Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026811 (St6galnac6)
Chromosomal location
Chr 2: 32455229 - 32476326 (+)
Description
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 Gene [Source:MGI (curated);Acc:St6galnac6-001]
RefSeq_dna
NM_001025310 NM_016973 NM_001025311 
RefSeq_peptide
NP_001020481.1 NP_058669.1 NP_001020482.1 
UniGene
Mm.88831 Mm.407226 Mm.394261 
MGI
MGI:1355316 
Uniprot/SWISSPROT
Q9JM95 
Human Ortholog
ENSG00000160408 (ST6GALNAC6)
Omim not available
UniTrap UNI33788
Vector Insertion
Chr 2: 32455357 - 32462530
Public Clones (sanger) IST14520B9 (tigm) IST14410B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33774
Vector Insertion
Chr 2: 32462632 - 32463561
Public Clones IST14243G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37295
Vector Insertion
Chr 2: 32467924 - 32470300
Public Clones CMHD-GT_260C8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113289
Sequence
GGGGCCTGGGCGGCCAGAGCGGCGCGGACCCCGGTTCTCGGCTCCCGGCGCCATGTGACGGGGTGCGGGGGCCGCGGGGGGCCGGGCGCTCCCCGGCGGA

G - UNI33774 - ATGAGGAAACTGAGGCTCAGAGAGGTCACATGGCTTGCTCGAGGCCCCCCAGCCAGTAAGTGTGGACCCGACATTCGCACTGGCA

CCTGATACGCTGTTCTGACCATGGCGTTCTCAGAGCAGGACCGTGACGGGCCTGACCGGGGGAACCGTAGTCCTGGCTGAGGGCACTGCTCAGGCAAAG 

GTGTGACCCCACAACCCTGCCCCCCGGGCCACCTGCCGGACGCTGGCCTCTACCCTTCAGCAGACGCCGGAGAGAGATGAGTAGCAACAAA GAGCAGCG

GTCAGCAGTGTTTGTGATCCTCTTTGCCCTCATCACCATCCTCATCCTCTACAGCTCCAACAGTGCCAACGAGGTCTTCCACTACGGCTCCCTGCGGGGC

CGCACGCGTCGGCCAGTCAACCTCAAGAAGTGGAGTTTCTCCAGCGCCTACTTCCCTATCCTCGGCAACAAG - UNI37295 - ACGCTGCCGTCCAG

GTGCAACCAGTGTGTGATCATCACCAGCTCCAGCCACCTGCTGGGCACCAAACTGGGCCCTGAGATTGAGCGGGCTGAGTGCACCATCCGCATGAACGAT

GCTCCCACCTCTGGCTACTCGGCTGA
Translation
 - UNI33774 -  MSSNK EQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNK - UNI37295 - TLPSR

CNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSA
Transcript ENSMUST00000113282
Sequence
GGGGCCTGGGCGGCCAGAGCGGCGCGGACCCCGGTTCTCGGCTCCCGGCGCCATGTGACGGGGTGCGGGGGCCGCGGGGGGCCGGGCGCTCCCCG - UN

I33774 - TCACAGATGAGGAAACTGAGGCTCAGAGAGGTCACATGGCTTGCTCGAGGCCCCCCAGCCAGTAAGTGTGGACCCGACATTCGCACTGGCA

CCTGATACGCTGTTCTGACCATGGCGTTCTCAGAGCAGGACCGTGACGGGCCTGACCGGGGGAACCGTAGTCCTGGCTGAGGGCACTGCTCAGGCAAAG 

GTGTGACCCCACAACCCTGCCCCCCGGGCCACCTGCCGGACGCTGGCCTCTACCCTTCAGCAGACGCCGGAGAGAGATGAGTAGCAACAAA GAGCAGCG

GTCAGCAGTGTTTGTGATCCTCTTTGCCCTCATCACCATCCTCATCCTCTACAGCTCCAACAGTGCCAACGAGGTCTTCCACTACGGCTCCCTGCGGGGC

CGCACGCGTCGGCCAGTCAACCTCAAGAAGTGGAGTTTCTCCAGCGCCTACTTCCCTATCCTCGGCAACAAG - UNI37295 - ACGCTGCCGTCCAG

GTGCAACCAGTGTGTGATCATCACCAGCTCCAGCCACCTGCTGGGCACCAAACTGGGCCCTGAGATTGAGCGGGCTGAGTGCACCATCCGCATGAACGAT

GCTCCCACCTCTGGCTACTCGGCTGACGTCGGAAACAAAACCACCTTCCGCGTAGTGGCCCATTCCAGTGTATTCCGTGTGCTGCGGAAGCCCCAGGAAT

TTGTCAACCGGACCCCTGAGACGGTGTTCATCTTCTGGGGACCCCCAAACAAGATGCAGAAGCCCCAGGGCAGCCTCCTGCGCGTCATCCAGCGGGCGGG

CCTCATGTTCCCGAACATGGAGGCCTATGCCGTCTCTCCCGCCCGCATGCAGCAGTTTGACGACCTCTTCCGGGGTGAGACGGGCAAGGACAG GGAAAA

GTCCCATTCCTGGTTGAGCACGGGCTGGTTTACCATGGTGATTGCGGTGGAATTGTGTGACCATGTGCACGTGTATGGCATGGTCCCTCCTGACTACTGC

AG CCAGCGGCCCCGCCTGCAGCGCATGCCATACCACTACTATGAACCCAAGGGGCCGGACGAGTGTGTCACCTACATCCAGAACGAGCACAGCCGTAAG

GGCAATCACCACCGCTTCATCACCGAGAAGAGGGTCTTCTCGTCCTGGGCCCAACTCTACGGTATCACCTTCTCCCACCCCTCCTGGACCTAGTTATCCT

GTCCACCGATCTCGGACAGATACAAACGAAGTGGCTCTGGCCCAGCCATTTAACCATGGCCATCTTCCAGCCAGTTCAGGCTGGCTGGAGTATTTCCCAG

CCAATCAAATCAGGGCCTTGATGAGGGTTTTTTTTTTCCTCCAGCCAATCGGGGCTGGGGTTATCTCTTGGCCAATCAGGGATTTGGAATTCTGTATGGT

TTAATCGGGTGTCAGGGGGTCTTTCTCGTCTAGTCAGGGTCTGAGCATAGTCTATCAGGGTATAGGGGTCTTTCTGAGTCAATCTGAAGCTTAGGACATG

TCTTTTCCCATAAGGCTTTGCTTCAGAGCCCCAGGAATGGGCCCCCAAATCACTCCCTCCTTAGCTGGGACAATGAGGTCCTGTCCTAAGGATCTGAGGA

CTTGGTGTTGCCCCACAGTTGCCAGAATCAGAGCTACTGTAGGGGGGAGGGGCTGCCAGGAGGCCAGGCCAAAGGATTTGTGGAGTTCTAGGAGTGGTAG

GGAAGCCTAGGAGGTAAGAGGCGGTGTCCAGTTCCCGGTTTCTTCCTGAGTGACCTTAAACAGACCCTCTTGTCTTTCTGGTATGCTGTGATGACATCAT

AGCTCCGTATGTGGAGACCCTCACTCTCCGTTATACTTAAGTGTAAATTCCTCAGCTACCATTCCTCGCTGGGGGACTCAGCTCCCTGGGGATGGGGAGC

CTGGGGTACCCTTCCCTGCCTCCTTCTAGAAACTTTAGGGTATTTTTGTGCAAGTGCCCCCCATGGTTGGGGGATCCTGACAGAAATGGGGCAAACATGA

AGCTGTTTCTCTAGCCCCTCAATCCAGCTGCCGTTAGCCTGGCTCTAGAAAGGCCAGGCACCTCTTCCTACCCTCCAGCAGGAGAGCATTCCCTGCTGCC

CGAAGGAGCCTTTGGGACTGAGGAAGGGGTATCCCAGCCACACCAGGGCTTCGTGAAGTTTTTGTCTGGAGATGCTGAGGGCTTTGGGGAGAAGTATCCT

CCCCCAAGTTTGGGATGAGACTAGAGATGGGGACTGGGTTCTGTCCCTTGCTTAAGCACTTTATTAAGGGCAGGACTGGGTGGGGGTGTGGGTAACCCCC

ATTCTTCCACAGCCTGCAAGGGAAGGGCTTCCAGAAAGGCTGTGGACTGGGGGTTGGGGGAGACTAGCCAGCAGTGAGCCCTGCACAGCAAGGTAATGGG

GGTTGGGCAGTGACAGCCCTAGATCTGGTTTTGTAATGATTTATACAGAAATAAACACGCCTAAGCCC
Translation
 - UNI33774 -  MSSNK EQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNK - UNI37295 - TLPSR

CNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFWGPPNKMQKPQGSLLRVIQRAG

LMFPNMEAYAVSPARMQQFDDLFRGETGKDR REKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCS SQRPRLQRMPYHYYEPKGPDECVTYIQNEH

SRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Transcript ENSMUST00000113290
Sequence
AACGGGACTGCGAGCGCCGGCGCTAGGACCCGGCGGGCTGGAGCTGCGGCGGGGCCTGGGCGGCCAGAGCGGCGCGGACCCCGGTTCTCGGCTCCCGGCG

CCATGTGACGGGGTGCGGGGGCCGCGGGGGGCCGGGCGCTCCCCGGCGGAG - UNI33774 - GTGTGACCCCACAACCCTGCCCCCCGGGCCACCTG

CCGGACGCTGGCCTCTACCCTTCAGCAGACGCCGGAGAGAGATGAGTAGCAACAAA GAGCAGCGGTCAGCAGTGTTTGTGATCCTCTTTGCCCTCATCA

CCATCCTCATCCTCTACAGCTCCAACAGTGCCAACGAGGTCTTCCACTACGGCTCCCTGCGGGGCCGCACGCGTCGGCCAGTCAACCTCAAGAAGTGGAG

TTTCTCCAGCGCCTACTTCCCTATCCTCGGCAACAAG - UNI37295 - ACGCTGCCGTCCAGGTGCAACCAGTGTGTGATCATCACCAGCTCCAGCC

ACCTGCTGGGCACCAAACTGGGCCCTGAGATTGAGCGGGCTGAGTGCACCATCCGCATGAACGATGCTCCCACCTCTGGCTACTCGGCTGACGTCGGAAA

CAAAACCACCTTCCGCGTAGTGGCCCATTCCAGTGTATTCCGTGTGCTGCGGAAGCCCCAGGAATTTGTCAACCGGACCCCTGAGACGGTGTTCATCTTC

TGGGGACCCCCAAACAAGATGCAGAAGCCCCAGGGCAGCCTCCTGCGCGTCATCCAGCGGGCGGGCCTCATGTTCCCGAACATGGAGGCCTATGCCGTCT

CTCCCGCCCGCATGCAGCAGTTTGACGACCTCTTCCGGGGTGAGACGGGCAAGGACAG GGAAAAGTCCCATTCCTGGTTGAGCACGGGCTGGTTTACCA

TGGTGATTGCGGTGGAATTGTGTGACCATGTGCACGTGTATGGCATGGTCCCTCCTGACTACTGCAG CCAGCGGCCCCGCCTGCAGCGCATGCCATACC

ACTACTATGAACCCAAGGGGCCGGACGAGTGTGTCACCTACATCCAGAACGAGCACAGCCGTAAGGGCAATCACCACCGCTTCATCACCGAGAAGAGGGT

CTTCTCGTCCTGGGCCCAACTCTACGGTATCACCTTCTCCCACCCCTCCTGGACCTAGTTATCCTGTCCACCGATCTCGGACAGATACAAACGAAGTGGC

TCTGGCCCAGCCATTTAACCATGGCCATCTTCCAGCCAGTTCAGGCTGGCTGGAGTATTTCCCAGCCAATCAAATCAGGGCCTTGATGAGGGTTTTTTTT

TTCCTCCAGCCAATCGGGGCTGGGGTTATCTCTTGGCCAATCAGGGATTTGGAATTCTGTATGGTTTAATCGGGTGTCAGGGGGTCTTTCTCGTCTAGTC

AGGGTCTGAGCATAGTCTATCAGGGTATAGGGGTCTTTCTGAGTCAATCTGAAGCTTAGGACATGTCTTTTCCCATAAGGCTTTGCTTCAGAGCCCCAGG

AATGGGCCCCCAAATCACTCCCTCCTTAGCTGGGACAATGAGGTCCTGTCCTAAGGATCTGAGGACTTGGTGTTGCCCCACAGTTGCCAGAATCAGAGCT

ACTGTAGGGGGGAGGGGCTGCCAGGAGGCCAGGCCAAAGGATTTGTGGAGTTCTAGGAGTGGTAGGGAAGCCTAGGAGGTAAGAGGCGGTGTCCAGTTCC

CGGTTTCTTCCTGAGTGACCTTAAACAGACCCTCTTGTCTTTCTGGTATGCTGTGATGACATCATAGCTCCGTATGTGGAGACCCTCACTCTCCGTTATA

CTTAAGTGTAAATTCCTCAGCTACCATTCCTCGCTGGGGGACTCAGCTCCCTGGGGATGGGGAGCCTGGGGTACCCTTCCCTGCCTCCTTCTAGAAACTT

TAGGGTATTTTTGTGCAAGTGCCCCCCATGGTTGGGGGATCCTGACAGAAATGGGGCAAACATGAAGCTGTTTCTCTAGCCCCTCAATCCAGCTGCCGTT

AGCCTGGCTCTAGAAAGGCCAGGCACCTCTTCCTACCCTCCAGCAGGAGAGCATTCCCTGCTGCCCGAAGGAGCCTTTGGGACTGAGGAAGGGGTATCCC

AGCCACACCAGGGCTTCGTGAAGTTTTTGTCTGGAGATGCTGAGGGCTTTGGGGAGAAGTATCCTCCCCCAAGTTTGGGATGAGACTAGAGATGGGGACT

GGGTTCTGTCCCTTGCTTAAGCACTTTATTAAGGGCAGGACTGGGTGGGGGTGTGGGTAACCCCCATTCTTCCACAGCCTGCAAGGGAAGGGCTTCCAGA

AAGGCTGTGGACTGGGGGTTGGGGGAGACTAGCCAGCAGTGAGCCCTGCACAGCAAGGTAATGGGGGTTGGGCAGTGACAGCCCTAGATCTGGTTTTGTA

ATGATTTATACAGAAATAAACACGCCTAAGCCC
Translation
 - UNI33774 - MSSNK EQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNK - UNI37295 - TLPSRC

NQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFWGPPNKMQKPQGSLLRVIQRAGL

MFPNMEAYAVSPARMQQFDDLFRGETGKDR REKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCS SQRPRLQRMPYHYYEPKGPDECVTYIQNEHS

RKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Transcript ENSMUST00000081879
Sequence
ATGGCACAGGGGAACCATGAAGCCTGGGGATG GTGTGACCCCACAACCCTGCCCCCCGGGCCACCTGCCGGACGCTGGCCTCTACCCTTCAGCAGACGC

CGGAGAGAGATGAGTAGCAACAAA GAGCAGCGGTCAGCAGTGTTTGTGATCCTCTTTGCCCTCATCACCATCCTCATCCTCTACAGCTCCAACAGTGCC

AACGAGGTCTTCCACTACGGCTCCCTGCGGGGCCGCACGCGTCGGCCAGTCAACCTCAAGAAGTGGAGTTTCTCCAGCGCCTACTTCCCTATCCTCGGCA

ACAAG - UNI37295 - ACGCTGCCGTCCAGGTGCAACCAGTGTGTGATCATCACCAGCTCCAGCCACCTGCTGGGCACCAAACTGGGCCCTGAGATT

GAGCGGGCTGAGTGCACCATCCGCATGAACGATGCTCCCACCTCTGGCTACTCGGCTGACGTCGGAAACAAAACCACCTTCCGCGTAGTGGCCCATTCCA

GTGTATTCCGTGTGCTGCGGAAGCCCCAGGAATTTGTCAACCGGACCCCTGAGACGGTGTTCATCTTCTGGGGACCCCCAAACAAGATGCAGAAGCCCCA

GGGCAGCCTCCTGCGCGTCATCCAGCGGGCGGGCCTCATGTTCCCGAACATGGAGGCCTATGCCGTCTCTCCCGCCCGCATGCAGCAGTTTGACGACCTC

TTCCGGGGTGAGACGGGCAAGGACAG GGAAAAGTCCCATTCCTGGTTGAGCACGGGCTGGTTTACCATGGTGATTGCGGTGGAATTGTGTGACCATGTG

CACGTGTATGGCATGGTCCCTCCTGACTACTGCAG CCAGCGGCCCCGCCTGCAGCGCATGCCATACCACTACTATGAACCCAAGGGGCCGGACGAGTGT

GTCACCTACATCCAGAACGAGCACAGCCGTAAGGGCAATCACCACCGCTTCATCACCGAGAAGAGGGTCTTCTCGTCCTGGGCCCAACTCTACGGTATCA

CCTTCTCCCACCCCTCCTGGACCTAGTTATCCTGTCCACCGATCTCGGACAGATACAAACGAAGTGGCTCTGGCCCAGCCATTTAACCATGGCCATCTTC

CAGCCAGTTCAGGCTGGCTGGAGTATTTCCCAGCCAATCAAATCAGGGCCTTGATGAGGGTTTTTTTTTTCCTCCAGCCAATCGGGGCTGGGGTTATCTC

TTGGCCAATCAGGGATTTGGAATTCTGTATGGTTTAATCGGGTGTCAGGGGGTCTTTCTCGTCTAGTCAGGGTCTGAGCATAGTCTATCAGGGTATAGGG

GTCTTTCTGAGTCAATCTGAAGCTTAGGACATGTCTTTTCCCATAAGGCTTTGCTTCAGAGCCCCAGGAATGGGCCCCCAAATCACTCCCTCCTTAGCTG

GGACAATGAGGTCCTGTCCTAAGGATCTGAGGACTTGGTGTTGCCCCACAGTTGCCAGAATCAGAGCTACTGTAGGGGGGAGGGGCTGCCAGGAGGCCAG

GCCAAAGGATTTGTGGAGTTCTAGGAGTGGTAGGGAAGCCTAGGAGGTAAGAGGCGGTGTCCAGTTCCCGGTTTCTTCCTGAGTGACCTTAAACAGACCC

TCTTGTCTTTCTGGTATGCTGTGATGACATCATAGCTCCGTATGTGGAGACCCTCACTCTCCGTTATACTTAAGTGTAAATTCCTCAGCTACCATTCCTC

GCTGGGGGACTCAGCTCCCTGGGGATGGGGAGCCTGGGGTACCCTTCCCTGCCTCCTTCTAGAAACTTTAGGGTATTTTTGTGCAAGTGCCCCCCATGGT

TGGGGGATCCTGACAGAAATGGGGCAAACATGAAGCTGTTTCTCTAGCCCCTCAATCCAGCTGCCGTTAGCCTGGCTCTAGAAAGGCCAGGCACCTCTTC

CTACCCTCCAGCAGGAGAGCATTCCCTGCTGCCCGAAGGAGCCTTTGGGACTGAGGAAGGGGTATCCCAGCCACACCAGGGCTTCGTGAAGTTTTTGTCT

GGAGATGCTGAGGGCTTTGGGGAGAAGTATCCTCCCCCAAGTTTGGGATGAGACTAGAGATGGGGACTGGGTTCTGTCCCTTGCTTAAGCACTTTATTAA

GGGCAGGACTGGGTGGGGGTGTGGGTAACCCCCATTCTTCCACAGCCTGCAAGGGAAGGGCTTCCAGAAAGGCTGTGGACTGGGGGTTGGGGGAGACTAG

CCAGCAGTGAGCCCTGCACAGCAAGGTAATGGGGGTTGGGCAGTGACAGCCCTAGATCTGGTTTTGTAATGATTTATACAGAAATAAACACGCCTAAGCC

C
Translation
MAQGNHEAWGW WCDPTTLPPGPPAGRWPLPFSRRRREMSSNK EQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPI

LGNK - UNI37295 - TLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFI

FWGPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDR REKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCS SQRPRLQ

RMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Transcript ENSMUST00000072111
Sequence
ATGGCTTGCTCGAGGCCCCCCAGCCA GTGTGACCCCACAACCCTGCCCCCCGGGCCACCTGCCGGACGCTGGCCTCTACCCTTCAGCAGACGCCGGAGA

GAGATGAGTAGCAACAAA GAGCAGCGGTCAGCAGTGTTTGTGATCCTCTTTGCCCTCATCACCATCCTCATCCTCTACAGCTCCAACAGTGCCAACGAG

GTCTTCCACTACGGCTCCCTGCGGGGCCGCACGCGTCGGCCAGTCAACCTCAAGAAGTGGAGTTTCTCCAGCGCCTACTTCCCTATCCTCGGCAACAAG 

- UNI37295 - ACGCTGCCGTCCAGGTGCAACCAGTGTGTGATCATCACCAGCTCCAGCCACCTGCTGGGCACCAAACTGGGCCCTGAGATTGAGCGG

GCTGAGTGCACCATCCGCATGAACGATGCTCCCACCTCTGGCTACTCGGCTGACGTCGGAAACAAAACCACCTTCCGCGTAGTGGCCCATTCCAGTGTAT

TCCGTGTGCTGCGGAAGCCCCAGGAATTTGTCAACCGGACCCCTGAGACGGTGTTCATCTTCTGGGGACCCCCAAACAAGATGCAGAAGCCCCAGGGCAG

CCTCCTGCGCGTCATCCAGCGGGCGGGCCTCATGTTCCCGAACATGGAGGCCTATGCCGTCTCTCCCGCCCGCATGCAGCAGTTTGACGACCTCTTCCGG

GGTGAGACGGGCAAGGACAG GGAAAAGTCCCATTCCTGGTTGAGCACGGGCTGGTTTACCATGGTGATTGCGGTGGAATTGTGTGACCATGTGCACGTG

TATGGCATGGTCCCTCCTGACTACTGCAG CCAGCGGCCCCGCCTGCAGCGCATGCCATACCACTACTATGAACCCAAGGGGCCGGACGAGTGTGTCACC

TACATCCAGAACGAGCACAGCCGTAAGGGCAATCACCACCGCTTCATCACCGAGAAGAGGGTCTTCTCGTCCTGGGCCCAACTCTACGGTATCACCTTCT

CCCACCCCTCCTGGACCTAGTTATCCTGTCCACCGATCTCGGACAGATACAAACGAAGTGGCTCTGGCCCAGCCATTTAACCATGGCCATCTTCCAGCCA

GTTCAGGCTGGCTGGAGTATTTCCCAGCCAATCAAATCAGGGCCTTGATGAGGGTTTTTTTTTTCCTCCAGCCAATCGGGGCTGGGGTTATCTCTTGGCC

AATCAGGGATTTGGAATTCTGTATGGTTTAATCGGGTGTCAGGGGGTCTTTCTCGTCTAGTCAGGGTCTGAGCATAGTCTATCAGGGTATAGGGGTCTTT

CTGAGTCAATCTGAAGCTTAGGACATGTCTTTTCCCATAAGGCTTTGCTTCAGAGCCCCAGGAATGGGCCCCCAAATCACTCCCTCCTTAGCTGGGACAA

TGAGGTCCTGTCCTAAGGATCTGAGGACTTGGTGTTGCCCCACAGTTGCCAGAATCAGAGCTACTGTAGGGGGGAGGGGCTGCCAGGAGGCCAGGCCAAA

GGATTTGTGGAGTTCTAGGAGTGGTAGGGAAGCCTAGGAGGTAAGAGGCGGTGTCCAGTTCCCGGTTTCTTCCTGAGTGACCTTAAACAGACCCTCTTGT

CTTTCTGGTATGCTGTGATGACATCATAGCTCCGTATGTGGAGACCCTCACTCTCCGTTATACTTAAGTGTAAATTCCTCAGCTACCATTCCTCGCTGGG

GGACTCAGCTCCCTGGGGATGGGGAGCCTGGGGTACCCTTCCCTGCCTCCTTCTAGAAACTTTAGGGTATTTTTGTGCAAGTGCCCCCCATGGTTGGGGG

ATCCTGACAGAAATGGGGCAAACATGAAGCTGTTTCTCTAGCCCCTCAATCCAGCTGCCGTTAGCCTGGCTCTAGAAAGGCCAGGCACCTCTTCCTACCC

TCCAGCAGGAGAGCATTCCCTGCTGCCCGAAGGAGCCTTTGGGACTGAGGAAGGGGTATCCCAGCCACACCAGGGCTTCGTGAAGTTTTTGTCTGGAGAT

GCTGAGGGCTTTGGGGAGAAGTATCCTCCCCCAAGTTTGGGATGAGACTAGAGATGGGGACTGGGTTCTGTCCCTTGCTTAAGCACTTTATTAAGGGCAG

GACTGGGTGGGGGTGTGGGTAACCCCCATTCTTCCACAGCCTGCAAGGGAAGGGCTTCCAGAAAGGCTGTGGACTGGGGGTTGGGGGAGACTAGCCAGCA

GTGAGCCCTGCACAGCAAGGTAATGGGGGTTGGGCAGTGACAGCCCTAGATCTGGTTTTGTAATGATTTATACAGAAATAAACACGCCTAAGCCC
Translation
MACSRPPSQ QCDPTTLPPGPPAGRWPLPFSRRRREMSSNK EQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILG

NK - UNI37295 - TLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFW

GPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDR REKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCS SQRPRLQRM

PYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Transcript ENSMUST00000095044
Sequence
AGAGCGGCGCGGACCCCGGTTCTCGGCTCCCGGCGCCATGTGACGGGGTGCGGGGGCCGCGGGGGGCCGGGCGCTCCCCGGCGGAG - UNI33774 - 

ATGAGGAAACTGAGGCTCAGAGAGGTCACATGGCTTGCTCGAGGCCCCCCAGCCA GTGTGACCCCACAACCCTGCCCCCCGGGCCACCTGCCGGACGCT

GGCCTCTACCCTTCAGCAGACGCCGGAGAGAGATGAGTAGCAACAAA GAGCAGCGGTCAGCAGTGTTTGTGATCCTCTTTGCCCTCATCACCATCCTCA

TCCTCTACAGCTCCAACAGTGCCAACGAGGTCTTCCACTACGGCTCCCTGCGGGGCCGCACGCGTCGGCCAGTCAACCTCAAGAAGTGGAGTTTCTCCAG

CGCCTACTTCCCTATCCTCGGCAACAAG - UNI37295 - ACGCTGCCGTCCAGGTGCAACCAGTGTGTGATCATCACCAGCTCCAGCCACCTGCTGG

GCACCAAACTGGGCCCTGAGATTGAGCGGGCTGAGTGCACCATCCGCATGAACGATGCTCCCACCTCTGGCTACTCGGCTGACGTCGGAAACAAAACCAC

CTTCCGCGTAGTGGCCCATTCCAGTGTATTCCGTGTGCTGCGGAAGCCCCAGGAATTTGTCAACCGGACCCCTGAGACGGTGTTCATCTTCTGGGGACCC

CCAAACAAGATGCAGAAGCCCCAGGGCAGCCTCCTGCGCGTCATCCAGCGGGCGGGCCTCATGTTCCCGAACATGGAGGCCTATGCCGTCTCTCCCGCCC

GCATGCAGCAGTTTGACGACCTCTTCCGGGGTGAGACGGGCAAGGACAG GGAAAAGTCCCATTCCTGGTTGAGCACGGGCTGGTTTACCATGGTGATTG

CGGTGGAATTGTGTGACCATGTGCACGTGTATGGCATGGTCCCTCCTGACTACTGCAG CCAGCGGCCCCGCCTGCAGCGCATGCCATACCACTACTATG

AACCCAAGGGGCCGGACGAGTGTGTCACCTACATCCAGAACGAGCACAGCCGTAAGGGCAATCACCACCGCTTCATCACCGAGAAGAGGGTCTTCTCGTC

CTGGGCCCAACTCTACGGTATCACCTTCTCCCACCCCTCCTGGACCTAGTTATCCTGTCCACCGATCTCGGACAGATACAAACGAAGTGGCTCTGGCCCA

GCCATTTAACCATGGCCATCTTCCAGCCAGTTCAGGCTGGCTGGAGTATTTCCCAGCCAATCAAATCAGGGCCTTGATGAGGGTTTTTTTTTTCCTCCAG

CCAATCGGGGCTGGGGTTATCTCTTGGCCAATCAGGGATTTGGAATTCTGTATGGTTTAATCGGGTGTCAGGGGGTCTTTCTCGTCTAGTCAGGGTCTGA

GCATAGTCTATCAGGGTATAGGGGTCTTTCTGAGTCAATCTGAAGCTTAGGACATGTCTTTTCCCATAAGGCTTTGCTTCAGAGCCCCAGGAATGGGCCC

CCAAATCACTCCCTCCTTAGCTGGGACAATGAGGTCCTGTCCTAAGGATCTGAGGACTTGGTGTTGCCCCACAGTTGCCAGAATCAGAGCTACTGTAGGG

GGGAGGGGCTGCCAGGAGGCCAGGCCAAAGGATTTGTGGAGTTCTAGGAGTGGTAGGGAAGCCTAGGAGGTAAGAGGCGGTGTCCAGTTCCCGGTTTCTT

CCTGAGTGACCTTAAACAGACCCTCTTGTCTTTCTGGTATGCTGTGATGACATCATAGCTCCGTATGTGGAGACCCTCACTCTCCGTTATACTTAAGTGT

AAATTCCTCAGCTACCATTCCTCGCTGGGGGACTCAGCTCCCTGGGGATGGGGAGCCTGGGGTACCCTTCCCTGCCTCCTTCTAGAAACTTTAGGGTATT

TTTGTGCAAGTGCCCCCCATGGTTGGGGGATCCTGACAGAAATGGGGCAAACATGAAGCTGTTTCTCTAGCCCCTCAATCCAGCTGCCGTTAGCCTGGCT

CTAGAAAGGCCAGGCACCTCTTCCTACCCTCCAGCAGGAGAGCATTCCCTGCTGCCCGAAGGAGCCTTTGGGACTGAGGAAGGGGTATCCCAGCCACACC

AGGGCTTCGTGAAGTTTTTGTCTGGAGATGCTGAGGGCTTTGGGGAGAAGTATCCTCCCCCAAGTTTGGGATGAGACTAGAGATGGGGACTGGGTTCTGT

CCCTTGCTTAAGCACTTTATTAAGGGCAGGACTGGGTGGGGGTGTGGGTAACCCCCATTCTTCCACAGCCTGCAAGGGAAGGGCTTCCAGAAAGGCTGTG

GACTGGGGGTTGGGGGAGACTAGCCAGCAGTGAGCCCTGCACAGCAAGGTAATGGGGGTTGGGCAGTGACAGCCCTAGATCTGGTTTTGTAATGATTTAT

ACAGAAATAAACACGCCTAAGCCCAA
Translation
 - UNI33774 - MACSRPPSQ QCDPTTLPPGPPAGRWPLPFSRRRREMSSNK EQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNL

KKWSFSSAYFPILGNK - UNI37295 - TLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQ

EFVNRTPETVFIFWGPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDR REKSHSWLSTGWFTMVIAVELCDHVHVYGMVPP

DYCS SQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Transcript ENSMUST00000095045
Sequence
ACTTCCTCCAAGCACACAAAGATGCCCACTGACAGGTCTGGCTGTTGGCACAGCGTCTACTGAAGACTCCCATGATGAAACTCAGGGGCCCCCTCCTTGG

ACACTGTGGGTCCGGTACCTGCTGGAAG - UNI33774 - - UNI33788 - GAGCAGCGGTCAGCAGTGTTTGTGATCCTCTTTGCCCTCATCACC

ATCCTCATCCTCTACAGCTCCAACAGTGCCAACGAGGTCTTCCACTACGGCTCCCTGCGGGGCCGCACGCGTCGGCCAGTCAACCTCAAGAAGTGGAGTT

TCTCCAGCGCCTACTTCCCTATCCTCGGCAACAAG - UNI37295 - ACGCTGCCGTCCAGGTGCAACCAGTGTGTGATCATCACCAGCTCCAGCCAC

CTGCTGGGCACCAAACTGGGCCCTGAGATTGAGCGGGCTGAGTGCACCATCCGCATGAACGATGCTCCCACCTCTGGCTACTCGGCTGACGTCGGAAACA

AAACCACCTTCCGCGTAGTGGCCCATTCCAGTGTATTCCGTGTGCTGCGGAAGCCCCAGGAATTTGTCAACCGGACCCCTGAGACGGTGTTCATCTTCTG

GGGACCCCCAAACAAGATGCAGAAGCCCCAGGGCAGCCTCCTGCGCGTCATCCAGCGGGCGGGCCTCATGTTCCCGAACATGGAGGCCTATGCCGTCTCT

CCCGCCCGCATGCAGCAGTTTGACGACCTCTTCCGGGGTGAGACGGGCAAGGACAG GGAAAAGTCCCATTCCTGGTTGAGCACGGGCTGGTTTACCATG

GTGATTGCGGTGGAATTGTGTGACCATGTGCACGTGTATGGCATGGTCCCTCCTGACTACTGCAG CCAGCGGCCCCGCCTGCAGCGCATGCCATACCAC

TACTATGAACCCAAGGGGCCGGACGAGTGTGTCACCTACATCCAGAACGAGCACAGCCGTAAGGGCAATCACCACCGCTTCATCACCGAGAAGAGGGTCT

TCTCGTCCTGGGCCCAACTCTACGGTATCACCTTCTCCCACCCCTCCTGGACCTAGTTATCCTGTCCACCGATCTCGGACAGATACAAACGAAGTGGCTC

TGGCCCAGCCATTTAACCATGGCCATCTTCCAGCCAGTTCAGGCTGGCTGGAGTATTTCCCAGCCAATCAAATCAGGGCCTTGATGAGGGTTTTTTTTTT

CCTCCAGCCAATCGGGGCTGGGGTTATCTCTTGGCCAATCAGGGATTTGGAATTCTGTATGGTTTAATCGGGTGTCAGGGGGTCTTTCTCGTCTAGTCAG

GGTCTGAGCATAGTCTATCAGGGTATAGGGGTCTTTCTGAGTCAATCTGAAGCTTAGGACATGTCTTTTCCCATAAGGCTTTGCTTCAGAGCCCCAGGAA

TGGGCCCCCAAATCACTCCCTCCTTAGCTGGGACAATGAGGTCCTGTCCTAAGGATCTGAGGACTTGGTGTTGCCCCACAGTTGCCAGAATCAGAGCTAC

TGTAGGGGGGAGGGGCTGCCAGGAGGCCAGGCCAAAGGATTTGTGGAGTTCTAGGAGTGGTAGGGAAGCCTAGGAGGTAAGAGGCGGTGTCCAGTTCCCG

GTTTCTTCCTGAGTGACCTTAAACAGACCCTCTTGTCTTTCTGGTATGCTGTGATGACATCATAGCTCCGTATGTGGAGACCCTCACTCTCCGTTATACT

TAAGTGTAAATTCCTCAGCTACCATTCCTCGCTGGGGGACTCAGCTCCCTGGGGATGGGGAGCCTGGGGTACCCTTCCCTGCCTCCTTCTAGAAACTTTA

GGGTATTTTTGTGCAAGTGCCCCCCATGGTTGGGGGATCCTGACAGAAATGGGGCAAACATGAAGCTGTTTCTCTAGCCCCTCAATCCAGCTGCCGTTAG

CCTGGCTCTAGAAAGGCCAGGCACCTCTTCCTACCCTCCAGCAGGAGAGCATTCCCTGCTGCCCGAAGGAGCCTTTGGGACTGAGGAAGGGGTATCCCAG

CCACACCAGGGCTTCGTGAAGTTTTTGTCTGGAGATGCTGAGGGCTTTGGGGAGAAGTATCCTCCCCCAAGTTTGGGATGAGACTAGAGATGGGGACTGG

GTTCTGTCCCTTGCTTAAGCACTTTATTAAGGGCAGGACTGGGTGGGGGTGTGGGTAACCCCCATTCTTCCACAGCCTGCAAGGGAAGGGCTTCCAGAAA

GGCTGTGGACTGGGGGTTGGGGGAGACTAGCCAGCAGTGAGCCCTGCACAGCAAGGTAATGGGGGTTGGGCAGTGACAGCCCTAGATCTGGTTTTGTAAT

GATTTATACAGAAATAAACACGCCTAAGCCC
Translation
MMKLRGPLLGHCGSGTCWK - UNI33774 - - UNI33788 - EQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYF

PILGNK - UNI37295 - TLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETV

FIFWGPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDR REKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCS SQRPR

LQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

For any suggestions or comments, please send an email to unitrap@crg.es