Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026835 (Fcnb)
Chromosomal location
Chr 2: 27931999 - 27940405 (-)
Description
ficolin B Gene [Source:MGI (curated);Acc:Fcnb-001]
Human Ortholog
not available
Omim not available
UniTrap UNI38504
Vector Insertion
Chr 2: 27938425 - 27940399
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117486
Sequence
AGAGGGGGTTGGGAGCCGACCAGTTGCCATGGCCCTGGGATCTGCTGCACTATTCGTCTTGACCCTGACTGTCCATGCGGCTGGCACATGCCCAG - UN

I38504 - AACTGAAGGTCCTAGATCTGGAAGGCTACAAGCAGCTCACCATCCTTCAAGGTTGCCCTGGCTTGCCTGGAGCTGCAGGGCCCAAGGGAGA

GGCAGGTGCCAAAGGAGATAGAG - UNI38504 - GAGAGAGTGGCCTTCCTGGAATTCCTGGAAAAGAAGGACCAACTGGACCCAAAG GAAACCAA

GGAGAAAAAGGAATACGTGGAGAAAAAG GAGACTCTGGGCCCTCTCAGTCATGTGCTACAG GACCTCGGACCTGCAAGGAGTTGCTCACCCAGGGCCA

CTTTCTCACTGGCTGGTATACCATCTATCTGCCAGACTGCAGGCCCCTGACTGTGCTGTGTGACATGGACACAGATGGTGGAGGCTGGACC GTCTTCCA

GAGGAGGCTTGACGGCTCTGTGGACTTCTTTCGGGACTGGACCTCATACAAGAGGGGCTTTGGCAGCCAACTAGGGGAGTTCTGGCTGGGGAATGATAAT

ATCCACGCTCTAACCACCCAGG GAACCAGTGAGCTGCGGGTGGATCTTTCAGACTTCGAAGGCAAGCATGACTTTGCCAAGTACAGCTCCTTCCAGATC

CAGGGAGAGGCCGAGAAATACAAGCTTATCCTGGGAAACTTCCTTGGCGGTGGTGCTGGTGAGCAGCTTGGGTTTGGGGGGCTTACCTGTGAAGTGAGGG

CTTCTGAACTACTCTGGGAGTAGAAGGGCCTGCTTTGCATCTCCCCCTGGTGGCCTTGAGCCTAGGGTTGACATCAGCGAAATACTAATATCTGCATCTT

TACACC
Translation
MALGSAALFVLTLTVHAAGTCPE - UNI38504 - ELKVLDLEGYKQLTILQGCPGLPGAAGPKGEAGAKGDRG - UNI38504 - GESGLPGIPG

KEGPTGPKG GNQGEKGIRGEKG GDSGPSQSCATG GPRTCKELLTQGHFLTGWYTIYLPDCRPLTVLCDMDTDGGGWT VFQRRLDGSVDFFRDWTSY

KRGFGSQLGEFWLGNDNIHALTTQG GTSELRVDLSDFEGKHDFAKYSSFQIQGEAEKYKLILGNFLGGGAGEQLGFGGLTCEVRASELLWE
Transcript ENSMUST00000028179
Sequence
GTTGGGAGCCGACCAGTTGCCATGGCCCTGGGATCTGCTGCACTATTCGTCTTGACCCTGACTGTCCATGCGGCTGGCACATGCCCAG - UNI38504 

- AACTGAAGGTCCTAGATCTGGAAGGCTACAAGCAGCTCACCATCCTTCAAGGTTGCCCTGGCTTGCCTGGAGCTGCAGGGCCCAAGGGAGAGGCAGGT

GCCAAAGGAGATAGAG - UNI38504 - GAGAGAGTGGCCTTCCTGGAATTCCTGGAAAAGAAGGACCAACTGGACCCAAAG GAAACCAAGGAGAAA

AAGGAATACGTGGAGAAAAAG GAGACTCTGGGCCCTCTCAGTCATGTGCTACAG GACCTCGGACCTGCAAGGAGTTGCTCACCCAGGGCCACTTTCTC

ACTGGCTGGTATACCATCTATCTGCCAGACTGCAGGCCCCTGACTGTGCTGTGTGACATGGACACAGATGGTGGAGGCTGGACC GTCTTCCAGAGGAGG

CTTGACGGCTCTGTGGACTTCTTTCGGGACTGGACCTCATACAAGAGGGGCTTTGGCAGCCAACTAGGGGAGTTCTGGCTGGGGAATGATAATATCCACG

CTCTAACCACCCAGG GAACCAGTGAGCTGCGGGTGGATCTTTCAGACTTCGAAGGCAAGCATGACTTTGCCAAGTACAGCTCCTTCCAGATCCAGGGAG

AGGCCGAGAAATACAAGCTTATCCTGGGAAACTTCCTTGGCGGTGGTGCTG GTGACTCTCTGACACCCCATAACAACAGGTTATTCTCCACCAAAGACC

AAGACAATGACGGCAGTACTTCCAGCTGTGCCATGGGTTACCATGGAGCCTGGTGGTACTCCCAGTGCCACACTTCCAACCTGAATGGCCTCTACCTGAG

GGGTCCCCATAAGAGCTATGCAAATGGTGTCAACTGGAAGTCATGGAGAGGGTACAACTACAGCTGCAAGGTTTCTGAGATGAAGGTGCGGCTCATCTAG

CTTCCCACACAGGGAGCACCCCTCCCAGACTCTTCCATCTTCACTGCTAGCTAAGGATGGAGTGTGCCCACCCACCCTGCTCTGCCCACTGCTCAC
Translation
MALGSAALFVLTLTVHAAGTCPE - UNI38504 - ELKVLDLEGYKQLTILQGCPGLPGAAGPKGEAGAKGDRG - UNI38504 - GESGLPGIPG

KEGPTGPKG GNQGEKGIRGEKG GDSGPSQSCATG GPRTCKELLTQGHFLTGWYTIYLPDCRPLTVLCDMDTDGGGWT VFQRRLDGSVDFFRDWTSY

KRGFGSQLGEFWLGNDNIHALTTQG GTSELRVDLSDFEGKHDFAKYSSFQIQGEAEKYKLILGNFLGGGAG GDSLTPHNNRLFSTKDQDNDGSTSSCA

MGYHGAWWYSQCHTSNLNGLYLRGPHKSYANGVNWKSWRGYNYSCKVSEMKVRLI

For any suggestions or comments, please send an email to unitrap@crg.es