Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026879 (Gsn)
Chromosomal location
Chr 2: 35111950 - 35163417 (+)
Description
gelsolin Gene [Source:MGI (curated);Acc:Gsn-001]
RefSeq_dna
NM_146120 
RefSeq_peptide
NP_666232.2 
UniGene
Mm.21109 Mm.469442 Mm.470521 
MGI
MGI:95851 
Uniprot/SWISSPROT
P13020 
Uniprot/SPTREMBL
A6PWS5 Q3TGJ9 Q3U9Q8 Q3UCW8 Q6PAC1 A2AL35 
Human Ortholog
ENSG00000148180 (GSN)
Omim 105120 - AMYLOIDOSIS, FINNISH TYPE  
UniTrap UNI27378
Vector Insertion
Chr 2: 35111994 - 35122339
Public Clones not available
Private Clones OST61262 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113016
Sequence
GGACTGAGCCGTCGCTGTCGCCGTCACCAGCTCTGCTGCATCAG - UNI27378 - GTACCACCAGCTTCTCTTCCAGTGCTTCAGCCGCTGTCATAG

CATCTCCTCTCGGAGTGGCTCTCTCCTTGTGCAGCCTGTAAG CCCAGCACTATGGTGGTGGAGCACCCCGAATTCCTGAAGGCAGGGAAGGAGCCTGGC

CTGCAGATCTGGCGTGTGGAGAAGTTTGACCTGGTGCCTGTGCCCCCCAACCTCTATGGAGACTTCTTCACGGGTGATGCCTATGTCATCCTAAAGACTG

TGCAGCTGAGGAATGGGAATCTGCAGTATGACCTCCACTATTGGCTGG GCAATGAATGCAGCCAGGATGAGAGCGGGGCTGCTGCCATCTTTACTGTGC

AACTGGATGACTACCTGAACGGCCGGGCTGTACAGCACCGTGAGGTTCAGGGCTTTGAGTCGTCCACCTTCTCCGGCTACTTCAAGTCTGGACTTAAGTA

CAAG AAAGGAGGTGTGGCATCTGGATTCAAACACGTGGTACCCAATGAGGTGGTGGTCCAGAGGCTCTTCCAGGTCAAAGGACGCCGTGTAGTCCGTGC

TACTGAGGTACCTGTGTCCTGGGACAGTTTCAACAATGGCGACTGCTTCATTCTGGACCTGGGAAAC AATATCTATCAGTGGTGTGGCTCTGGCAGCAA

CAAATTTGAAAGGCTGAAGGCCACACAGGTGTCCAAGGGCATCCGGGACAACGAGAGGAGTGGCCGTGCTCAAGTACACGTGTCTGAAGAGGGAGGAGAG

CCAGAAGCCATGCTGCAG GTGCTGGGCCCCAAGCCAGCTCTGCCTGAAGGTACCGAGGACACAGCCAAGGAAGATGCAGCCAACCGAAGGCTGGCCAAG

CTCTACAAG GTCTCCAACGGTGCAGGTAGCATGTCAGTCTCCCTAGTGGCTGATGAGAACCCCTTCGCCCAGGGCGCCCTGAGATCTGAGGACTGCTTC

ATCCTGGACCATGGCAGAGATGGGAAAATCTTTGTTTGGAAAG GCAAGCAGGCCAACATGGAGGAGCGGAAGGCTGCCCTCAAAACAGCCTCTGACTTC

ATCTCCAAGATGCAGTACCCCAGGCAGACCCAG GTTTCAGTTCTCCCAGAGGGCGGTGAGACCCCTCTCTTTAAGCAGTTCTTCAAGAACTGGCGGGAC

CCAGACCAGACAGACGGCCCCGGCCTGGGCTACCTCTCCAGCCACATTGCCAACGTGGAGCGCGTACCTTTCGATGCTGCTACGCTGCACACCTCCACCG

CCATGGCCGCTCAGCACGGCATGGATGATGATGGAACTGGCCAGAAACAG ATCTGGAGAATTGAAGGTTCCAACAAGGTGCCAGTGGACCCTGCCACAT

ACGGGCAGTTCTATGGAGGCGACAGCTACATCATTCTGTACAACTACCGCCACGGTGGCCGCCAGGGACAGATCATCTACAACTG GCAGGGTGCCCAGT

CTACCCAGGATGAGGTTGCTGCTTCTGCCATCCTGACTGCCCAGCTGGATGAGGAGCTGGGAGGAACTCCTGTCCAG AGCCGAGTGGTCCAAGGCAAAG

AGCCTGCACACCTCATGAGCTTGTTTGGCGGGAAGCCCATGATCATCTACAAGGGTGGCACCTCCCGTGATGGTGGGCAGACAGCTCCTGCCAGTATCCG

CCTCTTCCAAGTGCGAGCCAGCAGCTCTGGAGCCACCAGGGCTGTGGAG GTGATGCCTAAGTCTGGTGCTCTGAACTCCAACGATGCCTTTGTGCTGAA

AACCCCCTCCGCTGCCTACCTGTGGGTGGGCGCAGGAGCCAGTGAGGCGGAGAAGACCGGCGCCCAGGAGCTTCTGAAGGTGCTTCGGTCCCAGCATGTG

CAGGTGGAAGAAGGCAGTGAGCCAG ATGCCTTCTGGGAGGCTCTGGGCGGGAAGACTGCCTACCGCACATCCCCCAGGCTTAAGGACAAGAAGATGGAT

GCCCATCCTCCTCGACTCTTTGCCTGCTCCAACAGGATCGGACGCTTTGTG ATCGAAGAGGTTCCTGGCGAGCTTATGCAGGAAGACCTGGCTACTGAT

GACGTCATGCTCCTGGACACCTGGGACCAG GTCTTTGTCTGGGTTGGAAAAGACTCCCAGGAAGAGGAAAAGACGGAAGCCTTGACTTCTG CTAAGCG

GTACATCGAGACAGATCCAGCAAATCGGGACAGGCGGACCCCCATCACAGTCGTTAGGCAGGGCTTTGAGCCTCCTTCCTTCGTGGGCTGGTTCCTCGGC

TGGGATGACAACTACTGGTCGGTGGATCCTTTGGACCGGGCCTTGGCTGAGCTGGCTGCCTGAGTAAGGACCAAAGCCATCAATGTCACCAATCAGTGCC

TTTGAGGGTTGTCCATCTCCCAAAGACATCATATGGCAAGCAGGAAAACTATGATGTGTGCGCGCGTGTTTTTGTTTTTGTTTTTTACGGTAGCCAAAAC

AAGCCCTGTGGAAACTCAGGGTCTTTACAGAATTGCTTCAAATGTCTGTACTTTGGAAATGAAAGCCAATAAAAGCTTTTTGAAGTGTGTTCTC
Translation
 - UNI27378 -  MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLG GNECSQDESGAAAIFTVQ

LDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYK KGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWDSFNNGDCFILDLGN NIYQWCGSGS

NKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQ VLGPKPALPEGTEDTAKEDAANRRLAKLYK VSNGAGSMSVSLVADENPFAQGALRSED

CFILDHGRDGKIFVWKG GKQANMEERKAALKTASDFISKMQYPRQTQ VSVLPEGGETPLFKQFFKNWRDPDQTDGPGLGYLSSHIANVERVPFDAATL

HTSTAMAAQHGMDDDGTGQKQ IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNW WQGAQSTQDEVAASAILTAQLDEELGGTPVQ 

SRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAPASIRLFQVRASSSGATRAVE VMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELL

KVLRSQHVQVEEGSEPD DAFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFV IEEVPGELMQEDLATDDVMLLDTWDQ VFVWVGKDSQEE

EKTEALTSA AKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDDNYWSVDPLDRALAELAA
Transcript ENSMUST00000028239
Sequence
ATGGCTCCGTACCGCTCTTCACTGCTCTGCGCGCTGCTCCTCCTGGCGCTGTGCGCACTGTCGCCTTCCCATGCAGCCACCACATCACGGGGCAGGGCCC

AAGAGAGGGCGCCCCAAAGTCGGGTGTCTGAGGCGCGG CCCAGCACTATGGTGGTGGAGCACCCCGAATTCCTGAAGGCAGGGAAGGAGCCTGGCCTGC

AGATCTGGCGTGTGGAGAAGTTTGACCTGGTGCCTGTGCCCCCCAACCTCTATGGAGACTTCTTCACGGGTGATGCCTATGTCATCCTAAAGACTGTGCA

GCTGAGGAATGGGAATCTGCAGTATGACCTCCACTATTGGCTGG GCAATGAATGCAGCCAGGATGAGAGCGGGGCTGCTGCCATCTTTACTGTGCAACT

GGATGACTACCTGAACGGCCGGGCTGTACAGCACCGTGAGGTTCAGGGCTTTGAGTCGTCCACCTTCTCCGGCTACTTCAAGTCTGGACTTAAGTACAAG

 AAAGGAGGTGTGGCATCTGGATTCAAACACGTGGTACCCAATGAGGTGGTGGTCCAGAGGCTCTTCCAGGTCAAAGGACGCCGTGTAGTCCGTGCTACT

GAGGTACCTGTGTCCTGGGACAGTTTCAACAATGGCGACTGCTTCATTCTGGACCTGGGAAAC AATATCTATCAGTGGTGTGGCTCTGGCAGCAACAAA

TTTGAAAGGCTGAAGGCCACACAGGTGTCCAAGGGCATCCGGGACAACGAGAGGAGTGGCCGTGCTCAAGTACACGTGTCTGAAGAGGGAGGAGAGCCAG

AAGCCATGCTGCAG GTGCTGGGCCCCAAGCCAGCTCTGCCTGAAGGTACCGAGGACACAGCCAAGGAAGATGCAGCCAACCGAAGGCTGGCCAAGCTCT

ACAAG GTCTCCAACGGTGCAGGTAGCATGTCAGTCTCCCTAGTGGCTGATGAGAACCCCTTCGCCCAGGGCGCCCTGAGATCTGAGGACTGCTTCATCC

TGGACCATGGCAGAGATGGGAAAATCTTTGTTTGGAAAG GCAAGCAGGCCAACATGGAGGAGCGGAAGGCTGCCCTCAAAACAGCCTCTGACTTCATCT

CCAAGATGCAGTACCCCAGGCAGACCCAG GTTTCAGTTCTCCCAGAGGGCGGTGAGACCCCTCTCTTTAAGCAGTTCTTCAAGAACTGGCGGGACCCAG

ACCAGACAGACGGCCCCGGCCTGGGCTACCTCTCCAGCCACATTGCCAACGTGGAGCGCGTACCTTTCGATGCTGCTACGCTGCACACCTCCACCGCCAT

GGCCGCTCAGCACGGCATGGATGATGATGGAACTGGCCAGAAACAG ATCTGGAGAATTGAAGGTTCCAACAAGGTGCCAGTGGACCCTGCCACATACGG

GCAGTTCTATGGAGGCGACAGCTACATCATTCTGTACAACTACCGCCACGGTGGCCGCCAGGGACAGATCATCTACAACTG GCAGGGTGCCCAGTCTAC

CCAGGATGAGGTTGCTGCTTCTGCCATCCTGACTGCCCAGCTGGATGAGGAGCTGGGAGGAACTCCTGTCCAG AGCCGAGTGGTCCAAGGCAAAGAGCC

TGCACACCTCATGAGCTTGTTTGGCGGGAAGCCCATGATCATCTACAAGGGTGGCACCTCCCGTGATGGTGGGCAGACAGCTCCTGCCAGTATCCGCCTC

TTCCAAGTGCGAGCCAGCAGCTCTGGAGCCACCAGGGCTGTGGAG GTGATGCCTAAGTCTGGTGCTCTGAACTCCAACGATGCCTTTGTGCTGAAAACC

CCCTCCGCTGCCTACCTGTGGGTGGGCGCAGGAGCCAGTGAGGCGGAGAAGACCGGCGCCCAGGAGCTTCTGAAGGTGCTTCGGTCCCAGCATGTGCAGG

TGGAAGAAGGCAGTGAGCCAG ATGCCTTCTGGGAGGCTCTGGGCGGGAAGACTGCCTACCGCACATCCCCCAGGCTTAAGGACAAGAAGATGGATGCCC

ATCCTCCTCGACTCTTTGCCTGCTCCAACAGGATCGGACGCTTTGTG ATCGAAGAGGTTCCTGGCGAGCTTATGCAGGAAGACCTGGCTACTGATGACG

TCATGCTCCTGGACACCTGGGACCAG GTCTTTGTCTGGGTTGGAAAAGACTCCCAGGAAGAGGAAAAGACGGAAGCCTTGACTTCTG CTAAGCGGTAC

ATCGAGACAGATCCAGCAAATCGGGACAGGCGGACCCCCATCACAGTCGTTAGGCAGGGCTTTGAGCCTCCTTCCTTCGTGGGCTGGTTCCTCGGCTGGG

ATGACAACTACTGGTCGGTGGATCCTTTGGACCGGGCCTTGGCTGAGCTGGCTGCCTGAGTAAGGACCAAAGCCATCAATGTCACCAATCAGTGCCTTTG

AGGGTTGTCCATCTCCCAAAGACATCATATGGCAAGCAGGAAAACTATGATGTGTGCGCGCGTGTTTTTGTTTTTGTTTTTTACGGTAGCCAAAACAAGC

CCTGTGGAAACTCAGGGTCTTTACAGAATTGCTTCAAATGTCTGTACTTTGGAAATGAAAGCCAATAAAAGCTTTTTGAAGTGTGTTCTC
Translation
MAPYRSSLLCALLLLALCALSPSHAATTSRGRAQERAPQSRVSEAR PSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTV

QLRNGNLQYDLHYWLG GNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYK KGGVASGFKHVVPNEVVVQRLFQVKGRRVV

RATEVPVSWDSFNNGDCFILDLGN NIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQ VLGPKPALPEGTEDTAKEDAANRR

LAKLYK VSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKG GKQANMEERKAALKTASDFISKMQYPRQTQ VSVLPEGGETPLFKQF

FKNWRDPDQTDGPGLGYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQ IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIY

NW WQGAQSTQDEVAASAILTAQLDEELGGTPVQ SRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAPASIRLFQVRASSSGATRAVE VMPKSGA

LNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVLRSQHVQVEEGSEPD DAFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFV IEEV

PGELMQEDLATDDVMLLDTWDQ VFVWVGKDSQEEEKTEALTSA AKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDDNYWSVDPLDRALAELA

A

For any suggestions or comments, please send an email to unitrap@crg.es