCCATAGACTTACTCTTTTTGAGCTTGAAGGACTAAATTATTAATTATTGTTCAGTAATGATCA

CCTAATTTTTCCCATAAGAATTATAAGCTGCATTTCTAAGGCATAGCTCCAATTATGAGATAAAATTTATACTTTTTACTTTTCTAAATTAAACACAAGA

AAGAATGCAAAAACAAAAGTGATTTTTTAAAAATGAGGTTAAATCGATTTTGCATCAGTCACTGAACTGTCAGCTACGTGGCAGGAACCGGACGGAAGAA

TCCTCTCCAGGAGACTGGGCTTTAGTTAGTGGCTTGATTCCCCGGCTTGCTCAAGGGAACTCAGAAAATCATCGTCCTTGTACTGCGCTTCTGTTTACAA

ACGATTCACTGAACAGACTTAACTTGATGATGGAAATGATGAAAAACAGGCCTAATGTAGGTGTAAAAGTGTATTCAAACTCTAGACACGGCTAATCAGA

TTTTAATTCAATCATACACACATAATCCTTTGTAATCATTTTTCTTTTAAGTGAGGATATCTACTGTCTGCTTCATAGGGTGCTTTGCAATAAAATGAAA

ACGTATTTATACTGTTTTTACTAAGGTAACAAAAGCATGATAATCCTTTTTTTTGCAAGTGTAAACGACAGTCTGGACTCTTAACTTCTTAGTGCCTCAG

TTTTCCTTTGGGGTATACTTCACAAGGTATCAGAAGTACTTTCAGTCTACAGGTCTCTATGTCCACATAACTAAGGAATGCCTAACTAATGGAAACTTAA

GTTCCTTCTAGCCATTAAAACAGAGAGAAGATCAATTTAGATCCCGGAACACTGTATTTGAAAAATAATCTTCCTGTGTACTTTCTCAAACCTGCGCTCA

GTAATATACTTTATTCTTTGAAGATTTAATTTAAAAACTTCATAGAAAATCCTTTTTTGCTTTTCCTTTTGAGACAGAGTTTTGGTAGCTCCTACCAGCC

TCCAATTCTCTATGTAGCTGAAGATGACCTTGACTACCTGAGTTTCCTGTCTCTACTTCTTTTCAGCTTCTGGGACCACAGGCCTGTACCACCATGGCCA

GCTTTAGAGAGTAAAACATTTTAATTTGTTCTTGATTTGTATGATGTTGGGGGCGTTAGCATTACGTGTTGAATATTTTGAGTAAGAAGAAAAGAATCCA

TCTTCAGAATATAGGGTTGTTCTTTGGGAAAAAGAGTATAAGAACATAATTTCTTTGTCCTAGACTTTACAAATTTTTCAAAACTGTAACTTTATTTTAA

ACTTGTGTATCACAACTTGGTTGATATGCCTAAAATGATCTACTGGCTTTTGCTTATGATTAAAAAACCTCAAATCTATCTTCTACATTTTAAAAGGAAG

AAAAAAAAGCAAATAACTGAATTATTATAGAAAACTTTAGACCTGTGACATTTTTTTGTTTTAAATTACAAAAGAGGTTGGTATGATAAAGTGATGGCTT

TTTTCTTATATAAATAGAATGCAAATCAAAGATATAACCAGTGTGATTGATTGCAAGTAGTCAAGTGTAACTAACTCCTAAGGGCAACCATTTGTATCTT

ATATATCAGAATTACTTTATAGTTTGAAAGCACTTTGCACACATTTCCTGTATATAAAGGATGTAATTACAGGATATAGTGGTAATGCATTAAAACATGA

ACCT
Translation
MLFLA FHAGSWGSWCCCCCVITADRPWDRGRRWQLEMADTPSVYETRFEAAVKVIQSLPKNG GSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPI

GRYKW - UNI5962 - WDAWSSLGDMTKEEAMIAYVEEMKK - UNI5293 - IIETMPMTEKVEELLHVIGPFYEIVEDKKSSKSSDLTSD - UN

I5293 - DLGNVLTSSNAKAVNGKAESSDSGAESEEEEAQEELKGAEQSGSD - UNI9750 - DKKTLKKSADKNLEIIVTNGYKGSFVQDIQSDIH

TDSSRSTRSSEDEKPGDESSQQTGHTIVCAHQD DRNEDPSEDASGIHHLTSDSDSEVYCDSMEQFGQEE YYLGGDPTQHLESSGFCEDAQQSPGNGSI

GKMWMVAVKGKGEVKHGGEDGRSSSGAPHRETRGGESEDFSSVRRGRV - UNI31660 - VGNRIPHLSEGPKGRQVGSGGDGERWGSDRGSRGSLNE

QIALVLIRLQEDMQNVLQRLHKLETLTASQ - UNI8043 - AKLSLQTSNQPSSQ RPAWWPFEMSPGALAFAIIWPFIAQWLAHLYYQRRRR RKLN


For any suggestions or comments, please send an email to unitrap@crg.es