Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026842 (Abl1)
Chromosomal location
Chr 2: 31544833 - 31659747 (+)
Description
c-abl oncogene 1, receptor tyrosine kinase Gene [Source:MGI (curated);Acc:Abl1-001]
RefSeq_dna
NM_009594 
RefSeq_peptide
NP_033724.2 NP_001106174.1 
UniGene
Mm.1318 
MGI
MGI:87859 
Uniprot/SWISSPROT
P00520 
Uniprot/SPTREMBL
A2AV23 Q3TM13 Q3V2W1 A2AV22 Q3SYK5 
Human Ortholog
ENSG00000097007 (ABL1)
Omim 608232 - LEUKEMIA, CHRONIC MYELOID  
UniTrap UNI30094
Vector Insertion
Chr 2: 31546280 - 31615499
Public Clones D119D11 (ggtc) (ggtc) IST12578A1 (tigm) IST12858E9 (tigm) IST12040A2 (tigm)
IST11638C12 (tigm) IST14478B5 (tigm) IST13621F8 (tigm) IST10837F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34641
Vector Insertion
Chr 2: 31615636 - 31615911
Public Clones (ggtc) IST14158B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13304
Vector Insertion
Chr 2: 31615976 - 31633853
Public Clones CMHD-GT_329A6-3 (cmhd) IST14387B1 (tigm) IST10055A5 (tigm) IST12712D9 (tigm)
IST10070E5 (tigm) IST10845G1 (tigm) IST10898D9 (tigm) IST14387C1 (tigm)
IST13375A12 (tigm) IST14374F7 (tigm) IST14234G2 (tigm)
Private Clones OST284481 (lexicon) OST220388 (lexicon) OST169194 (lexicon) OST130711 (lexicon)
OST52877 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24585
Vector Insertion
Chr 2: 31634028 - 31634440
Public Clones not available
Private Clones OST214073 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3159
Vector Insertion
Chr 2: 31640300 - 31645790
Public Clones XT0574 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5367
Vector Insertion
Chr 2: 31655725 - 31659055
Public Clones SYA125 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113454
Sequence
ATGTCACAAAGGTGGACCTACACCAAGTGCCGCGTACAAAGGGATCCCGCTCTACCATTTATGG - UNI13304 - AAGCCCTGCAGAGGCCAGTGGC

ATCTGACTTTGAGCCCCAGGGTCTCAGCGAAGCAGCTCGATGGAACTCCAAGGAAAACCTTCTTGCTGGGCCCAGTGAAAATGACCCCAACCTTTTTGTG

GCACTCTATGATTTTGTGGCCAGTGGAGATAACACTCTCAGCATCACTAAAG - UNI24585 - GTGAAAAGCTCCGGGTCTTGGGTTATAATCACAA

TGGGGAATGGTGTGAAGCCCAAACGAAAAATGGCCAAGGATGGGTCCCAAGCAACTACATCACCCCCGTCAACAGCCTGGAGAAACATTCCTGGTATCAT

GGCCCTGTATCTCGGAATGCTGCTGAGTATCTGCTGAGCAGCGGAATCAACGGCAGCTTCTTAGTGCGGGAGAGTGAGAGTAGCCCTGGCCAGAGATCCA

TCTCGCTGCGGTATGAAGGGAGGGTGTACCACTACAGGATCAACACTGCCTCTGATGGCAAG CTGTACGTGTCCTCCGAGAGCCGCTTCAACACTCTGG

CTGAGTTAGTTCACCATCACTCCACGGTGGCTGATGGCCTCATCACCACACTCCACTACCCAGCTCCCAAGCGCAACAAGCCCACTATCTACGGTGTGTC

CCCCAACTACGACAAGTGGGAAATGGAGCGCACCGACATCACCATGAAGCACAAGTTGGGTGGAGGCCAGTACGGGGAGGTGTACGAGGGCGTTTGGAAG

AAGTACAGCCTCACTGTGGCCGTGAAGACCTTGAAG - UNI3159 - GAGGACACCATGGAGGTGGAGGAGTTCCTGAAGGAAGCGGCGGTGATGAAG

GAGATCAAACACCCTAACCTGGTGCAGCTGCTAG GGGTGTGTACCCGGGAACCACCATTCTACATAATCACTGAGTTCATGACCTATGGGAACCTGCTG

GACTACCTGAGGGAGTGTAACCGGCAGGAGGTGAGCGCCGTGGTACTGCTCTACATGGCCACACAGATCTCATCAGCCATGGAGTACTTGGAGAAGAAGA

ACTTCATCCACAG AGACCTTGCTGCCCGGAACTGCCTGGTAGGGGAAAACCACTTGGTGAAGGTGGCTGATTTTGGCCTGAGCAGGTTGATGACAGGGG

ACACCTACACGGCCCATGCTGGAGCCAAATTCCCCATCAAATGGACCGCACCTGAGAGCCTGGCCTACAACAAGTTCTCCATCAAGTCGGACGTGTGGG 

CATTTGGAGTATTGCTCTGGGAGATTGCTACCTATGGCATGTCACCTTACCCGGGAATTGACCTGTCTCAGGTTTATGAGCTGCTGGAAAAAGACTACCG

CATGGAGCGCCCTGAAGGCTGCCCGGAGAAGGTCTACGAGCTCATGCGAGCAT GTTGGCAGTGGAACCCCTCTGACCGGCCCTCCTTTGCTGAAATCCA

CCAAGCCTTTGAAACCATGTTCCAGGAATCCAGTATCTCAGATG AGGTGGAGAAGGAGCTGGGGAAACGAGGCACGAGAGGAGGTGCTGGGAGTATGCT

GCAGGCCCCAGAGCTGCCCACCAAGACCAGAACCTGCAGGAGAGCAGCTGAGCAGAAAGATGCGCCTGACACCCCTGAGCTGCTCCACACGAAGGGCCTG

GGAGAAAGCG - UNI5367 - ATGCACTGGACAGTGAGCCTGCTGTATCGCCACTGCTTCCTCGGAAAGAGCGCGGGCCCCCAGACGGCAGCCTAAAT

GAAGATGAGCGCCTTCTCCCCAGAGACAGAAAGACCAACCTGTTCAGCGCTTTGATCAAGAAGAAGAAGAAAATGGCGCCGACGCCCCCTAAGCGCAGCA

GTTCCTTCCGAGAGATGGATGGCCAGCCAGACCGCAGAGGGGCTAGTGAGGATGACAGCAGGGAACTCTGCAATGGACCACCAGCTCTCACCTCAGACGC

AGCAGAGCCTACCAAGTCCCCAAAGGCCAGCAATGGGGCTGGCGTCCCTAATGGAGCCTTCCGGGAGCCGGGCAACTCAGGCTTCCGTTCTCCCCACATG

TGGAAAAAGTCCAGCACACTGACCGGGAGCCGCCTGGCTGCTGCCGAAGAGGAGAGCGGCATGAGCTCCAGTAAGCGCTTCCTGCGTTCTTGTTCGGCCT

CCTGCATGCCCCATGGGGCAAGGGACACAGAGTGGCGGTCGGTCACGCTGCCTCGAGACCTGCCGTCTGCTGGCAAGCAGTTTGACTCATCCACCTTTGG

AGGGCACAAAAGCGAAAAGCCAGCTCTGCCTCGGAAACGCACCAGTGAGAGCAGGTCTGAGCAGGTGGCCAAAAGCACGGCGATGCCCCCTCCCCGGCTG

GTGAAGAAGAACGAGGAGGCTGCTGAAGAAGGCTTCAAAGACACAGAATCCAGCCCTGGCTCCAGCCCTCCCAGCTTGACTCCCAAACTCCTCCGCAGGC

AGGTCACTGCCTCTCCTTCCTCTGGCCTCTCTCACAAGGAAGAGGCCACCAAGGGCAGTGCCTCAGGCATGGGGACTCCGGCCACTGCAGAGCCAGCACC

CCCCAGCAACAAAGTGGGCCTCAGCAAGGCCTCCTCTGAGGAGATGCGCGTAAGGAGGCACAAGCACAGCTCGGAGTCCCCAGGGAGAGACAAGGGGCGA

CTGGCTAAGCTCAAGCCTGCCCCGCCGCCTCCTCCTGCCTGCACAGGAAAAGCAGGCAAGCCCGCACAGAGCCCCAGCCAAGAGGCCGGGGAGGCAGGGG

GGCCCACAAAGACAAAATGCACGAGTCTGGCTATGGATGCTGTGAACACTGACCCCACCAAGGCCGGCCCACCTGGAGAAGGACTGAGAAAGCCTGTGCC

CCCATCTGTGCCAAAGCCCCAGTCGACGGCTAAGCCTCCAGGGACTCCCACCAGCCCGGTCTCCACCCCCTCCACAGCACCAGCTCCTTCACCCCTGGCT

GGGGACCAGCAGCCATCTTCTGCCGCCTTCATCCCCCTCATATCAACCCGTGTGTCTCTTAGGAAGACCCGCCAGCCGCCAGAGCGCATTGCCAGTGGCA

CCATCACCAAGGGTGTGGTTCTGGACAGTACTGAGGCCCTGTGCCTTGCCATCTCCCGGAACTCAGAGCAGATGGCCAGCCACAGTGCTGTACTGGAGGC

TGGCAAGAACCTGTACACTTTCTGTGTGAGCTATGTGGACTCTATCCAGCAGATGAGGAACAAGTTTGCCTTCCGTGAGGCTATCAACAAGCTGGAGAGC

AACCTCCGAGAGCTGCAGATCTGCCCTGCCACAGCCTCCAGTGGGCCAGCTGCCACCCAAGACTTCAGCAAGCTGCTCAGCTCTGTGAAGGAGATCAGCG

ACATTGTCCGGAGGTAGCAGCAACCAGTGTATGTCAGCAAGAGATGTTGCAGTTCACAGGGCTCTTGTGCCTATAAAGATGGGGACAGGGGACTGGGGAG

CTGGCGTCTTTCCCCAGGAGCTTTAAAGAGAGACAAGCAGAGCCTGAGGGAGACCTGGATGGAGCCTGGTGGAGTTGGCTCTTCCTCCTGTGTTGTGCAC

CAGCTGCCCTGCACCTTTCCTGTCCAGCCCAGGCGTCAGCCACCTCTCCTCACTGCCTGTGGATGGGTCTCCTGCTCTGAAGACTACATCTGGCCTGCCT

GGCCACCAGGCTTCTCACTCCCCGGTGCCTCAGACCCAGCTCCCAGGTCAGCCTGGAGTGCTCTTCCCTGTCCTTGCAGAACGACCTCCTCTGATGGACC

TTCTTGTCACCAAGGCATGGGAGCCCCTGTGCTTACTGTACCTGCACCTTTGATGCTTACAAACTGTCCCCGAGAGCCTGTGCTCACTGTGTTTTCATTG

GAAGGAAGCTGTCGCTTTAAGGGTCATGAGGTGCTAAAGCCAGGGGCCCAGATGGGTGGGCACTGGAAACAGGAGCTGGGCAGTGTGGTCTGTCACCTGC

TCTCAGTATCTTCAGCAGTGTGCCCGGCAGATCTTGGACAGCAAGCTTGAGTTTTATGGGTGGCAGTCACTGGCTGGCTAGGCACATAGCCAGGCCAAAC

CTAGGCCTCCAAGGGCTCCCCAAAATCTGAATTTCTGAGTAGTCTTCATCCCCTCTCCTGCTCTAAGGTCAGGTCCATCCTCTCTGGTCCTTACCTTGAT

GACAAGGATCCAGCCTTCTGGTGTTTTTGAGCATTTCAAAGGTCTGCATAGAAAGGAACAGCCACTAGGTACAAACAGGCAGGAATCTGGGCTCTCCTGA

GCCCTGACTGCTTCTCAGAACTGCTGCTTAACCACTGAGAACAGTGCTCAGCCCAGAGCTCCTGAGAGCCATGCACATCACGCTGGGGTTGGGTGTCCCT

TGCAGACTCAGCCAGGGGGGCCATATCTTCCTCCTAAGGCAGGCAGGACCAGAGCTGAGCACAGGCACAGGTGTGGGCGACTCCTTGACTAACCCAGAGC

CGCCAGCCTAGGCCTCGTGCCAGGCTGACCCAAAACAGGGCGCATGCCTAGGCCTTGTACCAGGCTGGAAGACACCTCCACACTCCCTGCTTCTCCACTG

CAGGTGTGCTGTGCTGGCCCCAGGCCCACACTGATCACCTAGATGCGGGCCTGGTAGAGATGATTTCCTCTGGATGGTCTTCCATGGTCCTCGTAGCACC

TCACCTCGTTACCTCCAAAGGCTGCTCTGCAGCCCAAGGGAGGCTGTGCCACACTGCCAGCGACCTTGAATAGCCAGACACCGCCATCCCCTGACACTGT

GCTCACAAGGCCCCTGCTCTGTTGCTGCCGTGGGTGCCACTATATTTTGTATTACACTTTGATATTACACTCTTTTTTAAAATAGACTTGCGCTCTTATA

AATGACATGTAAATAGTTCACCACTGTGCCCCCTCTGGCACACCAACAGCATTCCCCTTTTTTCTCAGTCCAGTACATTTTGTTTCTGTATATGACTGTT

TTTTGAATCCAAATCTCTCTGTAGTATTTTTTAAATAAATGTTTACAGAACTATCGACAGACTGCTTGGTCTGTGATTCATCTCTGCAAGCCCTCATGTC

CCAGCCCGTGTGTCCCGAGCATATCGTTGCCAGCTGCCCAGCTCTTGGCAGCCTCACAGCAGATGGTAGTGTCCTGTGTCGGGCCGGAAGTAGGAGCGGC

TAAGCACCTGAGATTCTTGCTGGCGGAGTGAGTCCCTCCCCGGCATGCCTCTGCCTTCAGCCGCTCAGTGCTCTCTCTCTCTCATGTGGCTTCGGGTGCC

AGCTGTTAGGCTTCAGTGGACAGTGAACAAACGCCTCGGCAGGCTCCGTGGACTATGCTTCAGTCACTGGAGCTCAGGCAAGGATGCCAAGGCCACAGGC

TGGGGTGCCCTGCCACTCCAACAACTCGCCACACAGAAGCTCTGCCTCCCCTGGCTGTCATATGTCATGCATGTTGAAGTGGGTCGGAGTTGTCCAGTGA

ATCTAGACACTGGCCATCCTGCAGGTCTTCTGTAGCCAATAGGGTCATCCTTGAGTGGCTGTCTAACAGGAGGTTCCAGGGACAGCCTCCACAGCTACCA

CTTGTGCTTTTGTGTGTGACATGGGCCTAAGAGGGCTCCCAGTGGCCTCAAGCAAGTACTGTTTGCCTGTTTTCTCGATTTCTTGTAAGGCCACAGGAGT

GAGACCTGTCACCTTGGCCCAAGCATAAAATACTCCATGTCTCCG
Translation
MSQRWTYTKCRVQRDPALPFME - UNI13304 - EALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKG - UN

I24585 - GEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYR

INTASDGK LYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLK

 - UNI3159 - EDTMEVEEFLKEAAVMKEIKHPNLVQLLG GVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNF

IHR RDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWA AFGVLLWEIATYGMSPYPGIDLSQVYELLEKD

YRMERPEGCPEKVYELMRAC CWQWNPSDRPSFAEIHQAFETMFQESSISDE EVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAEQKDAPDTPELL

HTKGLGESD - UNI5367 - DALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQPDRRGASEDD

SRELCNGPPALTSDAAEPTKSPKASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSCSASCMPHGARDTEWRSVTLPR

DLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAMPPPRLVKKNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQVTASPSSGLSHKEEATKG

SASGMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACTGKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDP

TKAGPPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAIS

RNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVRR
Transcript ENSMUST00000028190
Sequence
CGGCCTGGCGGGGCTGGGGGCCCGGGGTGGTGGGGCCTTCGCCGTGGCCACGGGACCATGTTGGAGATCTGTTTGAAGTTGGTGGGCTGCAAATCCAAGA

AGGGGCTCTCTTCGTCCTCCAGCTGCTACCTGGAAG - UNI13304 - - UNI34641 - AAGCCCTGCAGAGGCCAGTGGCATCTGACTTTGAGCC

CCAGGGTCTCAGCGAAGCAGCTCGATGGAACTCCAAGGAAAACCTTCTTGCTGGGCCCAGTGAAAATGACCCCAACCTTTTTGTGGCACTCTATGATTTT

GTGGCCAGTGGAGATAACACTCTCAGCATCACTAAAG - UNI24585 - GTGAAAAGCTCCGGGTCTTGGGTTATAATCACAATGGGGAATGGTGTGA

AGCCCAAACGAAAAATGGCCAAGGATGGGTCCCAAGCAACTACATCACCCCCGTCAACAGCCTGGAGAAACATTCCTGGTATCATGGCCCTGTATCTCGG

AATGCTGCTGAGTATCTGCTGAGCAGCGGAATCAACGGCAGCTTCTTAGTGCGGGAGAGTGAGAGTAGCCCTGGCCAGAGATCCATCTCGCTGCGGTATG

AAGGGAGGGTGTACCACTACAGGATCAACACTGCCTCTGATGGCAAG CTGTACGTGTCCTCCGAGAGCCGCTTCAACACTCTGGCTGAGTTAGTTCACC

ATCACTCCACGGTGGCTGATGGCCTCATCACCACACTCCACTACCCAGCTCCCAAGCGCAACAAGCCCACTATCTACGGTGTGTCCCCCAACTACGACAA

GTGGGAAATGGAGCGCACCGACATCACCATGAAGCACAAGTTGGGTGGAGGCCAGTACGGGGAGGTGTACGAGGGCGTTTGGAAGAAGTACAGCCTCACT

GTGGCCGTGAAGACCTTGAAG - UNI3159 - GAGGACACCATGGAGGTGGAGGAGTTCCTGAAGGAAGCGGCGGTGATGAAGGAGATCAAACACCCT

AACCTGGTGCAGCTGCTAG GGGTGTGTACCCGGGAACCACCATTCTACATAATCACTGAGTTCATGACCTATGGGAACCTGCTGGACTACCTGAGGGAG

TGTAACCGGCAGGAGGTGAGCGCCGTGGTACTGCTCTACATGGCCACACAGATCTCATCAGCCATGGAGTACTTGGAGAAGAAGAACTTCATCCACAG A

GACCTTGCTGCCCGGAACTGCCTGGTAGGGGAAAACCACTTGGTGAAGGTGGCTGATTTTGGCCTGAGCAGGTTGATGACAGGGGACACCTACACGGCCC

ATGCTGGAGCCAAATTCCCCATCAAATGGACCGCACCTGAGAGCCTGGCCTACAACAAGTTCTCCATCAAGTCGGACGTGTGGG CATTTGGAGTATTGC

TCTGGGAGATTGCTACCTATGGCATGTCACCTTACCCGGGAATTGACCTGTCTCAGGTTTATGAGCTGCTGGAAAAAGACTACCGCATGGAGCGCCCTGA

AGGCTGCCCGGAGAAGGTCTACGAGCTCATGCGAGCAT GTTGGCAGTGGAACCCCTCTGACCGGCCCTCCTTTGCTGAAATCCACCAAGCCTTTGAAAC

CATGTTCCAGGAATCCAGTATCTCAGATG AGGTGGAGAAGGAGCTGGGGAAACGAGGCACGAGAGGAGGTGCTGGGAGTATGCTGCAGGCCCCAGAGCT

GCCCACCAAGACCAGAACCTGCAGGAGAGCAGCTGAGCAGAAAGATGCGCCTGACACCCCTGAGCTGCTCCACACGAAGGGCCTGGGAGAAAGCG - UN

I5367 - ATGCACTGGACAGTGAGCCTGCTGTATCGCCACTGCTTCCTCGGAAAGAGCGCGGGCCCCCAGACGGCAGCCTAAATGAAGATGAGCGCCTT

CTCCCCAGAGACAGAAAGACCAACCTGTTCAGCGCTTTGATCAAGAAGAAGAAGAAAATGGCGCCGACGCCCCCTAAGCGCAGCAGTTCCTTCCGAGAGA

TGGATGGCCAGCCAGACCGCAGAGGGGCTAGTGAGGATGACAGCAGGGAACTCTGCAATGGACCACCAGCTCTCACCTCAGACGCAGCAGAGCCTACCAA

GTCCCCAAAGGCCAGCAATGGGGCTGGCGTCCCTAATGGAGCCTTCCGGGAGCCGGGCAACTCAGGCTTCCGTTCTCCCCACATGTGGAAAAAGTCCAGC

ACACTGACCGGGAGCCGCCTGGCTGCTGCCGAAGAGGAGAGCGGCATGAGCTCCAGTAAGCGCTTCCTGCGTTCTTGTTCGGCCTCCTGCATGCCCCATG

GGGCAAGGGACACAGAGTGGCGGTCGGTCACGCTGCCTCGAGACCTGCCGTCTGCTGGCAAGCAGTTTGACTCATCCACCTTTGGAGGGCACAAAAGCGA

AAAGCCAGCTCTGCCTCGGAAACGCACCAGTGAGAGCAGGTCTGAGCAGGTGGCCAAAAGCACGGCGATGCCCCCTCCCCGGCTGGTGAAGAAGAACGAG

GAGGCTGCTGAAGAAGGCTTCAAAGACACAGAATCCAGCCCTGGCTCCAGCCCTCCCAGCTTGACTCCCAAACTCCTCCGCAGGCAGGTCACTGCCTCTC

CTTCCTCTGGCCTCTCTCACAAGGAAGAGGCCACCAAGGGCAGTGCCTCAGGCATGGGGACTCCGGCCACTGCAGAGCCAGCACCCCCCAGCAACAAAGT

GGGCCTCAGCAAGGCCTCCTCTGAGGAGATGCGCGTAAGGAGGCACAAGCACAGCTCGGAGTCCCCAGGGAGAGACAAGGGGCGACTGGCTAAGCTCAAG

CCTGCCCCGCCGCCTCCTCCTGCCTGCACAGGAAAAGCAGGCAAGCCCGCACAGAGCCCCAGCCAAGAGGCCGGGGAGGCAGGGGGGCCCACAAAGACAA

AATGCACGAGTCTGGCTATGGATGCTGTGAACACTGACCCCACCAAGGCCGGCCCACCTGGAGAAGGACTGAGAAAGCCTGTGCCCCCATCTGTGCCAAA

GCCCCAGTCGACGGCTAAGCCTCCAGGGACTCCCACCAGCCCGGTCTCCACCCCCTCCACAGCACCAGCTCCTTCACCCCTGGCTGGGGACCAGCAGCCA

TCTTCTGCCGCCTTCATCCCCCTCATATCAACCCGTGTGTCTCTTAGGAAGACCCGCCAGCCGCCAGAGCGCATTGCCAGTGGCACCATCACCAAGGGTG

TGGTTCTGGACAGTACTGAGGCCCTGTGCCTTGCCATCTCCCGGAACTCAGAGCAGATGGCCAGCCACAGTGCTGTACTGGAGGCTGGCAAGAACCTGTA

CACTTTCTGTGTGAGCTATGTGGACTCTATCCAGCAGATGAGGAACAAGTTTGCCTTCCGTGAGGCTATCAACAAGCTGGAGAGCAACCTCCGAGAGCTG

CAGATCTGCCCTGCCACAGCCTCCAGTGGGCCAGCTGCCACCCAAGACTTCAGCAAGCTGCTCAGCTCTGTGAAGGAGATCAGCGACATTGTCCGGAGGT

AGCAGCAACCAGTGTATGTCAGCAAGAGATGTTGCAGTTCACAGGGCTCTTGTGCCTATAAAGATGGGGACAGGGGACTGGGGAGCTGGCGTCTTTCCCC

AGGAGCTTTAAAGAGAGACAAGCAGAGCCTGAGGGAGACCTGGATGGAGCCTGGTGGAGTTGGCTCTTCCTCCTGTGTTGTGCACCAGCTGCCCTGCACC

TTTCCTGTCCAGCCCAGGCGTCAGCCACCTCTCCTCACTGCCTGTGGATGGGTCTCCTGCTCTGAAGACTACATCTGGCCTGCCTGGCCACCAGGCTTCT

CACTCCCCGGTGCCTCAGACCCAGCTCCCAGGTCAGCCTGGAGTGCTCTTCCCTGTCCTTGCAGAACGACCTCCTCTGATGGACCTTCTTGTCACCAAGG

CATGGGAGCCCCTGTGCTTACTGTACCTGCACCTTTGATGCTTACAAACTGTCCCCGAGAGCCTGTGCTCACTGTGTTTTCATTGGAAGGAAGCTGTCGC

TTTAAGGGTCATGAGGTGCTAAAGCCAGGGGCCCAGATGGGTGGGCACTGGAAACAGGAGCTGGGCAGTGTGGTCTGTCACCTGCTCTCAGTATCTTCAG

CAGTGTGCCCGGCAGATCTTGGACAGCAAGCTTGAGTTTTATGGGTGGCAGTCACTGGCTGGCTAGGCACATAGCCAGGCCAAACCTAGGCCTCCAAGGG

CTCCCCAAAATCTGAATTTCTGAGTAGTCTTCATCCCCTCTCCTGCTCTAAGGTCAGGTCCATCCTCTCTGGTCCTTACCTTGATGACAAGGATCCAGCC

TTCTGGTGTTTTTGAGCATTTCAAAGGTCTGCATAGAAAGGAACAGCCACTAGGTACAAACAGGCAGGAATCTGGGCTCTCCTGAGCCCTGACTGCTTCT

CAGAACTGCTGCTTAACCACTGAGAACAGTGCTCAGCCCAGAGCTCCTGAGAGCCATGCACATCACGCTGGGGTTGGGTGTCCCTTGCAGACTCAGCCAG

GGGGGCCATATCTTCCTCCTAAGGCAGGCAGGACCAGAGCTGAGCACAGGCACAGGTGTGGGCGACTCCTTGACTAACCCAGAGCCGCCAGCCTAGGCCT

CGTGCCAGGCTGACCCAAAACAGGGCGCATGCCTAGGCCTTGTACCAGGCTGGAAGACACCTCCACACTCCCTGCTTCTCCACTGCAGGTGTGCTGTGCT

GGCCCCAGGCCCACACTGATCACCTAGATGCGGGCCTGGTAGAGATGATTTCCTCTGGATGGTCTTCCATGGTCCTCGTAGCACCTCACCTCGTTACCTC

CAAAGGCTGCTCTGCAGCCCAAGGGAGGCTGTGCCACACTGCCAGCGACCTTGAATAGCCAGACACCGCCATCCCCTGACACTGTGCTCACAAGGCCCCT

GCTCTGTTGCTGCCGTGGGTGCCACTATATTTTGTATTACACTTTGATATTACACTCTTTTTTAAAATAGACTTGCGCTCTTATAAATGACATGTAAATA

GTTCACCACTGTGCCCCCTCTGGCACACCAACAGCATTCCCCTTTTTTCTCAGTCCAGTACATTTTGTTTCTGTATATGACTGTTTTTTGAATCCAAATC

TCTCTGTAGTATTTTTTAAATAAATGTTTACAGAACTATCGACAGACTGCTTGGTCTGTGATTCATCTCTGCAAGCCCTCATGTCCCAGCCCGTGTGTCC

CGAGCATATCGTTGCCAGCTGCCCAGCTCTTGGCAGCCTCACAGCAGATGGTAGTGTCCTGTGTCGGGCCGGAAGTAGGAGCGGCTAAGCACCTGAGATT

CTTGCTGGCGGAGTGAGTCCCTCCCCGGCATGCCTCTGCCTTCAGCCGCTCAGTGCTCTCTCTCTCTCATGTGGCTTCGGGTGCCAGCTGTTAGGCTTCA

GTGGACAGTGAACAAACGCCTCGGCAGGCTCCGTGGACTATGCTTCAGTCACTGGAGCTCAGGCAAGGATGCCAAGGCCACAGGCTGGGGTGCCCTGCCA

CTCCAACAACTCGCCACACAGAAGCTCTGCCTCCCCTGGCTGTCATATGTCATGCATGTTGAAGTGGGTCGGAGTTGTCCAGTGAATCTAGACACTGGCC

ATCCTGCAGGTCTTCTGTAGCCAATAGGGTCATCCTTGAGTGGCTGTCTAACAGGAGGTTCCAGGGACAGCCTCCACAGCTACCACTTGTGCTTTTGTGT

GTGACATGGGCCTAAGAGGGCTCCCAGTGGCCTCAAGCAAGTACTGTTTGCCTGTTTTCTCGATTTCTTGTAAGGCCACAGGAGTGAGACCTGTCACCTT

GGCCCAAGCATAAAATACTCCATGTCTCCG
Translation
MLEICLKLVGCKSKKGLSSSSSCYLEE - UNI13304 - - UNI34641 - EALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDF

VASGDNTLSITKG - UNI24585 - GEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESS

PGQRSISLRYEGRVYHYRINTASDGK LYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEV

YEGVWKKYSLTVAVKTLK - UNI3159 - EDTMEVEEFLKEAAVMKEIKHPNLVQLLG GVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLL

YMATQISSAMEYLEKKNFIHR RDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWA AFGVLLWEIATYGM

SPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRAC CWQWNPSDRPSFAEIHQAFETMFQESSISDE EVEKELGKRGTRGGAGSMLQAPELPTKTR

TCRRAAEQKDAPDTPELLHTKGLGESD - UNI5367 - DALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLFSALIKKKKKMAPTPPKRSS

SFREMDGQPDRRGASEDDSRELCNGPPALTSDAAEPTKSPKASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSCSAS

CMPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAMPPPRLVKKNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQ

VTASPSSGLSHKEEATKGSASGMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACTGKAGKPAQSPSQEAGEAGG

PTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGT

ITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISD

IVRR
Transcript ENSMUST00000113455
Sequence
ATGATATCTTTTGACCTTCTCAGTGATGAGCTGCACTTGAAACTTCTCGTTTTGGATGTAG - UNI13304 - - UNI30094 - - UNI34641 -

 AAGCCCTGCAGAGGCCAGTGGCATCTGACTTTGAGCCCCAGGGTCTCAGCGAAGCAGCTCGATGGAACTCCAAGGAAAACCTTCTTGCTGGGCCCAGTG

AAAATGACCCCAACCTTTTTGTGGCACTCTATGATTTTGTGGCCAGTGGAGATAACACTCTCAGCATCACTAAAG - UNI24585 - GTGAAAAGCTC

CGGGTCTTGGGTTATAATCACAATGGGGAATGGTGTGAAGCCCAAACGAAAAATGGCCAAGGATGGGTCCCAAGCAACTACATCACCCCCGTCAACAGCC

TGGAGAAACATTCCTGGTATCATGGCCCTGTATCTCGGAATGCTGCTGAGTATCTGCTGAGCAGCGGAATCAACGGCAGCTTCTTAGTGCGGGAGAGTGA

GAGTAGCCCTGGCCAGAGATCCATCTCGCTGCGGTATGAAGGGAGGGTGTACCACTACAGGATCAACACTGCCTCTGATGGCAAG CTGTACGTGTCCTC

CGAGAGCCGCTTCAACACTCTGGCTGAGTTAGTTCACCATCACTCCACGGTGGCTGATGGCCTCATCACCACACTCCACTACCCAGCTCCCAAGCGCAAC

AAGCCCACTATCTACGGTGTGTCCCCCAACTACGACAAGTGGGAAATGGAGCGCACCGACATCACCATGAAGCACAAGTTGGGTGGAGGCCAGTACGGGG

AGGTGTACGAGGGCGTTTGGAAGAAGTACAGCCTCACTGTGGCCGTGAAGACCTTGAAG - UNI3159 - GAGGACACCATGGAGGTGGAGGAGTTCC

TGAAGGAAGCGGCGGTGATGAAGGAGATCAAACACCCTAACCTGGTGCAGCTGCTAG GGGTGTGTACCCGGGAACCACCATTCTACATAATCACTGAGT

TCATGACCTATGGGAACCTGCTGGACTACCTGAGGGAGTGTAACCGGCAGGAGGTGAGCGCCGTGGTACTGCTCTACATGGCCACACAGATCTCATCAGC

CATGGAGTACTTGGAGAAGAAGAACTTCATCCACAG AGACCTTGCTGCCCGGAACTGCCTGGTAGGGGAAAACCACTTGGTGAAGGTGGCTGATTTTGG

CCTGAGCAGGTTGATGACAGGGGACACCTACACGGCCCATGCTGGAGCCAAATTCCCCATCAAATGGACCGCACCTGAGAGCCTGGCCTACAACAAGTTC

TCCATCAAGTCGGACGTGTGGG CATTTGGAGTATTGCTCTGGGAGATTGCTACCTATGGCATGTCACCTTACCCGGGAATTGACCTGTCTCAGGTTTAT

GAGCTGCTGGAAAAAGACTACCGCATGGAGCGCCCTGAAGGCTGCCCGGAGAAGGTCTACGAGCTCATGCGAGCAT GTTGGCAGTGGAACCCCTCTGAC

CGGCCCTCCTTTGCTGAAATCCACCAAGCCTTTGAAACCATGTTCCAGGAATCCAGTATCTCAGATG AGGTGGAGAAGGAGCTGGGGAAACGAGGCACG

AGAGGAGGTGCTGGGAGTATGCTGCAGGCCCCAGAGCTGCCCACCAAGACCAGAACCTGCAGGAGAGCAGCTGAGCAGAAAGATGCGCCTGACACCCCTG

AGCTGCTCCACACGAAGGGCCTGGGAGAAAGCG - UNI5367 - ATGCACTGGACAGTGAGCCTGCTGTATCGCCACTGCTTCCTCGGAAAGAGCGCG

GGCCCCCAGACGGCAGCCTAAATGAAGATGAGCGCCTTCTCCCCAGAGACAGAAAGACCAACCTGTTCAGCGCTTTGATCAAGAAGAAGAAGAAAATGGC

GCCGACGCCCCCTAAGCGCAGCAGTTCCTTCCGAGAGATGGATGGCCAGCCAGACCGCAGAGGGGCTAGTGAGGATGACAGCAGGGAACTCTGCAATGGA

CCACCAGCTCTCACCTCAGACGCAGCAGAGCCTACCAAGTCCCCAAAGGCCAGCAATGGGGCTGGCGTCCCTAATGGAGCCTTCCGGGAGCCGGGCAACT

CAGGCTTCCGTTCTCCCCACATGTGGAAAAAGTCCAGCACACTGACCGGGAGCCGCCTGGCTGCTGCCGAAGAGGAGAGCGGCATGAGCTCCAGTAAGCG

CTTCCTGCGTTCTTGTTCGGCCTCCTGCATGCCCCATGGGGCAAGGGACACAGAGTGGCGGTCGGTCACGCTGCCTCGAGACCTGCCGTCTGCTGGCAAG

CAGTTTGACTCATCCACCTTTGGAGGGCACAAAAGCGAAAAGCCAGCTCTGCCTCGGAAACGCACCAGTGAGAGCAGGTCTGAGCAGGTGGCCAAAAGCA

CGGCGATGCCCCCTCCCCGGCTGGTGAAGAAGAACGAGGAGGCTGCTGAAGAAGGCTTCAAAGACACAGAATCCAGCCCTGGCTCCAGCCCTCCCAGCTT

GACTCCCAAACTCCTCCGCAGGCAGGTCACTGCCTCTCCTTCCTCTGGCCTCTCTCACAAGGAAGAGGCCACCAAGGGCAGTGCCTCAGGCATGGGGACT

CCGGCCACTGCAGAGCCAGCACCCCCCAGCAACAAAGTGGGCCTCAGCAAGGCCTCCTCTGAGGAGATGCGCGTAAGGAGGCACAAGCACAGCTCGGAGT

CCCCAGGGAGAGACAAGGGGCGACTGGCTAAGCTCAAGCCTGCCCCGCCGCCTCCTCCTGCCTGCACAGGAAAAGCAGGCAAGCCCGCACAGAGCCCCAG

CCAAGAGGCCGGGGAGGCAGGGGGGCCCACAAAGACAAAATGCACGAGTCTGGCTATGGATGCTGTGAACACTGACCCCACCAAGGCCGGCCCACCTGGA

GAAGGACTGAGAAAGCCTGTGCCCCCATCTGTGCCAAAGCCCCAGTCGACGGCTAAGCCTCCAGGGACTCCCACCAGCCCGGTCTCCACCCCCTCCACAG

CACCAGCTCCTTCACCCCTGGCTGGGGACCAGCAGCCATCTTCTGCCGCCTTCATCCCCCTCATATCAACCCGTGTGTCTCTTAGGAAGACCCGCCAGCC

GCCAGAGCGCATTGCCAGTGGCACCATCACCAAGGGTGTGGTTCTGGACAGTACTGAGGCCCTGTGCCTTGCCATCTCCCGGAACTCAGAGCAGATGGCC

AGCCACAGTGCTGTACTGGAGGCTGGCAAGAACCTGTACACTTTCTGTGTGAGCTATGTGGACTCTATCCAGCAGATGAGGAACAAGTTTGCCTTCCGTG

AGGCTATCAACAAGCTGGAGAGCAACCTCCGAGAGCTGCAGATCTGCCCTGCCACAGCCTCCAGTGGGCCAGCTGCCACCCAAGACTTCAGCAAGCTGCT

CAGCTCTGTGAAGGAGATCAGCGACATTGTCCGGAGGTAGCAGCAACCAGTGTATGTCAGCAAGAGATGTTGCAGTTCACAGGGCTCTTGTGCCTATAAA

GATGGGGACAGGGGACTGGGGAGCTGGCGTCTTTCCCCAGGAGCTTTAAAGAGAGACAAGCAGAGCCTGAGGGAGACCTGGATGGAGCCTGGTGGAGTTG

GCTCTTCCTCCTGTGTTGTGCACCAGCTGCCCTGCACCTTTCCTGTCCAGCCCAGGCGTCAGCCACCTCTCCTCACTGCCTGTGGATGGGTCTCCTGCTC

TGAAGACTACATCTGGCCTGCCTGGCCACCAGGCTTCTCACTCCCCGGTGCCTCAGACCCAGCTCCCAGGTCAGCCTGGAGTGCTCTTCCCTGTCCTTGC

AGAACGACCTCCTCTGATGGACCTTCTTGTCACCAAGGCATGGGAGCCCCTGTGCTTACTGTACCTGCACCTTTGATGCTTACAAACTGTCCCCGAGAGC

CTGTGCTCACTGTGTTTTCATTGGAAGGAAGCTGTCGCTTTAAGGGTCATGAGGTGCTAAAGCCAGGGGCCCAGATGGGTGGGCACTGGAAACAGGAGCT

GGGCAGTGTGGTCTGTCACCTGCTCTCAGTATCTTCAGCAGTGTGCCCGGCAGATCTTGGACAGCAAGCTTGAGTTTTATGGGTGGCAGTCACTGGCTGG

CTAGGCACATAGCCAGGCCAAACCTAGGCCTCCAAGGGCTCCCCAAAATCTGAATTTCTGAGTAGTCTTCATCCCCTCTCCTGCTCTAAGGTCAGGTCCA

TCCTCTCTGGTCCTTACCTTGATGACAAGGATCCAGCCTTCTGGTGTTTTTGAGCATTTCAAAGGTCTGCATAGAAAGGAACAGCCACTAGGTACAAACA

GGCAGGAATCTGGGCTCTCCTGAGCCCTGACTGCTTCTCAGAACTGCTGCTTAACCACTGAGAACAGTGCTCAGCCCAGAGCTCCTGAGAGCCATGCACA

TCACGCTGGGGTTGGGTGTCCCTTGCAGACTCAGCCAGGGGGGCCATATCTTCCTCCTAAGGCAGGCAGGACCAGAGCTGAGCACAGGCACAGGTGTGGG

CGACTCCTTGACTAACCCAGAGCCGCCAGCCTAGGCCTCGTGCCAGGCTGACCCAAAACAGGGCGCATGCCTAGGCCTTGTACCAGGCTGGAAGACACCT

CCACACTCCCTGCTTCTCCACTGCAGGTGTGCTGTGCTGGCCCCAGGCCCACACTGATCACCTAGATGCGGGCCTGGTAGAGATGATTTCCTCTGGATGG

TCTTCCATGGTCCTCGTAGCACCTCACCTCGTTACCTCCAAAGGCTGCTCTGCAGCCCAAGGGAGGCTGTGCCACACTGCCAGCGACCTTGAATAGCCAG

ACACCGCCATCCCCTGACACTGTGCTCACAAGGCCCCTGCTCTGTTGCTGCCGTGGGTGCCACTATATTTTGTATTACACTTTGATATTACACTCTTTTT

TAAAATAGACTTGCGCTCTTATAAATGACATGTAAATAGTTCACCACTGTGCCCCCTCTGGCACACCAACAGCATTCCCCTTTTTTCTCAGTCCAGTACA

TTTTGTTTCTGTATATGACTGTTTTTTGAATCCAAATCTCTCTGTAGTATTTTTTAAATAAATGTTTACAGAACTATCGACAGACTGCTTGGTCTGTGAT

TCATCTCTGCAAGCCCTCATGTCCCAGCCCGTGTGTCCCGAGCATATCGTTGCCAGCTGCCCAGCTCTTGGCAGCCTCACAGCAGATGGTAGTGTCCTGT

GTCGGGCCGGAAGTAGGAGCGGCTAAGCACCTGAGATTCTTGCTGGCGGAGTGAGTCCCTCCCCGGCATGCCTCTGCCTTCAGCCGCTCAGTGCTCTCTC

TCTCTCATGTGGCTTCGGGTGCCAGCTGTTAGGCTTCAGTGGACAGTGAACAAACGCCTCGGCAGGCTCCGTGGACTATGCTTCAGTCACTGGAGCTCAG

GCAAGGATGCCAAGGCCACAGGCTGGGGTGCCCTGCCACTCCAACAACTCGCCACACAGAAGCTCTGCCTCCCCTGGCTGTCATATGTCATGCATGTTGA

AGTGGGTCGGAGTTGTCCAGTGAATCTAGACACTGGCCATCCTGCAGGTCTTCTGTAGCCAATAGGGTCATCCTTGAGTGGCTGTCTAACAGGAGGTTCC

AGGGACAGCCTCCACAGCTACCACTTGTGCTTTTGTGTGTGACATGGGCCTAAGAGGGCTCCCAGTGGCCTCAAGCAAGTACTGTTTGCCTGTTTTCTCG

ATTTCTTGTAAGGCCACAGGAGTGAGACCTGTCACCTTGGCCCAAGCATAAAATACTCCATGTCTCCG
Translation
MISFDLLSDELHLKLLVLDVE - UNI13304 - - UNI30094 - - UNI34641 - EALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNL

FVALYDFVASGDNTLSITKG - UNI24585 - GEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFL

VRESESSPGQRSISLRYEGRVYHYRINTASDGK LYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLG

GGQYGEVYEGVWKKYSLTVAVKTLK - UNI3159 - EDTMEVEEFLKEAAVMKEIKHPNLVQLLG GVCTREPPFYIITEFMTYGNLLDYLRECNRQE

VSAVVLLYMATQISSAMEYLEKKNFIHR RDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWA AFGVLLW

EIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRAC CWQWNPSDRPSFAEIHQAFETMFQESSISDE EVEKELGKRGTRGGAGSMLQAP

ELPTKTRTCRRAAEQKDAPDTPELLHTKGLGESD - UNI5367 - DALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLFSALIKKKKKMAP

TPPKRSSSFREMDGQPDRRGASEDDSRELCNGPPALTSDAAEPTKSPKASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRF

LRSCSASCMPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAMPPPRLVKKNEEAAEEGFKDTESSPGSSPPSLT

PKLLRRQVTASPSSGLSHKEEATKGSASGMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACTGKAGKPAQSPSQ

EAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPP

ERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLS

SVKEISDIVRR
Transcript ENSMUST00000075759
Sequence
GAAGTGAGAGCGGCAGGAAATTTGTTACAAGATGGAGAGACAGAGATAGGGGATTGGTTGACTTCCACAGAAAAGATTGCAGAGAATATAAAAGCAGCTC

AGCCTTTGCTTCTCGCTGGGGAGTTGAAATGACTTTCAGTGCCGTTGGCCCTTTTCTGACTTTTCTGTGAATAGTTTTATCTAAAGTTCCCCTCTTGCAA

AGAAAGTGTTCCTCAGCTCGCAACGTAGACTTAGATTGAAGAAACTTTTGGCATTGCGGTTACATGACTTCAAACTAATTACCCTGGAAAAGAATTCCAG

GCTCCTGTTTACATGTGTGAACCTCAAACCCAGCTTCCCTTTGTCATGGAAGTTGTCTGTCTGTGATTGACCCAAGTTACTGACCCAAGACGGTGGTGTG

AAGTTCTGGGTATATACTGTTGCCTGCTAACCCCCACGGACCATTCTGAAAAGTCTTGAACCCTCTTCTGGAAAGGGGCACCTATTATTGCTTTATGGGG

CAGCAGCCTGGAAAAGTTCTTGGGGACCAAAGAAGGCCTAGTTTGCCCGCCCTGCATTTTATCAAAGGGGCAGGGAAGAGGGACTCATCGAGGCATGGGG

GCCCACACTGCAATGTCTTTGTGGAACACG - UNI13304 - - UNI30094 - - UNI34641 - AAGCCCTGCAGAGGCCAGTGGCATCTGACT

TTGAGCCCCAGGGTCTCAGCGAAGCAGCTCGATGGAACTCCAAGGAAAACCTTCTTGCTGGGCCCAGTGAAAATGACCCCAACCTTTTTGTGGCACTCTA

TGATTTTGTGGCCAGTGGAGATAACACTCTCAGCATCACTAAAG - UNI24585 - GTGAAAAGCTCCGGGTCTTGGGTTATAATCACAATGGGGAAT

GGTGTGAAGCCCAAACGAAAAATGGCCAAGGATGGGTCCCAAGCAACTACATCACCCCCGTCAACAGCCTGGAGAAACATTCCTGGTATCATGGCCCTGT

ATCTCGGAATGCTGCTGAGTATCTGCTGAGCAGCGGAATCAACGGCAGCTTCTTAGTGCGGGAGAGTGAGAGTAGCCCTGGCCAGAGATCCATCTCGCTG

CGGTATGAAGGGAGGGTGTACCACTACAGGATCAACACTGCCTCTGATGGCAAG CTGTACGTGTCCTCCGAGAGCCGCTTCAACACTCTGGCTGAGTTA

GTTCACCATCACTCCACGGTGGCTGATGGCCTCATCACCACACTCCACTACCCAGCTCCCAAGCGCAACAAGCCCACTATCTACGGTGTGTCCCCCAACT

ACGACAAGTGGGAAATGGAGCGCACCGACATCACCATGAAGCACAAGTTGGGTGGAGGCCAGTACGGGGAGGTGTACGAGGGCGTTTGGAAGAAGTACAG

CCTCACTGTGGCCGTGAAGACCTTGAAG - UNI3159 - GAGGACACCATGGAGGTGGAGGAGTTCCTGAAGGAAGCGGCGGTGATGAAGGAGATCAA

ACACCCTAACCTGGTGCAGCTGCTAG GGGTGTGTACCCGGGAACCACCATTCTACATAATCACTGAGTTCATGACCTATGGGAACCTGCTGGACTACCT

GAGGGAGTGTAACCGGCAGGAGGTGAGCGCCGTGGTACTGCTCTACATGGCCACACAGATCTCATCAGCCATGGAGTACTTGGAGAAGAAGAACTTCATC

CACAG AGACCTTGCTGCCCGGAACTGCCTGGTAGGGGAAAACCACTTGGTGAAGGTGGCTGATTTTGGCCTGAGCAGGTTGATGACAGGGGACACCTAC

ACGGCCCATGCTGGAGCCAAATTCCCCATCAAATGGACCGCACCTGAGAGCCTGGCCTACAACAAGTTCTCCATCAAGTCGGACGTGTGGG CATTTGGA

GTATTGCTCTGGGAGATTGCTACCTATGGCATGTCACCTTACCCGGGAATTGACCTGTCTCAGGTTTATGAGCTGCTGGAAAAAGACTACCGCATGGAGC

GCCCTGAAGGCTGCCCGGAGAAGGTCTACGAGCTCATGCGAGCAT GTTGGCAGTGGAACCCCTCTGACCGGCCCTCCTTTGCTGAAATCCACCAAGCCT

TTGAAACCATGTTCCAGGAATCCAGTATCTCAGATG AGGTGGAGAAGGAGCTGGGGAAACGAGGCACGAGAGGAGGTGCTGGGAGTATGCTGCAGGCCC

CAGAGCTGCCCACCAAGACCAGAACCTGCAGGAGAGCAGCTGAGCAGAAAGATGCGCCTGACACCCCTGAGCTGCTCCACACGAAGGGCCTGGGAGAAAG

CG - UNI5367 - ATGCACTGGACAGTGAGCCTGCTGTATCGCCACTGCTTCCTCGGAAAGAGCGCGGGCCCCCAGACGGCAGCCTAAATGAAGATGA

GCGCCTTCTCCCCAGAGACAGAAAGACCAACCTGTTCAGCGCTTTGATCAAGAAGAAGAAGAAAATGGCGCCGACGCCCCCTAAGCGCAGCAGTTCCTTC

CGAGAGATGGATGGCCAGCCAGACCGCAGAGGGGCTAGTGAGGATGACAGCAGGGAACTCTGCAATGGACCACCAGCTCTCACCTCAGACGCAGCAGAGC

CTACCAAGTCCCCAAAGGCCAGCAATGGGGCTGGCGTCCCTAATGGAGCCTTCCGGGAGCCGGGCAACTCAGGCTTCCGTTCTCCCCACATGTGGAAAAA

GTCCAGCACACTGACCGGGAGCCGCCTGGCTGCTGCCGAAGAGGAGAGCGGCATGAGCTCCAGTAAGCGCTTCCTGCGTTCTTGTTCGGCCTCCTGCATG

CCCCATGGGGCAAGGGACACAGAGTGGCGGTCGGTCACGCTGCCTCGAGACCTGCCGTCTGCTGGCAAGCAGTTTGACTCATCCACCTTTGGAGGGCACA

AAAGCGAAAAGCCAGCTCTGCCTCGGAAACGCACCAGTGAGAGCAGGTCTGAGCAGGTGGCCAAAAGCACGGCGATGCCCCCTCCCCGGCTGGTGAAGAA

GAACGAGGAGGCTGCTGAAGAAGGCTTCAAAGACACAGAATCCAGCCCTGGCTCCAGCCCTCCCAGCTTGACTCCCAAACTCCTCCGCAGGCAGGTCACT

GCCTCTCCTTCCTCTGGCCTCTCTCACAAGGAAGAGGCCACCAAGGGCAGTGCCTCAGGCATGGGGACTCCGGCCACTGCAGAGCCAGCACCCCCCAGCA

ACAAAGTGGGCCTCAGCAAGGCCTCCTCTGAGGAGATGCGCGTAAGGAGGCACAAGCACAGCTCGGAGTCCCCAGGGAGAGACAAGGGGCGACTGGCTAA

GCTCAAGCCTGCCCCGCCGCCTCCTCCTGCCTGCACAGGAAAAGCAGGCAAGCCCGCACAGAGCCCCAGCCAAGAGGCCGGGGAGGCAGGGGGGCCCACA

AAGACAAAATGCACGAGTCTGGCTATGGATGCTGTGAACACTGACCCCACCAAGGCCGGCCCACCTGGAGAAGGACTGAGAAAGCCTGTGCCCCCATCTG

TGCCAAAGCCCCAGTCGACGGCTAAGCCTCCAGGGACTCCCACCAGCCCGGTCTCCACCCCCTCCACAGCACCAGCTCCTTCACCCCTGGCTGGGGACCA

GCAGCCATCTTCTGCCGCCTTCATCCCCCTCATATCAACCCGTGTGTCTCTTAGGAAGACCCGCCAGCCGCCAGAGCGCATTGCCAGTGGCACCATCACC

AAGGGTGTGGTTCTGGACAGTACTGAGGCCCTGTGCCTTGCCATCTCCCGGAACTCAGAGCAGATGGCCAGCCACAGTGCTGTACTGGAGGCTGGCAAGA

ACCTGTACACTTTCTGTGTGAGCTATGTGGACTCTATCCAGCAGATGAGGAACAAGTTTGCCTTCCGTGAGGCTATCAACAAGCTGGAGAGCAACCTCCG

AGAGCTGCAGATCTGCCCTGCCACAGCCTCCAGTGGGCCAGCTGCCACCCAAGACTTCAGCAAGCTGCTCAGCTCTGTGAAGGAGATCAGCGACATTGTC

CGGAGGTAGCAGCAACCAGTGTATGTCAGCAAGAGATGTTGCAGTTCACAGGGCTCTTGTGCCTATAAAGATGGGGACAGGGGACTGGGGAGCTGGCGTC

TTTCCCCAGGAGCTTTAAAGAGAGACAAGCAGAGCCTGAGGGAGACCTGGATGGAGCCTGGTGGAGTTGGCTCTTCCTCCTGTGTTGTGCACCAGCTGCC

CTGCACCTTTCCTGTCCAGCCCAGGCGTCAGCCACCTCTCCTCACTGCCTGTGGATGGGTCTCCTGCTCTGAAGACTACATCTGGCCTGCCTGGCCACCA

GGCTTCTCACTCCCCGGTGCCTCAGACCCAGCTCCCAGGTCAGCCTGGAGTGCTCTTCCCTGTCCTTGCAGAACGACCTCCTCTGATGGACCTTCTTGTC

ACCAAGGCATGGGAGCCCCTGTGCTTACTGTACCTGCACCTTTGATGCTTACAAACTGTCCCCGAGAGCCTGTGCTCACTGTGTTTTCATTGGAAGGAAG

CTGTCGCTTTAAGGGTCATGAGGTGCTAAAGCCAGGGGCCCAGATGGGTGGGCACTGGAAACAGGAGCTGGGCAGTGTGGTCTGTCACCTGCTCTCAGTA

TCTTCAGCAGTGTGCCCGGCAGATCTTGGACAGCAAGCTTGAGTTTTATGGGTGGCAGTCACTGGCTGGCTAGGCACATAGCCAGGCCAAACCTAGGCCT

CCAAGGGCTCCCCAAAATCTGAATTTCTGAGTAGTCTTCATCCCCTCTCCTGCTCTAAGGTCAGGTCCATCCTCTCTGGTCCTTACCTTGATGACAAGGA

TCCAGCCTTCTGGTGTTTTTGAGCATTTCAAAGGTCTGCATAGAAAGGAACAGCCACTAGGTACAAACAGGCAGGAATCTGGGCTCTCCTGAGCCCTGAC

TGCTTCTCAGAACTGCTGCTTAACCACTGAGAACAGTGCTCAGCCCAGAGCTCCTGAGAGCCATGCACATCACGCTGGGGTTGGGTGTCCCTTGCAGACT

CAGCCAGGGGGGCCATATCTTCCTCCTAAGGCAGGCAGGACCAGAGCTGAGCACAGGCACAGGTGTGGGCGACTCCTTGACTAACCCAGAGCCGCCAGCC

TAGGCCTCGTGCCAGGCTGACCCAAAACAGGGCGCATGCCTAGGCCTTGTACCAGGCTGGAAGACACCTCCACACTCCCTGCTTCTCCACTGCAGGTGTG

CTGTGCTGGCCCCAGGCCCACACTGATCACCTAGATGCGGGCCTGGTAGAGATGATTTCCTCTGGATGGTCTTCCATGGTCCTCGTAGCACCTCACCTCG

TTACCTCCAAAGGCTGCTCTGCAGCCCAAGGGAGGCTGTGCCACACTGCCAGCGACCTTGAATAGCCAGACACCGCCATCCCCTGACACTGTGCTCACAA

GGCCCCTGCTCTGTTGCTGCCGTGGGTGCCACTATATTTTGTATTACACTTTGATATTACACTCTTTTTTAAAATAGACTTGCGCTCTTATAAATGACAT

GTAAATAGTTCACCACTGTGCCCCCTCTGGCACACCAACAGCATTCCCCTTTTTTCTCAGTCCAGTACATTTTGTTTCTGTATATGACTGTTTTTTGAAT

CCAAATCTCTCTGTAGTATTTTTTAAATAAATGTTTACAGAACT
Translation
MGQQPGKVLGDQRRPSLPALHFIKGAGKRDSSRHGGPHCNVFVEHE - UNI13304 - - UNI30094 - - UNI34641 - EALQRPVASDFEPQ

GLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKG - UNI24585 - GEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKH

SWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGK LYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPT

IYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLK - UNI3159 - EDTMEVEEFLKEAAVMKEIKHPNLVQLLG GVCTREP

PFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHR RDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTA

PESLAYNKFSIKSDVWA AFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRAC CWQWNPSDRPSFAEIHQAFETMFQESSIS

DE EVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAEQKDAPDTPELLHTKGLGESD - UNI5367 - DALDSEPAVSPLLPRKERGPPDGSLNED

ERLLPRDRKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQPDRRGASEDDSRELCNGPPALTSDAAEPTKSPKASNGAGVPNGAFREPGNSGFRSPHMWK

KSSTLTGSRLAAAEEESGMSSSKRFLRSCSASCMPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAMPPPRLVK

KNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQVTASPSSGLSHKEEATKGSASGMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLA

KLKPAPPPPPACTGKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPSTAPAPSPLAGD

QQPSSAAFIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNL

RELQICPATASSGPAATQDFSKLLSSVKEISDIVRR

For any suggestions or comments, please send an email to unitrap@crg.es