Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026803 (Ttf1)
Chromosomal location
Chr 2: 28915783 - 28943169 (+)
Description
transcription termination factor, RNA polymerase I Gene [Source:MGI (curated);Acc:Ttf1-001]
RefSeq_peptide
NP_033468.2 
UniGene
Mm.389366 
MGI
MGI:105044 
Uniprot/SWISSPROT
Q62187 
Uniprot/SPTREMBL
Q3TQG6 A2AR36 
Human Ortholog
ENSG00000125482 (TTF1)
Omim not available
UniTrap UNI30856
Vector Insertion
Chr 2: 28915824 - 28920145
Public Clones (sanger) 5SD099C12 (ggtc) 3SD099C12 (ggtc) 3SE286D03 (ggtc) IST14646C1 (tigm)
IST10031A10 (tigm) IST14561G6 (tigm) IST15012E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27936
Vector Insertion
Chr 2: 28920482 - 28920556
Public Clones (sanger) D164B12 (ggtc) D164A12 (ggtc) IST14504G9 (tigm)
Private Clones OST43618 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17839
Vector Insertion
Chr 2: 28921429 - 28922522
Public Clones D159G01 (ggtc) (ggtc) D134D06 (ggtc) IST10325B9 (tigm)
Private Clones OST435170 (lexicon) OST328428 (lexicon) OST293277 (lexicon) OST232193 (lexicon)
OST128861 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35425
Vector Insertion
Chr 2: 28922750 - 28925411
Public Clones IST11519D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24357
Vector Insertion
Chr 2: 28925411 - 28925598
Public Clones not available
Private Clones OST223750 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30058
Vector Insertion
Chr 2: 28926897 - 28929408
Public Clones D135H05 (ggtc) D101H05 (ggtc) D070E09 (ggtc) IST12046G6 (tigm) IST10279D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31512
Vector Insertion
Chr 2: 28929540 - 28930093
Public Clones 5SE142H05 (ggtc) IST10724D1 (tigm) IST12016F5 (tigm) IST14916E4 (tigm)
IST12740C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31366
Vector Insertion
Chr 2: 28930329 - 28934908
Public Clones 3SE223F09 (ggtc) (cmhd) IST15061H12 (tigm) IST14429B1 (tigm) IST11733F2 (tigm)
IST12081F5 (tigm) IST11048G3 (tigm) IST12080F5 (tigm) IST10702H12 (tigm)
IST10277B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061157
Sequence
ATGAAAGGGGGCACAAGCAAATTTAAGACCCACACTGAAACTTTGTACAAGAAAAAGAAATGGTCTTCTGTGTCTGAAAAAAGACCTCAGAAATGTCCCT

CTCAGTGCTTGGAGAGCAAGCAGCCTCAGGTATCTGTGTTGGGGAAGAGGAGGAGGGCGTCCCAGACACCAGCCCAGGAGACCTTAGAGAGTGAGTGGCC

TCAAAAGGCCAAGAGGAAGAAGAGGAGGAGGGAACCCCAGACACCAGCCCAGGAGACCTTAGAGAGTGAGTGGCCTCAAAAGGCCAAGAAGAAGAAGAGA

AGGGGGGAACCCCAGACACCAACCCAAGAGAGTTTG - UNI27936 - GAGAGTGAGCAGCCTCGGAAAGCCAAGAGAAGGAGGAAGAAAAGGAAAGG

GTCCCAGCAACCAACTTCCTCCCTTCTGAAAACTCCAGAAACCTTTCTTAAAGCTAAGAAAACCACTTCTGCCCACAAGAAGAAAAAGAATAGTGTTCTG

GAGGTGGATATGGAAACTGGGATCATCCTTGTAGATAAAGAAAACATGGAGAACCTGCTAGAGACTTCTAGAAAGGATGTGGATATTGTTTATGTTGATA

TGAGCAAGGGACAAAGGTCAGCAAAAGTGCGTGAAACAGGAGAGCTGCCCGCTGCTAAGCCACAGGAACATGGCTGTCGAGAGCTGCTCGGTGACGTCAG

GAGCAGAAAGAAACAAAAGCACCTCCAGAAAGTTGCACCCTGGGATGTTGTTCAGGGGAGCCAGCCTGAGAGTATCTCCCTGCCCCCATCAGAGCCCTTG

TCTTCTGAAGATTTAGAAGGCAAAAGCACAGAAGCAGCAGTGTTTTGTAAAAAGAAGTCTAAAAAAAACGTGTTCAGGAGCCAGGAATTGGAGCCCATCC

CCGACAGTCTTGATGACTCGGAGACCATCTCTGAGAGACTTGATAGCACACACCATGGAGGAGCTGTCGGGGCTGGAGAAGAATGTGAGAGCACCAAAGA

ATCCCACAGTATCAAAAAAAAGTCCAAGAAAAAGAAGCACAAGTCTGTTGCTCTTGCCACATCTAGTGACAGTGCCTCAGTGACAGACAGCAAGGCTAAG

AATGCCCTGGTGGACTCCTCAGAAGGCAGTGGTGCTGTGAGGGAAGAGGACGTGGACCACAGGCCAGCAGAGGCAGAAGCCCAGGCTTGTTCCACTGAGA

AGCACAGGGAAGCCATGCAGAG - UNI17839 - GTTAGAACCTACCCATGAAGAAGAAAGCAATTCGGAATCAGCTAGCAATTCTGCAGCAAGACAC

ATATCTGAGGACAGGAGAGAGTCTGATGACTCGGATGTTGATTTGGGCTCTGCAGTGAGACAGCTGCGAGAGTTCATTCCTGACATACAGGAAAGGGCGG

CCACCACCATCAGACGCATGTATCGGGATGACCTAGGGCGCTTCAAAGAATTTAAGGCACAAG - UNI24357 - - UNI35425 - GTGTGGCTAT

TAGATTTGGCAAATTTTCTGCTAAAGAAAATAAACAAATAGAAAAAAATGTGCAAGATTTCCTATCCCTGACTGGAATTGAGAGTGCAGACAAGCTGCTG

TACACAGACAGATACCCAGAGGAAAAGACTCTGATCACCAACCTAAAACGGAAGCATGCCTTCAGACTGCACATTG - UNI24357 - GGAAGGGCAT

CGCTCGGCCCTGGAAGCTCGTGTACTACCGTGCAAAGAAGATCTTTGATGTGAATAACTACAAAGGCAG - UNI30058 - GTACAATGAAGAAGATA

CTAAGAAGCTGAAGGCATACCATTCCCTCCATGGAAACGACTGGAAAAAGATTGGGGCCATGGTGGCCCGAAGCAGCCTCTCAGTCGCCCTCAAGTTCTC

TCAGATTGGTGGTA - UNI31512 - CTAGAAACCAAGGTGCTTGGAGTAAGGCAGAAACCCAGAGGCTAATCAAGGCTGTGGAGGACGTGATCCTAA

AGAAGATGTCTCCCCAGGAGTTAAGAGAACTGGATTCTAAACTCCAGGAAGACCCTGAGGGTCGCCTGTCAATTGTCCGGGAAAAACTCTACAAGGGCAT

ATCTTGGGTGGAGGTGGAAGCTAGAGTGGAGACCCGGAACTGGATGCAGTGCAAAAGTAAGTG - UNI31366 - GACAGAGATTCTTACCAAAAGGA

TGACCCATGGTGGGTTCGTGTATCGTGGGGTCAATGCTCTACAGGCCAAAATCACCCTTATTGAAAG GTTGTATGAACTAAATGTGAATGATGCTAATG

AAATAGACTGGGAAGATCTTGCTAGCGCCATAGG GGATGTCCCTCCACCTTTTGTTCAGGCAAAATTTTATAAGCTGAAAGCTGCCTGCGTTCCCTTTT

GGCAGAAAAAGACTTTTCCAG AAATCATTGACTACTTATATAAGAACAGTCTGCCTTTGCTGAAGGAAAAGTTAGACAAGAAAATGAAGAAAAAAGACG

GCCAGATCCAAACACCTGCAGCTCCCAAACAAGACTTTCTGTTCAAAGACATCTTCCATTGCGATGATGACAGTGATGAAGGGAGCCCAGAGGAGCCCAG

 CGCCTCTGATGTGCAGTGACTGGATCGTCTCTTCCTCAAACTGCTCTCTGTTCCCTTGGACCTGTGTTGTGCATTGGCTATAGATCCCGCTCGCATGTG

ATACCTCTCCTGTGCTGGGCACCGAGTCACACGGTGTTCTGCTGGAGCATTGGTAGTCTGCATCGGAGCCCAACTGGTAGCCTTGAAGAGTCTGTCAGCT

GAACACAGCCCCACTGGATTCTCAGGACTGGGTGAAAGGGGTGCTCTTTGGTCAATCAGGAGAGTCAACCCAACTGTAGGGGCTTCAGAGAAGAAAACTT

AGGGTTTGGGTAAGAAGAAGTATTCCATGAGATCTGTGCACTATGGAGATAGGTGGGGGAGTGGGAAGTGGGGTCACAGGATTGAAGCCAACCTGGGCTA

CATAGTTCCTCCAGCATATACACACACAGTGGGATGCTGGAGCATCCTCCAAAAGGAGAAGTGCATTGCCCAGAGAGCAGGAGAGTACTGCAGAGAAGCT

CTAGCTCTGCAAGCCCCAATTTCCCTGTGTTCCTTCTAGCTGTTCCCATACTCAGGCTGTCTGTTGTTGCCCTGCAGAGAAATGTGTCCATGTGTGACCC

TTAGCAGAACACTGCTGCAAGGGAGTCTGGGACACCCAAATGTTCAGACATTCAGACTTCTGCCCCATCTGTGCTGGGGAGACAGAAGGGAAAGTGAGGC

TAATGAAACCGCCCATATACTGCTGTCTACGTTGGTGCCACTCAGCAATCTTCTGTCTCCCGAGAACTCTCAGACATGATTTCTGTGGCACTATTAGAAG

GTGGACTAGAGGGCTGGTGAGATGGCTCAGTGGGTAAGAGCACCCGATTGCTCTCCCGAAGGTCCGGAGTTCAAATCCCAGCAACCACATGGTGGCTCAC

AACCATCTGTAACAAGATCTGACTCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTACATATAATAAATAAATAAATCTTTAAAAAAAAAAAA

AAAAAAAAAGAAGGTGGACTAGAAGGAGCTTCTGCTTGCCATGTACCTAGCACTTCCCCAGATGTGCAGATAACGGAGTAGTCAGGTGGAATGCACTAAT

GCACCCAGCATTCATGTGGGGTAGGAGGAGCGGGAGGTCAAAGTGGTCCTTACAAATAGCAGGCTCTAGGCCAGGGTGGCCTATAGATGACTCTGGCTCT

AACAAACACACAAATAAAACATTGTGTGAATGATGGTATTTTAGTACATGGTTCTCTACCCAGCCCCTCTGTCCCTCAGGCATTCTAGACTCTGTGCTGA

CAGGACTAAATTGCTCCTACAAAAATAATAGTACTAATGTATAAGCCAATTCTATATTTGTGATAGAAGAAAAAATGAATATTCTTTAACAGGAAGTATG

TTCCTAGAATGGGATATCATATGGTAAATTACAGTGATAACAATAGATCTGGTTGACATGACGTTATATTTTTGTGAAGTATTTCAAAAGAATATATATT

TTCTCAGTTTTATAAAAATGAAAAATAAAAGAAATTGGTTGTTT
Translation
MKGGTSKFKTHTETLYKKKKWSSVSEKRPQKCPSQCLESKQPQVSVLGKRRRASQTPAQETLESEWPQKAKRKKRRREPQTPAQETLESEWPQKAKKKKR

RGEPQTPTQESL - UNI27936 - ESEQPRKAKRRRKKRKGSQQPTSSLLKTPETFLKAKKTTSAHKKKKNSVLEVDMETGIILVDKENMENLLETSR

KDVDIVYVDMSKGQRSAKVRETGELPAAKPQEHGCRELLGDVRSRKKQKHLQKVAPWDVVQGSQPESISLPPSEPLSSEDLEGKSTEAAVFCKKKSKKNV

FRSQELEPIPDSLDDSETISERLDSTHHGGAVGAGEECESTKESHSIKKKSKKKKHKSVALATSSDSASVTDSKAKNALVDSSEGSGAVREEDVDHRPAE

AEAQACSTEKHREAMQR - UNI17839 - RLEPTHEEESNSESASNSAARHISEDRRESDDSDVDLGSAVRQL - UNI24357 - - UNI35425 

-  - UNI24357 -  - UNI30058 -  - UNI31512 -  - UNI31366 -     
Transcript ENSMUST00000100237
Sequence
AACACTTCCGGGTTGGAAGACGAGCGCTACATTGTCGCTGG - UNI30856 - GGACAGGATGAAAGGGGGCACAAGCAAATTTAAGACCCACACTGA

AACTTTGTACAAGAAAAAGAAATGGTCTTCTGTGTCTGAAAAAAGACCTCAGAAATGTCCCTCTCAGTGCTTGGAGAGCAAGCAGCCTCAGGTATCTGTG

TTGGGGAAGAGGAGGAGGGCGTCCCAGACACCAGCCCAGGAGACCTTAGAGAGTGAGTGGCCTCAAAAGGCCAAGAGGAAGAAGAGGAGGAGGGAACCCC

AGACACCAGCCCAGGAGACCTTAGAGAGTGAGTGGCCTCAAAAGGCCAAGAAGAAGAAGAGAAGGGGGGAACCCCAGACACCAACCCAAGAGAGTTTGGA

GAGTGAGCAGCCTCCAGTGTCCTTGCTGGGGAAGAGAAGGAGGGAATCCCAGACACCAGCCCAGGAGAACTCGGAGAGTGAGCAGCCTCGGAAAGCCAAG

AGAAGGAGGAAGAAAAGGAAAGGGTCCCAGCAACCAACTTCCTCCCTTCTGAAAACTCCAGAAACCTTTCTTAAAGCTAAGAAAACCACTTCTGCCCACA

AGAAGAAAAAGAATAGTGTTCTGGAGGTGGATATGGAAACTGGGATCATCCTTGTAGATAAAGAAAACATGGAGAACCTGCTAGAGACTTCTAGAAAGGA

TGTGGATATTGTTTATGTTGATATGAGCAAGGGACAAAGGTCAGCAAAAGTGCGTGAAACAGGAGAGCTGCCCGCTGCTAAGCCACAGGAACATGGCTGT

CGAGAGCTGCTCGGTGACGTCAGGAGCAGAAAGAAACAAAAGCACCTCCAGAAAGTTGCACCCTGGGATGTTGTTCAGGGGAGCCAGCCTGAGAGTATCT

CCCTGCCCCCATCAGAGCCCTTGTCTTCTGAAGATTTAGAAGGCAAAAGCACAGAAGCAGCAGTGTTTTGTAAAAAGAAGTCTAAAAAAAACGTGTTCAG

GAGCCAGGAATTGGAGCCCATCCCCGACAGTCTTGATGACTCGGAGACCATCTCTGAGAGACTTGATAGCACACACCATGGAGGAGCTGTCGGGGCTGGA

GAAGAATGTGAGAGCACCAAAGAATCCCACAGTATCAAAAAAAAGTCCAAGAAAAAGAAGCACAAGTCTGTTGCTCTTGCCACATCTAGTGACAGTGCCT

CAGTGACAGACAGCAAGGCTAAGAATGCCCTGGTGGACTCCTCAGAAGGCAGTGGTGCTGTGAGGGAAGAGGACGTGGACCACAGGCCAGCAGAGGCAGA

AGCCCAGGCTTGTTCCACTGAGAAGCACAGGGAAGCCATGCAGAG - UNI17839 - GTTAGAACCTACCCATGAAGAAGAAAGCAATTCGGAATCAG

CTAGCAATTCTGCAGCAAGACACATATCTGAGGACAGGAGAGAGTCTGATGACTCGGATGTTGATTTGGGCTCTGCAGTGAGACAGCTGCGAGAGTTCAT

TCCTGACATACAGGAAAGGGCGGCCACCACCATCAGACGCATGTATCGGGATGACCTAGGGCGCTTCAAAGAATTTAAGGCACAAG - UNI24357 - 

- UNI35425 - GTGTGGCTATTAGATTTGGCAAATTTTCTGCTAAAGAAAATAAACAAATAGAAAAAAATGTGCAAGATTTCCTATCCCTGACTGGAA

TTGAGAGTGCAGACAAGCTGCTGTACACAGACAGATACCCAGAGGAAAAGACTCTGATCACCAACCTAAAACGGAAGCATGCCTTCAGACTGCACATTG 

- UNI24357 - GGAAGGGCATCGCTCGGCCCTGGAAGCTCGTGTACTACCGTGCAAAGAAGATCTTTGATGTGAATAACTACAAAGGCAG - UNI30

058 - GTACAATGAAGAAGATACTAAGAAGCTGAAGGCATACCATTCCCTCCATGGAAACGACTGGAAAAAGATTGGGGCCATGGTGGCCCGAAGCAGC

CTCTCAGTCGCCCTCAAGTTCTCTCAGATTGGTGGTA - UNI31512 - CTAGAAACCAAGGTGCTTGGAGTAAGGCAGAAACCCAGAGGCTAATCAA

GGCTGTGGAGGACGTGATCCTAAAGAAGATGTCTCCCCAGGAGTTAAGAGAACTGGATTCTAAACTCCAGGAAGACCCTGAGGGTCGCCTGTCAATTGTC

CGGGAAAAACTCTACAAGGGCATATCTTGGGTGGAGGTGGAAGCTAGAGTGGAGACCCGGAACTGGATGCAGTGCAAAAGTAAGTG - UNI31366 - 

GACAGAGATTCTTACCAAAAGGATGACCCATGGTGGGTTCGTGTATCGTGGGGTCAATGCTCTACAGGCCAAAATCACCCTTATTGAAAG GTTGTATGA

ACTAAATGTGAATGATGCTAATGAAATAGACTGGGAAGATCTTGCTAGCGCCATAGG GGATGTCCCTCCACCTTTTGTTCAGGCAAAATTTTATAAGCT

GAAAGCTGCCTGCGTTCCCTTTTGGCAGAAAAAGACTTTTCCAG AAATCATTGACTACTTATATAAGAACAGTCTGCCTTTGCTGAAGGAAAAGTTAGA

CAAGAAAATGAAGAAAAAAGACGGCCAGATCCAAACACCTGCAGCTCCCAAACAAGACTTTCTGTTCAAAGACATCTTCCATTGCGATGATGACAGTGAT

GAAGGGAGCCCAGAGGAGCCCAG CGCCTCTGATGTGCAGTGACTGGATCGTCTCTTCCTCAAACTGCTCTCTGTTCCCTTGGACCTGTGTTGTGCATTG

GCTATAGATCCCGCTCGCATGTGATACCTCTCCTGTGCTGGGCACCGAGTCACACGGTGTTCTGCTGGAGCATTGGTAGTCTGCATCGGAGCCCAACTGG

TAGCCTTGAAGAGTCTGTCAGCTGAACACAGCCCCACTGGATTCTCAGGACTGGGTGAAAGGGGTGCTCTTTGGTCAATCAGGAGAGTCAACCCAACTGT

AGGGGCTTCAGAGAAGAAAACTTAGGGTTTGGGTAAGAAGAAGTATTCCATGAGATCTGTGCACTATGGAGATAGGTGGGGGAGTGGGAAGTGGGGTCAC

AGGATTGAAGCCAACCTGGGCTACATAGTTCCTCCAGCATATACACACACAGTGGGATGCTGGAGCATCCTCCAAAAGGAGAAGTGCATTGCCCAGAGAG

CAGGAGAGTACTGCAGAGAAGCTCTAGCTCTGCAAGCCCCAATTTCCCTGTGTTCCTTCTAGCTGTTCCCATACTCAGGCTGTCTGTTGTTGCCCTGCAG

AGAAATGTGTCCATGTGTGACCCTTAGCAGAACACTGCTGCAAGGGAGTCTGGGACACCCAAATGTTCAGACATTCAGACTTCTGCCCCATCTGTGCTGG

GGAGACAGAAGGGAAAGTGAGGCTAATGAAACCGCCCATATACTGCTGTCTACGTTGGTGCCACTCAGCAATCTTCTGTCTCCCGAGAACTCTCAGACAT

GATTTCTGTGGCACTATTAGAAGGTGGACTAGAGGGCTGGTGAGATGGCTCAGTGGGTAAGAGCACCCGATTGCTCTCCCGAAGGTCCGGAGTTCAAATC

CCAGCAACCACATGGTGGCTCACAACCATCTGTAACAAGATCTGACTCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTACATATAATAAATA

AATAAATCTTTAAAAAAAAAAAAAAAAAAAAAGAAGGTGGACTAGAAGGAGCTTCTGCTTGCCATGTACCTAGCACTTCCCCAGATGTGCAGATAACGGA

GTAGTCAGGTGGAATGCACTAATGCACCCAGCATTCATGTGGGGTAGGAGGAGCGGGAGGTCAAAGTGGTCCTTACAAATAGCAGGCTCTAGGCCAGGGT

GGCCTATAGATGACTCTGGCTCTAACAAACACACAAATAAAACATTGTGTGAATGATGGTATTTTAGTACATGGTTCTCTACCCAGCCCCTCTGTCCCTC

AGGCATTCTAGACTCTGTGCTGACAGGACTAAATTGCTCCTACAAAAATAATAGTACTAATGTATAAGCCAATTCTATATTTGTGATAGAAGAAAAAATG

AATATTCTTTAACAGGAAGTATGTTCCTAGAATGGGATATCATATGGTAAATTACAGTGATAACAATAGATCTGGTTGACATGACGTTATATTTTTGTGA

AGTATTTCAAAAGAATATATATTTTCTCAGTTTTATAAAAATGAAAAATAAAAGAAATTGGTTGTTT
Translation
 - UNI30856 - MKGGTSKFKTHTETLYKKKKWSSVSEKRPQKCPSQCLESKQPQVSVLGKRRRASQTPAQETLESEWPQKAKRKKRRREPQTPAQET

LESEWPQKAKKKKRRGEPQTPTQESLESEQPPVSLLGKRRRESQTPAQENSESEQPRKAKRRRKKRKGSQQPTSSLLKTPETFLKAKKTTSAHKKKKNSV

LEVDMETGIILVDKENMENLLETSRKDVDIVYVDMSKGQRSAKVRETGELPAAKPQEHGCRELLGDVRSRKKQKHLQKVAPWDVVQGSQPESISLPPSEP

LSSEDLEGKSTEAAVFCKKKSKKNVFRSQELEPIPDSLDDSETISERLDSTHHGGAVGAGEECESTKESHSIKKKSKKKKHKSVALATSSDSASVTDSKA

KNALVDSSEGSGAVREEDVDHRPAEAEAQACSTEKHREAMQR - UNI17839 - RLEPTHEEESNSESASNSAARHISEDRRESDDSDVDLGSAVRQL

REFIPDIQERAATTIRRMYRDDLGRFKEFKAQG - UNI24357 - - UNI35425 - GVAIRFGKFSAKENKQIEKNVQDFLSLTGIESADKLLYTD

RYPEEKTLITNLKRKHAFRLHIG - UNI24357 - GKGIARPWKLVYYRAKKIFDVNNYKGR - UNI30058 - RYNEEDTKKLKAYHSLHGNDWK

KIGAMVARSSLSVALKFSQIGGT - UNI31512 - TRNQGAWSKAETQRLIKAVEDVILKKMSPQELRELDSKLQEDPEGRLSIVREKLYKGISWVEV

EARVETRNWMQCKSKW - UNI31366 - WTEILTKRMTHGGFVYRGVNALQAKITLIER RLYELNVNDANEIDWEDLASAIG GDVPPPFVQAKFYK

LKAACVPFWQKKTFPE EIIDYLYKNSLPLLKEKLDKKMKKKDGQIQTPAAPKQDFLFKDIFHCDDDSDEGSPEEPS SASDVQ

For any suggestions or comments, please send an email to unitrap@crg.es