Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026837 (Col5a1)
Chromosomal location
Chr 2: 27742205 - 27893044 (+)
Description
collagen, type V, alpha 1 Gene [Source:MGI (curated);Acc:Col5a1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36764
Vector Insertion
Chr 2: 27845612 - 27847513
Public Clones IST10080F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028280
Sequence
CGGGCGGGTGCCGAGCTTCCTATGACTCCCTGAAGTTGTCGTGCTCCCCTAGCGTCCGCCACCCGGGACGTGTCTCTGGTCCCCGTGCATCGTGTGCGTC

TCCCGCTCCCCGGCCCGCGCACCCCGCCGGCATGGACGTACACACCCGCTGGAAAGCTGCGCGCCCAGGCGCCCTGCTGCTGTCTTCGCCGCTACTCCTG

TTCCTGCTGCTGCTGTGGGCGCCGCCTTCGAGCCGCGCAG CTCAGCCAGCAGATCTTCTGGAGATGCTAGATTTTCACAATTTGCCCTCAGGGGTAACG

AAAACCACAGGTTTCTGTGCTACTCGAAGATCTTCCAGCGAGCCGGATGTTGCCTACCGAGTCTCTAAAGATGCACAGCTCAGCATGCCCACCAAGCAGC

TGTACCCTG AGTCTGGTTTTCCCGAGGACTTCTCCATCCTGACAACCGTGAAAGCCAAGAAAGGCAGCCAGGCCTTCCTAGTCTCCATTTACAATGAGC

AGGGCATCCAGCAGTTGGGGCTGGAGCTGGGCCGCTCCCCTGTCTTCCTCTATGAGGACCACACAGGGAAGCCCGGGCCTGAAGAGTATCCGCTTTTCCC

TGGCATCAACTTGTCCGATGGCAA GTGGCACCGAATTGCTCTCAGTGTCTACAAGAAAAATGTCACCTTGATCCTCGACTGTAAGAAGAAGATTACGAA

GTTCCTCAGCCGCAGTGACCACCCCATAATAGACACCAATGGGATTGTCATGTTTGGCTCCCGGATTCTGGATGATGAAATATTTGAG GGTGACATCCA

ACAGTTGCTTTTCGTCTCTGACAACCGAGCTGCCTATGACTACTGTGAGCACTACAGCCCCGACTGTGACACTGCGGTCCCTGACACACCTCAGTCACAG

GACCCTAACCCGGATGAATAT TACCCAGAAGGAGAGGGTGAGACCTATTACTATGAGTATCCATATTATGAAGACCCTGAAGACCCGGGAAAGGAGCCT

GCCCCTACTCAGAAGCCAGTGGAAGCTGCCAGAGAAACCACAGAGGTTCCTGAG GAGCAGACCCAGCCCCTACCCGAAGCCCCTACAGTGCCTGAGACC

AGTGACACGGCTGACAAGGAGGACAGTCTAGGGATCGGGGACTATGACTACGTGCCCCCAGATGACTATTACACTCCACCCCCATATGAAGACTTTGGAT

ATGGCGAGGGTGTGGAGAACCCTGACCAGCCCACCAACCCCGACTCAGGGGCTGAGGTCCCCACCAGCACCACTGTTACCTCCAACACCTCCAAT CCAG

CTCCAGGAGAAGGGAAGGATGACCTGGGCGGCGAATTCACCGAGGAAACCATCAAGAATCTAGAGGAAAACTACTATGACCCGTACTTTGACCCCGACTC

CGACTCCAGTGTCTCTCCATCAGAGATAGGGCCAGGCATGCCCGCTAACCAGGACACCATCTTTGAGGGG ATTGGAGGACCCCGAGGTGAGAAAGGGCA

AAAGGGAGAACCAGCCATCATTGAGCCG GGGATGCTGATCGAGGGGCCCCCTGGCCCTGAAGGCCCTGCT GGTCTTCCAGGACCTCCAGGAACTACAG

GTCCTACTGGCCAAATGGGTGACCCTGGAGAAAGG GGTCCCCCTGGGCGCCCAGGTCTTCCTGGAGCTGATGGCTTGCCTGGCCCCCCAGGTACCATGC

TCATGCTGCCG TTCCGGTTTGGAGGCGGTGGCGATGCCGGTTCTAAGGGCCCCATGGTCTCTGCGCAGGAGTCCCAGGCCCAGGCTATCCTCCAGCAAG

CCAGG TTGGCACTGAGGGGACCAGCTGGCCCAATGGGTCTCACCGGGAGACCTGGCCCCATG GGTCCTCCTGGGAGTGGCGGTTTGAAAGGTGAGCCA

GGAGACATGGGACCTCAG GGTCCTCGAGGTGTGCAAGGCCCACCTGGCCCAACAGGGAAGCCTGGAAGACGG GGCCGTGCTGGAAGTGATGGAGCCAG

AGGCATGCCTGGACAAACAGGCCCCAAG GGTGACCGTGGCTTTGATGGTCTGGCTGGGTTGCCGGGAGAGAAAGGCCATAGA GGTGACCCTGGTCCTT

CTGGCCCGCCCGGAATCCCAGGAGATGATGGAGAAAGG GGTGACGATGGAGAAGTTGGGCCCAGGGGACTGCCCGGGGAGCCT GGACCACGTGGTCTG

CTTGGGCCAAAAGGCCCCCCAGGGCCTCCTGGACCTCCT GGTGTAACGGGTATGGATGGCCAGCCTGGCCCAAAAGGAAATGTG GGTCCCCAGGGAGA

GCCTGGGCCGCCAGGACAGCAGGGTAATCCTGGTGCCCAG GGTCTTCCAGGTCCCCAGGGTGCCATTGGTCCTCCAGGAGAAAAG GGTCCTTTGGGGA

AACCAGGTCTCCCAGGAATGCCAGGCGCTGATGGACCCCCG GGGCACCCTGGAAAAGAAGGTCCTCCAGGAGAGAAAGGAGGCCAG GGTCCTCCTGGC

CCCCAGGGTCCCATTGGCTACCCCGGTCCACGAGGAGTCAAG GGGGCAGATGGCATCCGAGGTCTGAAGGGCACCAAGGGGGAGAAG GGTGAAGACGG

CTTCCCTGGGTTTAAAGGCGACATGGGAATAAAGGGTGACCGG GGGGAAATCGGCCCACCTGGTCCCCGAGGAGAAGATGGTCCTGAAGGTCCAAAGGG

TCGAGGTGGTCCCAATGGTGATCCTGGTCCCCTGGGGCCCACTGGGGAAAAG GGAAAGCTTGGCGTGCCCGGATTACCGGGGTACCCAGGAAGACAAGG

GCCAAAG - UNI36764 - GGTTCCATTGGATTCCCTGGCTTCCCGGGCGCCAACGGAGAGAAGGGTGGCAGG GGGACACCTGGAAAGCCAGGACCA

CGGGGACAGAGAGGCCCAACG GGCCCGCGGGGTGAACGAGGCCCACGAGGCATCACGGGGAAGCCTGGCCCTAAG GGCAACTCCGGAGGTGATGGCCC

AGCTGGCCCTCCTGGTGAACGG GGACCCAACGGACCCCAAGGTCCCACCGGCTTTCCTGGACCCAAGGGTCCCCCG GGCCCACCAGGCAAGGACGGAC

TCCCTGGACACCCTGGGCAGAGAGGGGAGACC GGTTTCCAAGGCAAGACTGGCCCTCCAGGGCCCCCAGGAGTGGTTGGCCCTCAG GGTCCCACAGGA

GAGACGGGCCCCATGGGTGAGCGTGGCCATCCTGGTCCTCCAGGCCCTCCTGGTGAACAGGGCCTCCCAGGTGCTGCTGGGAAAGAAGGAACGAAG GGT

GACCCAGGTCCTGCTGGCCTCCCTGGGAAGGATGGCCCTCCAGGATTGCGTGGATTCCCTGGGGACCGAGGGCTACCTGGCCCCGTG GGAGCCCTTGGA

CTCAAAGGCAGTGAAGGCCCCCCTGGCCCACCAGGTCCTGCG GGTTCTCCAGGGGAGAGAGGACCAGCTGGTGCCGCTGGGCCCATCGGAATTCCAGGG

AGACCTGGGCCTCAGGGACCTCCGGGGCCTGCTGGAGAGAAAGGACTTCCT GGCGAGAAAGGTCCACAAGGCCCAGCTGGCCGAGATGGCCTCCAAGGT

CCCGTGGGGCTCCCTGGACCAGCCGGCCCAGTGGGTCCTCCTGGAGAAGATGGAGATAAG GGAGAGATCGGAGAGCCAGGGCAGAAGGGAAGCAAGGGC

GACAAAGGCGAGCAG GGTCCTCCTGGGCCTACCGGTCCTCAAGGCCCGATTGGACAGCCAGGCCCTTCG GGAGCAGATGGTGAACCTGGCCCTCGTGG

ACAGCAGGGCCTGTTTGGGCAGAAAGGAGATGAAGGTTCAAGAGGTTTCCCAGGACCCCCCGGGCCAGTGGGATTGCAG GGTTTGCCAGGACCTCCAGG

AGAAAAGGGCGAGACAGGAGACGTGGGCCAGATG GGCCCTCCTGGTCCACCAGGCCCCCGAGGACCCTCTGGAGCTCCAGGTGCCGATGGACCACAGGG

TCCTCCTGGAGGGATTGGCAACCCTGGTGCAGTCGGAGAAAAG GGAGAACCTGGTGAAGCTGGAGATCCTGGCCTTCCAGGAGAAGGAGGTCCCCTG G

GACCTAAAGGAGAAAGAGGGGAGAAGGGAGAGGCTGGCCCCTCTGGTGCTGCTGGACCCCCTGGACCCAAAGGCCCTCCTGGAGATGATGGCCCCAAAGG

CAGCCCT GGCCCTGTGGGCTTTCCTGGAGATCCTGGTCCCCCTGGAGAGCCAGGCCCCGCA GGTCAAGACGGCCCACCTGGTGACAAAGGGGACGATG

GTGAACCTGGGCAGACG GGGTCCCCGGGCCCTACTGGTGAACCTGGTCCATCTGGGCCTCCAGGAAAGAGG GGTCCCCCAGGCCCTGCAGGCCCTGAA

GGCAGGCAGGGGGAGAAAGGAGCCAAG GGAGAAGCTGGCTTAGAAGGCCCTCCTGGGAAGACTGGCCCCATTGGCCCCCAAGGGGCCCCTGGGAAGCCT

GGCCCCGATGGTCTCCGTGGAATCCCTGGTCCTGTG GGTGAGCAAGGCCTCCCAGGATCCCCAGGCCCCGATGGTCCACCCGGCCCCATG GGTCCTCC

AGGACTCCCTGGCCTCAAAGGAGACTCCGGTCCCAAAGGTGAAAAG GGCCATCCAGGCCTGATTGGACTCATCGGCCCTCCGGGAGAGCAAGGTGAAAA

GGGTGACCGTGGACTCCCAGGCCCCCAGGGTTCATCTGGTCCTAAAGGAGATCAG GGCATCACAGGTCCTTCTGGCCCACTTGGGCCTCCTGGTCCTCC

TGGCTTGCCG GGCCCTCCAGGTCCCAAAGGTGCTAAGGGCTCTTCG GGTCCCACCGGCCCGAAGGGTGAGGCAGGCCACCCAGGACTCCCCGGCCCAC

CT GGCCCTCCGGGTGAGGTCATCCAGCCCCTGCCAATCCAGGCCTCCAGGACTCGGCGGAACATTGATGCCAGCCAGCTCCTGGACGATGGGGCTGGGG

AGAGCTACGTGGATTATGCAGATGGCATGGAAGAGATCTTTGGTTCCCTCAACTCCCTGAAGCTGGAGATTGAACAGATGAAGCGACCACTGGGCACCCA

GCAGAACCCAGCCCGTACCTGCAAGGATCTACAGCTCTGTCATCCTGACTTCCCAGATG GCGAATACTGGGTCGATCCCAACCAAGGGTGCTCCAGGGA

CTCCTTCAAAGTCTACTGCAATTTCACAGCTGGAGGGTCCACGTGCGTCTTCCCTGACAAGAAGTCTGAGGGA GCCAGAATCACTTCTTGGCCCAAAGA

AAACCCAGGTTCCTGGTTCAGTGAATTCAAGCGTGGGAAACTG CTCTCCTATGTGGATGCTGAAGGCAACCCCGTGGGCGTGGTACAAATGACCTTCCT

GCGGCTGCTGAGCGCCTCTGCCCACCAGAACGTCACCTACAACTGCTACCAGTCCGTGGCCTGGCAGGATGCCGCCACAGGCAGCTATGATAAGGCTATC

CGCTTCTTGGGCTCCAACGATGAGGAAATGTCTTATGATAACAACCCCTACATCCGTGCCCTGGTGGATGGCTGTGCT ACCAAGAAAGGCTACCAGAAG

ACGGTGCTGGAGATCGACACGCCCAAAGTAGAGCAAGTCCCCATTGTGGACATCATGTTCAACGACTTTGGCGAAGCCTCACAGAAATTTGGATTTGAAG

TGGGGCCAGCTTGCTTCCTAGGCTAGGAGCTGCTGAGCCCACCGGTCTCCAGAGCAACCTCGTGACCTCAGCACCCCACCTGTGGGCGTCCTGTGCACGG

CCCATCCCGGACAGTGAACATTTCTCACCCCTGCCTGCCTGACTCATCTGTGCCTCGGACCCTCCGTGGCATTGGACCCCATGCCCAGAGAGAACAAAGG

GAAAGAGCCGTGTCCCCACGGAGCCGAATCACATGACCTAGCCACACCACAGCCTCTTGCCACCCTTCAGCTCTCAGGATAGGTTCATTAAAGGTGTTAA

TGGACCGTTGGCCGGGAGTGGGGGCGGGACAGTATTTGAAGATCACTTTAAAAAAAATTCAACTTGAAGATATGTATTCCCCCTGACCTTCAAAAGATGT

TCTGAGGTGGTCTTGTAAAGGTCGCCAAAGCCTCCATTTTTTTTTAAAACAACCCTCAACACATCCACTCAGAGGCCAAATGTCATTCCACACGTGCCTT

TCCGATGGATTAAAGGTGCTTATGTTTTTGTGAG
Translation
MDVHTRWKAARPGALLLSSPLLLFLLLLWAPPSSRAA AQPADLLEMLDFHNLPSGVTKTTGFCATRRSSSEPDVAYRVSKDAQLSMPTKQLYPE ESGF

PEDFSILTTVKAKKGSQAFLVSIYNEQGIQQLGLELGRSPVFLYEDHTGKPGPEEYPLFPGINLSDGK KWHRIALSVYKKNVTLILDCKKKITKFLSRS

DHPIIDTNGIVMFGSRILDDEIFE GDIQQLLFVSDNRAAYDYCEHYSPDCDTAVPDTPQSQDPNPDEY YPEGEGETYYYEYPYYEDPEDPGKEPAPTQ

KPVEAARETTEVPE EQTQPLPEAPTVPETSDTADKEDSLGIGDYDYVPPDDYYTPPPYEDFGYGEGVENPDQPTNPDSGAEVPTSTTVTSNTSN PAPG

EGKDDLGGEFTEETIKNLEENYYDPYFDPDSDSSVSPSEIGPGMPANQDTIFEG IGGPRGEKGQKGEPAIIEP GMLIEGPPGPEGPA GLPGPPGTTG

PTGQMGDPGER GPPGRPGLPGADGLPGPPGTMLMLP FRFGGGGDAGSKGPMVSAQESQAQAILQQAR LALRGPAGPMGLTGRPGPM GPPGSGGLKG

EPGDMGPQ GPRGVQGPPGPTGKPGRR GRAGSDGARGMPGQTGPK GDRGFDGLAGLPGEKGHR GDPGPSGPPGIPGDDGER GDDGEVGPRGLPGEP

 GPRGLLGPKGPPGPPGPP GVTGMDGQPGPKGNV GPQGEPGPPGQQGNPGAQ GLPGPQGAIGPPGEK GPLGKPGLPGMPGADGPP GHPGKEGPPG

EKGGQ GPPGPQGPIGYPGPRGVK GADGIRGLKGTKGEK GEDGFPGFKGDMGIKGDR GEIGPPGPRGEDGPEGPKGRGGPNGDPGPLGPTGEK GKL

GVPGLPGYPGRQGPK - UNI36764 - GSIGFPGFPGANGEKGGR GTPGKPGPRGQRGPT GPRGERGPRGITGKPGPK GNSGGDGPAGPPGER G

PNGPQGPTGFPGPKGPP GPPGKDGLPGHPGQRGET GFQGKTGPPGPPGVVGPQ GPTGETGPMGERGHPGPPGPPGEQGLPGAAGKEGTK GDPGPAG

LPGKDGPPGLRGFPGDRGLPGPV GALGLKGSEGPPGPPGPA GSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGLP GEKGPQGPAGRDGLQGPVGL

PGPAGPVGPPGEDGDK GEIGEPGQKGSKGDKGEQ GPPGPTGPQGPIGQPGPS GADGEPGPRGQQGLFGQKGDEGSRGFPGPPGPVGLQ GLPGPPGE

KGETGDVGQM GPPGPPGPRGPSGAPGADGPQGPPGGIGNPGAVGEK GEPGEAGDPGLPGEGGPL GPKGERGEKGEAGPSGAAGPPGPKGPPGDDGPK

GSP GPVGFPGDPGPPGEPGPA GQDGPPGDKGDDGEPGQT GSPGPTGEPGPSGPPGKR GPPGPAGPEGRQGEKGAK GEAGLEGPPGKTGPIGPQGA

PGKPGPDGLRGIPGPV GEQGLPGSPGPDGPPGPM GPPGLPGLKGDSGPKGEK GHPGLIGLIGPPGEQGEKGDRGLPGPQGSSGPKGDQ GITGPSGP

LGPPGPPGLP GPPGPKGAKGSS GPTGPKGEAGHPGLPGPP GPPGEVIQPLPIQASRTRRNIDASQLLDDGAGESYVDYADGMEEIFGSLNSLKLEIE

QMKRPLGTQQNPARTCKDLQLCHPDFPDG GEYWVDPNQGCSRDSFKVYCNFTAGGSTCVFPDKKSEG ARITSWPKENPGSWFSEFKRGKL LSYVDAE

GNPVGVVQMTFLRLLSASAHQNVTYNCYQSVAWQDAATGSYDKAIRFLGSNDEEMSYDNNPYIRALVDGCA TKKGYQKTVLEIDTPKVEQVPIVDIMFN

DFGEASQKFGFEVGPACFLG

For any suggestions or comments, please send an email to unitrap@crg.es