Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026883 (Dab2ip)
Chromosomal location
Chr 2: 35414093 - 35586514 (+)
Description
disabled homolog 2 (Drosophila) interacting protein Gene [Source:MGI (curated);Acc:Dab2ip-002]
RefSeq_dna
NM_001001602 
RefSeq_peptide
NP_001001602.2 NP_001107596.1 NP_001107597.1 
UniGene
Mm.375721 Mm.29629 
MGI
MGI:1916851 
Uniprot/SWISSPROT
Q3UHC7 
Uniprot/SPTREMBL
A2AUX1 A2AUW9 A2AUX0 Q6Y636 A2AUX5 A2AUX3 A2AUX2 A5X2X2 Q3U2G7 A2AUX4 B1AZ03 
Human Ortholog
ENSG00000136848 (DAB2IP)
Omim not available
UniTrap UNI31931
Vector Insertion
Chr 2: 35436654 - 35477569
Public Clones (ggtc) IST15097C7 (tigm) IST13612D5 (tigm) IST15021E11 (tigm) IST13612D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24022
Vector Insertion
Chr 2: 35477804 - 35499407
Public Clones D173B05 (ggtc) D127E12 (ggtc)
Private Clones OST237406 (lexicon) OST170197 (lexicon) OST77519 (lexicon) OST36859 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29787
Vector Insertion
Chr 2: 35517146 - 35547513
Public Clones (sanger) E068E04 (ggtc) D093C06 (ggtc) D159E08 (ggtc) D110G10 (ggtc)
IST15060E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38597
Vector Insertion
Chr 2: 35552328 - 35563167
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16497
Vector Insertion
Chr 2: 35563167 - 35563322
Public Clones CMHD-GT_453G8-3 (cmhd)
Private Clones OST459718 (lexicon) OST458458 (lexicon) OST399370 (lexicon) OST375927 (lexicon)
OST348452 (lexicon) OST331940 (lexicon) OST326498 (lexicon) OST324546 (lexicon)
OST316829 (lexicon) OST254957 (lexicon) OST113234 (lexicon) OST63485 (lexicon)
OST57127 (lexicon) OST53823 (lexicon) OST38009 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19310
Vector Insertion
Chr 2: 35563167 - 35563322
Public Clones not available
Private Clones OST395601 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2456
Vector Insertion
Chr 2: 35563322 - 35563726
Public Clones AA0179 (sanger) RRS162 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16569
Vector Insertion
Chr 2: 35564333 - 35564433
Public Clones not available
Private Clones OST458243 (lexicon) OST424022 (lexicon) OST314329 (lexicon) OST254955 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2504
Vector Insertion
Chr 2: 35572793 - 35574279
Public Clones XT0252 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028246
Sequence
GAGAAGCCGCTTACTTTCAACTTCCAACTTCTTGGACCTGGAGGCTACTGTGTGGAAGACTGTAATTTTCCTTGTTCTCTGGGGAACCCGGAAATCTCTA

GATGTTGTCGCCTCTGTGTGCTTAAGACATTTTTGAGAGTTTCAACGTGGTGGACACAGACATAGTGTGTGCTCTGTGGTAAGGGGGAACCCAAAGGGTT

CACCTCTTAAATGTCCACCCTGGCCACCTGGATCTGCACCACCCTTGGGAATGGGCCTCTGTGGCCTTGGACTCCTCGGTGACAACCTTGGCAAGATCCT

GTGCTGGTCTGGAGGTGCCACTCTCTGGAGGCCCAGCCATCCTCGGAAGCCTCATCTGGCTGCTGGGCCTCAGATGCCCAGGTCAGCAGAGAGGCCTACA

CTCCTATCGTTGCCAAG - UNI16497 - - UNI19310 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCC

CCAGCAGCGCAGTGGAGGCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG -

 UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGA

GCGCGATAAGTGGATGGAGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGT

GGGTGATTGAGGCCAAGGATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGAC

GGACAATGTCTTCTGGGGAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAA

AAGGAACGCAACAGCTACCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACC

CCAAGGGTGGCAAAGGCCCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCA

CATCACTAACCACTACCTGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAG

AGCACGGGAAAGGTGAAG GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTG

GCCACCAAGGCCATCGAGGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAA

AATTGTGAAGTGGACCCAAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCA

ACTCCTACTG CGTCTTCCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCA

TCAGCGCCTCCCTCTTCCTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCAC

CCTCACGCTCATTGCCAAAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCA

CGAGTGGACCAACATGCAGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAG

CTCTCTAGCCTGCACTCCCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATC

CTGAGGGATGTCCACACAGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCT

CTGCTGGGCTTCAGAAGATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTT

TTGTCACAAGGTCCTCCGGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAG

CCTGTCCATGGTGGACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCG

ACTCAGCTGCTGGCTGGGTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCA

CCTCCGAGGGTGCACCAGGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGG

CCTTGGTGACTCAGGCTCTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCT

GCAGAGGAGCTGGCAAGGCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCG

GTCCCCAGCGGAGGATTGACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTA

CCCACGACCCTCAAGTGGAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGC

CCAGAGCTGAAGCCCCGAGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACGCG

CAGTTGTTAGAAGACGAGGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTG

CTACAAGACAAGCTACGGATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATC

AGGCTCGGCTGGAAGAAGGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAG

AAGAACTGAAGAAGGATCATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTG

CCAATGCCCGCCTCATGAGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCGTCTCCCCCACCAACCCCACCAAATTGCAGAT

TACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGTGGTGGCCCGGGACAGGGTCTCCGTCAGGAGACTCCC

ACAGTTGCAGGCTAGCCTGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCACAGTGGCCCCCCTTCTCTTTGCCCACCTGAACAGTGG

GTGTGGGTAGAGGCAGCGGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGAATGTGTCTCTGGTTGTTGAGTTTGGTATGTGGCACC

TTCTCTCTGAGCAGCCAGGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGCAAAGGGCTCAAGGAAGGTTTAGGGGCCACTGCTGTG

GGTTTCCCATGGCCCCCAGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTCTGCCCTGAGCCCCTGCCACTGCATGCAGCTGGTCAG

GGACCCTTCCAGGGGGTGAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTGACACCCTCCACCCTCCTTCCCTTCCTTCCTTGCATT

GCCAAACAGACAGCACTGCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTTCCCACACTTCACATGCGGGCCTGGCTCATGCTCTTG

GAACTCCAGAAGCCAGAGAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTTCTCCAGGGTCCCAGTGTGGCCTGCACAGTGGCCCTG

TGGGGAGAGGCCAGCCAGTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAAGAATTCTAAAGCCTGCCGGCCCTGAGAAGGTGGATA

ACTGTGATTTTTTTTCCTTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTGAGCGAGCGCACTGC

ATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCCTCTCCTCACCCTCC

CAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTCTGTAGCATATCTGT

CCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTCCAAGCCCTGGTTCT

GAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACTAGAAAGCGTGGACA

TCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGACCAATGCTGGGAGA

GGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTGTCCACACCCCTGCT

CCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGGAGCCCTGTTTTCCT

CCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGACAGGAGAGCGCAGGG

CCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTCCACAGA

TTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTATTTCACCCAAGGGA

TGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCTGGGCAGGACAAAGA

GCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGTTGATGGGGGCAAAT

GCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTGCCAGAGGCCCTGCT

CTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTTCAACTTGTGTGTTA

GGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACGTGTACCCCAGCACC

TGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGCCACAAGGCTACCCG

ATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCAGTCGAGACTTTTAA

CCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTATTTAG

CTATTTT
Translation
 - UNI16497 - - UNI19310 -  - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - MENLRRAVHPNK - UNI165

69 - DNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAAS

VAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVK DFLTDLMMS

EVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMCCELAFCKIINSYC CVFPRELKE

VFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK KFGSKEEYMSFMNQFLEHEWTNMQRFLL

EISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSVSA

GLQKMVIENDLSG GLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPADGQVPA

TQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTA

AEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDWAGPGTRLRQQSSSSKGDS

PELKPRAMHKQ GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLE

YQARLEEGEERLRRQQEDKDIQMKGIISR RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAANARLMSALTQLKERYSMQARNGVSPTNPT

KLQITENGEFRNSSNC
Transcript ENSMUST00000112980
Sequence
GCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCCGCCGGGCGGTCCGGAGCGGCCGATGGGGCCCGTGTGAGCGCCCAGGCCTGGCCCGGTGCCCGGC

GGGCGGCAGCATGTCCGCCGGCGGCAACGCCAGGAAGAGCACCGGGAGGCCATCCTACTACTACCGGCTGCTGCGGCGGCCCCGGCTGCAGCGACAGAGG

AGCCGCTCCCGCAGCCGGACCCGGCCAGCCAGGG - UNI24022 - AGTCGCCCCAAGAAAGGCCGGGCTCCCGGCGGAGCCTTCCCGGCAGCATGTC

AGAGAAAAACCCCAGCATGGAGCCCTCGGCTTCAACCCCGTTCCGGGTCACG GGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAG

CCAGCCCAAACTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCAGCCGCCGCCGCCGCGGACAATGAGAG - UNI16497 -

 - UNI19310 - - UNI29787 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGGAG

GCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UNI1

6497 - - UNI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGAGCGCGATAAGTGGATGG

AGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGTGGGTGATTGAGGCCAAG

GATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGACGGACAATGTCTTCTGGG

GAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAAAAGGAACGCAACAGCTA

CCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACCCCAAGGGTGGCAAAGGC

CCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCACATCACTAACCACTACC

TGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAGAGCACGGGAAAGGTGAA

G GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATCGA

GGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAAAATTGTGAAGTGGACCC

AAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCAACTCCTACTG CGTCTT

CCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCATCAGCGCCTCCCTCTTC

CTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCACCCTCACGCTCATTGCCA

AAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCACGAGTGGACCAACATGC

AGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAGCTCTCTAGCCTGCACTC

CCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATCCTGAGGGATGTCCACAC

AGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCTCTGCTGGGCTTCAGAAG

ATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCC

GGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAGCCTGTCCATGGTGGACC

TCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCGACTCAGCTGCTGGCTGG

GTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCACCTCCGAGGGTGCACCA

GGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGGCCTTGGTGACTCAGGCT

CTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCTGCAGAGGAGCTGGCAAG

GCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCGGTCCCCAGCGGAGGATT

GACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTACCCACGACCCTCAAGTG

GAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGCCCAGAGCTGAAGCCCCG

AGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGA

GGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTGCTACAAGACAAGCTACG

GATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATCAGGCTCGGCTGGAAGAA

GGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAGAAGAACTGAAGAAGGAT

CATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTGCCAATGCCCGCCTCATG

AGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCGTCTCCCCCACCAACCCCACCAAATTGCAGATTACTGAGAACGGCGAGT

TCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGTGGTGGCCCGGGACAGGGTCTCCGTCAGGAGACTCCCACAGTTGCAGGCTAGCC

TGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCACAGTGGCCCCCCTTCTCTTTGCCCACCTGAACAGTGGGTGTGGGTAGAGGCAGC

GGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGAATGTGTCTCTGGTTGTTGAGTTTGGTATGTGGCACCTTCTCTCTGAGCAGCCA

GGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGCAAAGGGCTCAAGGAAGGTTTAGGGGCCACTGCTGTGGGTTTCCCATGGCCCCC

AGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTCTGCCCTGAGCCCCTGCCACTGCATGCAGCTGGTCAGGGACCCTTCCAGGGGGT

GAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTGACACCCTCCACCCTCCTTCCCTTCCTTCCTTGCATTGCCAAACAGACAGCACT

GCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTTCCCACACTTCACATGCGGGCCTGGCTCATGCTCTTGGAACTCCAGAAGCCAGA

GAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTTCTCCAGGGTCCCAGTGTGGCCTGCACAGTGGCCCTGTGGGGAGAGGCCAGCCA

GTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAAGAATTCTAAAGCCTGCCGGCCCTGAGAAGGTGGATAACTGTGATTTTTTTTCC

TTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTGAGCGAGCGCACTGCATGGGAAATAGCGGCCC

TGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCCTCTCCTCACCCTCCCAGCCCCAGCCAAGGAC

CCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTCTGTAGCATATCTGTCCCTCCCCCCCCCCCCT

TTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTCCAAGCCCTGGTTCTGAGTCACCTAGGGCAGG

AGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACTAGAAAGCGTGGACATCCTGAGGTGTGGCCTA

GCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGACCAATGCTGGGAGAGGGCGTGGCTATCAAGG

GTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTGTCCACACCCCTGCTCCCATGCATTTCAGCAG

GGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGGAGCCCTGTTTTCCTCCTCACCCACACTCTCG

CCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGACAGGAGAGCGCAGGGCCAGATGCAATGGCCCC

CTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTCCACAGATTTTTATCTTAATTGCA

AGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTATTTCACCCAAGGGATGTACATAGTCCTTTAG

TCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCTGGGCAGGACAAAGAGCTTTGCAGTCTAGGTG

TCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGTTGATGGGGGCAAATGCCCCAGTGGGGCCAGT

AAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTGCCAGAGGCCCTGCTCTGGGAAGACCCTGGCC

ACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTTCAACTTGTGTGTTAGGGTGAAGGAAACTGCC

AAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACGTGTACCCCAGCACCTGCCCGAGGGACACTCC

TCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGCCACAAGGCTACCCGATCCCCCACTGTGCCCA

GCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCAGTCGAGACTTTTAACCCTGTAATAATGTACA

GAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTATTTAGCT
Translation
 - UNI24022 -   - UNI16497 - - UNI19310 - - UNI29787 -  - UNI2456 - - UNI16497 - - UNI16569 - - UNI1

9310 - MENLRRAVHPNK - UNI16569 - DNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVT

VHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTK

EEMASALVHILQSTGKVK DFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQG

NLKMCCELAFCKIINSYC CVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK 

KFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTA

LSTPGSGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSG GLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVD

LQDARTLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSG

SEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSS

GTLASASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQ GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQDK

LRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISR RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAAN

ARLMSALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC
Transcript ENSMUST00000112981
Sequence
GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGGAGGCCCTGGACCTCAGCATGGAGGAGGAG

GTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UNI16497 - - UNI19310 - TGCCTAG

ATGTGGGTCTGCCTTCTCCAGTGGAACCTGCATTTTGCTGGGAGTAGCCTGGTCAGTGAAGGCAATTCTGGCCAAATTCCTCACACCAGGAAAACATTGG

GGTTGCAACTGGGAAGTGAACAGGATTCATACCAGCAGTGGAGGGTGAAG - UNI16569 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGC

CGGTCAGCCGCTGAGCGCGATAAGTGGATGGAGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCA

TATCCTGAAGCTGTGGGTGATTGAGGCCAAGGATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACA

AGCAAGCTCAAGACGGACAATGTCTTCTGGGGAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTG

ACAAGAAAAAGAAAAAGGAACGCAACAGCTACCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGT

GGTGACACCCAACCCCAAGGGTGGCAAAGGCCCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAG

GAGTTTGCGGAGCACATCACTAACCACTACCTGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGG

TGCACATCCTGCAGAGCACGGGAAAGGTGAAG GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCC

GGGAGAACACACTGGCCACCAAGGCCATCGAGGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGT

ATGAGTCAGATGAAAATTGTGAAGTGGACCCAAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTT

CTGCAAGATCATCAACTCCTACTG CGTCTTCCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATAT

CAGTGAACGGCTCATCAGCGCCTCCCTCTTCCTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGAC

CGCACGGCTCGCACCCTCACGCTCATTGCCAAAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAAC

CAGTTCCTGGAGCACGAGTGGACCAACATGCAGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAG

ACCTGGGCCGGGAGCTCTCTAGCCTGCACTCCCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGAC

CTCTGCCTCGTATCCTGAGGGATGTCCACACAGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGG

CAGCAGCAGCGTCTCTGCTGGGCTTCAGAAGATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAA

CAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCC

AATGGCAGCAAGAGCCTGTCCATGGTGGACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACG

GGCAGGTGCCTGCGACTCAGCTGCTGGCTGGGTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACC

AACCACACCAGGCACCTCCGAGGGTGCACCAGGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCA

CTGTCACCCCGTGGCCTTGGTGACTCAGGCTCTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAA

GTTTCAGCACTGCTGCAGAGGAGCTGGCAAGGCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAG

GCAAAATAGTGCCGGTCCCCAGCGGAGGATTGACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTG

AGCACCCTACAGTACCCACGACCCTCAAGTGGAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCT

CCAAGGGAGACAGCCCAGAGCTGAAGCCCCGAGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCT

TGACCATGAACGCGCAGTTGTTAGAAGACGAGGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAA

G GATCTGGCAGTGCTACAAGACAAGCTACGGATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCT

GGTGCTGGAGTATCAGGCTCGGCTGGAAGAAGGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTT

GATGTCAGTGGAAGAAGAACTGAAGAAGGATCATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGC

CTCGCTGGATGCTGCCAATGCCCGCCTCATGAGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCGTCTCCCCCACCAACCCC

ACCAAATTGCAGATTACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGTGGTGGCCCGGGACAGGGTCTCC

GTCAGGAGACTCCCACAGTTGCAGGCTAGCCTGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCACAGTGGCCCCCCTTCTCTTTGCC

CACCTGAACAGTGGGTGTGGGTAGAGGCAGCGGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGAATGTGTCTCTGGTTGTTGAGTT

TGGTATGTGGCACCTTCTCTCTGAGCAGCCAGGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGCAAAGGGCTCAAGGAAGGTTTAG

GGGCCACTGCTGTGGGTTTCCCATGGCCCCCAGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTCTGCCCTGAGCCCCTGCCACTGC

ATGCAGCTGGTCAGGGACCCTTCCAGGGGGTGAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTGACACCCTCCACCCTCCTTCCCT

TCCTTCCTTGCATTGCCAAACAGACAGCACTGCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTTCCCACACTTCACATGCGGGCCT

GGCTCATGCTCTTGGAACTCCAGAAGCCAGAGAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTTCTCCAGGGTCCCAGTGTGGCCT

GCACAGTGGCCCTGTGGGGAGAGGCCAGCCAGTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAAGAATTCTAAAGCCTGCCGGCCC

TGAGAAGGTGGATAACTGTGATTTTTTTTCCTTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTG

AGCGAGCGCACTGCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCC

TCTCCTCACCCTCCCAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTC

TGTAGCATATCTGTCCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTC

CAAGCCCTGGTTCTGAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACT

AGAAAGCGTGGACATCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGA

CCAATGCTGGGAGAGGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTG

TCCACACCCCTGCTCCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGG

AGCCCTGTTTTCCTCCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGAC

AGGAGAGCGCAGGGCCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTAC

AGACTCTCCACAGATTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTA

TTTCACCCAAGGGATGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCT

GGGCAGGACAAAGAGCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGT

TGATGGGGGCAAATGCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTG

CCAGAGGCCCTGCTCTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTT

CAACTTGTGTGTTAGGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACG

TGTACCCCAGCACCTGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGC

CACAAGGCTACCCGATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCA

GTCGAGACTTTTAACCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATT

AAAGATTTATTTAGCTATTTTAA
Translation
 - UNI2456 - - UNI16497 - - UNI19310 - MWVCLLQWNLHFAGSSLVSEGNSGQIPHTRKTLGLQLGSEQDSYQQWRVK - UNI16569

 - VTTSSGSKCFSCRSAAERDKWMENLRRAVHPNK - UNI16569 - DNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVF

WGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNH

YLGLCAALEPILSAKTKEEMASALVHILQSTGKVK DFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENC

EVDPSKCSSADLPEHQGNLKMCCELAFCKIINSYC CVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTART

LTLIAKVTQNLANFAK KFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SV

VSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSG GLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEAN

EPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVY

QMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRG

RTPPTLLSTLQYPRPSSGTLASASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQ GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSK

EELSQAEK DLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISR RLMSVEEELKKDHAEMQAAVDSKQK

IIDAQ EKRIASLDAANARLMSALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC
Transcript ENSMUST00000112982
Sequence
ATGTGGGTCTGCCTTCTCCAGTGGAACCTGCATTTTGCTGGGAGTAGCCTGGTCAGTGAAGGCAATTCTGGCCAAATTCCTCACACCAGGAAAACATTGG

GGTTGCAACTGGGAAGTGAACAGGATTCATACCAGCAGTGGAGGGTGAAG - UNI16569 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGC

CGGTCAGCCGCTGAGCGCGATAAGTGGATGGAGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCA

TATCCTGAAGCTGTGGGTGATTGAGGCCAAGGATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACA

AGCAAGCTCAAGACGGACAATGTCTTCTGGGGAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTG

ACAAGAAAAAGAAAAAGGAACGCAACAGCTACCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGT

GGTGACACCCAACCCCAAGGGTGGCAAAGGCCCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAG

GAGTTTGCGGAGCACATCACTAACCACTACCTGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGG

TGCACATCCTGCAGAGCACGGGAAAGGTGAAG GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCC

GGGAGAACACACTGGCCACCAAGGCCATCGAGGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGT

ATGAGTCAGATGAAAATTGTGAAGTGGACCCAAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTT

CTGCAAGATCATCAACTCCTACTG CGTCTTCCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATAT

CAGTGAACGGCTCATCAGCGCCTCCCTCTTCCTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGAC

CGCACGGCTCGCACCCTCACGCTCATTGCCAAAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAAC

CAGTTCCTGGAGCACGAGTGGACCAACATGCAGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAG

ACCTGGGCCGGGAGCTCTCTAGCCTGCACTCCCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGAC

CTCTGCCTCGTATCCTGAGGGATGTCCACACAGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGG

CAGCAGCAGCGTCTCTGCTGGGCTTCAGAAGATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAA

CAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCC

AATGGCAGCAAGAGCCTGTCCATGGTGGACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACG

GGCAGGTGCCTGCGACTCAGCTGCTGGCTGGGTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACC

AACCACACCAGGCACCTCCGAGGGTGCACCAGGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCA

CTGTCACCCCGTGGCCTTGGTGACTCAGGCTCTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAA

GTTTCAGCACTGCTGCAGAGGAGCTGGCAAGGCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAG

GCAAAATAGTGCCGGTCCCCAGCGGAGGATTGACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTG

AGCACCCTACAGTACCCACGACCCTCAAGTGGAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCT

CCAAGGGAGACAGCCCAGAGCTGAAGCCCCGAGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCT

TGACCATGAACGCGCAGTTGTTAGAAGACGAGGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAA

G GATCTGGCAGTGCTACAAGACAAGCTACGGATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCT

GGTGCTGGAGTATCAGGCTCGGCTGGAAGAAGGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTT

GATGTCAGTGGAAGAAGAACTGAAGAAGGATCATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGC

CTCGCTGGATGCTGCCAATGCCCGCCTCATGAGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCGTCTCCCCCACCAACCCC

ACCAAATTGCAGATTACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGTGGTGGCCCGGGACAGGGTCTCC

GTCAGGAGACTCCCACAGTTGCAGGCTAGCCTGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCACAGTGGCCCCCCTTCTCTTTGCC

CACCTGAACAGTGGGTGTGGGTAGAGGCAGCGGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGAATGTGTCTCTGGTTGTTGAGTT

TGGTATGTGGCACCTTCTCTCTGAGCAGCCAGGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGCAAAGGGCTCAAGGAAGGTTTAG

GGGCCACTGCTGTGGGTTTCCCATGGCCCCCAGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTCTGCCCTGAGCCCCTGCCACTGC

ATGCAGCTGGTCAGGGACCCTTCCAGGGGGTGAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTGACACCCTCCACCCTCCTTCCCT

TCCTTCCTTGCATTGCCAAACAGACAGCACTGCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTTCCCACACTTCACATGCGGGCCT

GGCTCATGCTCTTGGAACTCCAGAAGCCAGAGAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTTCTCCAGGGTCCCAGTGTGGCCT

GCACAGTGGCCCTGTGGGGAGAGGCCAGCCAGTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAAGAATTCTAAAGCCTGCCGGCCC

TGAGAAGGTGGATAACTGTGATTTTTTTTCCTTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTG

AGCGAGCGCACTGCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCC

TCTCCTCACCCTCCCAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTC

TGTAGCATATCTGTCCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTC

CAAGCCCTGGTTCTGAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACT

AGAAAGCGTGGACATCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGA

CCAATGCTGGGAGAGGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTG

TCCACACCCCTGCTCCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGG

AGCCCTGTTTTCCTCCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGAC

AGGAGAGCGCAGGGCCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTAC

AGACTCTCCACAGATTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTA

TTTCACCCAAGGGATGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCT

GGGCAGGACAAAGAGCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGT

TGATGGGGGCAAATGCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTG

CCAGAGGCCCTGCTCTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTT

CAACTTGTGTGTTAGGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACG

TGTACCCCAGCACCTGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGC

CACAAGGCTACCCGATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCA

GTCGAGACTTTTAACCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATT

AAAGATTTATTTAGCTATTTT
Translation
MWVCLLQWNLHFAGSSLVSEGNSGQIPHTRKTLGLQLGSEQDSYQQWRVK - UNI16569 - VTTSSGSKCFSCRSAAERDKWMENLRRAVHPNK - 

UNI16569 - DNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLV

SLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVK DFL

TDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMCCELAFCKIINSYC CVF

PRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK KFGSKEEYMSFMNQFLEHEWTN

MQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSG

SSSVSAGLQKMVIENDLSG GLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPA

DGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKL

GSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDWAGPGTRLRQQSS

SSKGDSPELKPRAMHKQ GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQDKLRISTKKLEEYETLFKCQEETT

QKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISR RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAANARLMSALTQLKERYSMQARNGV

SPTNPTKLQITENGEFRNSSNC
Transcript ENSMUST00000112983
Sequence
AGCACAGAGCTGGACTGACTGAGGTTAGCAGGGAACAGCCAGTGGCTAGATGGCTACTCTAGCCTCTGTTCACTTG - UNI16497 - - UNI19310

 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGGAGGCCCTGGACCTCAGCATGGAGGAG

GAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UNI16497 - - UNI16569 - - UN

I19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGAGCGCGATAAGTGGATGGAGAACCTGAGGCGAGCAGTGCACC

CCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGTGGGTGATTGAGGCCAAGGATCTGCCGGCCAAGAAGAAGTAT

CTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGACGGACAATGTCTTCTGGGGAGAGCACTTTGAGTTCCATAACC

TGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAAAAGGAACGCAACAGCTACCTGGGCCTGGTGAGCCTGCCTGC

CGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACCCCAAGGGTGGCAAAGGCCCTGGGCCCATGATCCGAATCAAG

GCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCACATCACTAACCACTACCTGGGGCTGTGCGCAGCCCTGGAAC

CCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAGAGCACGGGAAAGGTGAAG GACTTTCTAACAGACCTGATGA

TGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATCGAGGAATACCTCAAACTTGTGGGCCA

GAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAAAATTGTGAAGTGGACCCAAGCAAGTGCTCATCCGCTGACCT

CCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCAACTCCTACTG CGTCTTCCCACGGGAGCTTAAGGAGGTGTT

CGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCATCAGCGCCTCCCTCTTCCTTCGCTTCCTGTGCCCTGCCATC

ATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCACCCTCACGCTCATTGCCAAAGTCACCCAGAACCTGGCCAACT

TTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCACGAGTGGACCAACATGCAGCGCTTCCTGTTGGAGATCTCCA

ACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAGCTCTCTAGCCTGCACTCCCTGCTCTGGGAAGCTGTCAGCCA

GCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATCCTGAGGGATGTCCACACAGCACTGAGCACTCCTGGCAGTGG

GCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCTCTGCTGGGCTTCAGAAGATGGTGATTGAAAATGACCTCTCT

GG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGCCTTCACCTGCCCGC

AGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAGCCTGTCCATGGTGGACCTCCAGGACGCCCGCACGCTGGATG

GGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCGACTCAGCTGCTGGCTGGGTGGCCAGCCAGGGCAGCCCCAGT

GAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCACCTCCGAGGGTGCACCAGGACGGCCCCAGTTGTTGGCCCCA

CTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGGCCTTGGTGACTCAGGCTCTGAAGGCCACAGCTCCCTGAGCT

CTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCTGCAGAGGAGCTGGCAAGGCGGCCTGGAGAACTGGCACGGAG

GCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCGGTCCCCAGCGGAGGATTGACCAGCCGCCACCGCCACCACCA

CCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTACCCACGACCCTCAAGTGGAACCCTGGCATCAGCATCCCCCG

ACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGCCCAGAGCTGAAGCCCCGAGCCATGCACAAGCAG GGCCCTT

CACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGTCTGGGCCCAGATCCCCCCCA

CAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTGCTACAAGACAAGCTACGGATCTCCACCAAGAAGCTGGAGGA

GTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATCAGGCTCGGCTGGAAGAAGGTGAGGAGCGGCTGCGGCGGCAG

CAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAGAAGAACTGAAGAAGGATCATGCAGAGATGCAAGCAGCTGTA

GATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTGCCAATGCCCGCCTCATGAGTGCCCTCACACAGCTGAAAGAG

AGGTACAGCATGCAAGCCCGTAACGGCGTCTCCCCCACCAACCCCACCAAATTGCAGATTACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAAC

CTGCCTGAGGAGAGGGGGACTGTGGTGGCCCGGGACAGGGTCTCCGTCAGGAGACTCCCACAGTTGCAGGCTAGCCTGCAGTGGAGGGGGCGTAAGACTG

ATGGAGCGTGAGACTGAGGGCACAGTGGCCCCCCTTCTCTTTGCCCACCTGAACAGTGGGTGTGGGTAGAGGCAGCGGAGACTGCACTGGGGAGTGGGGC

CAGTCTGCAGGGAGGCCTGCCGAATGTGTCTCTGGTTGTTGAGTTTGGTATGTGGCACCTTCTCTCTGAGCAGCCAGGTGCATGTACCCCTCCTTACCCT

TTCCCATGGAGGAAGCTACCTGCAAAGGGCTCAAGGAAGGTTTAGGGGCCACTGCTGTGGGTTTCCCATGGCCCCCAGGACCTGATGGAGTAGTTGACAG

GCAGAGTGGCCCCTGTTCATCTCTGCCCTGAGCCCCTGCCACTGCATGCAGCTGGTCAGGGACCCTTCCAGGGGGTGAGGAACTGAAGAACAGAACCTCG

GTCCTATGCCCATCCCAGACGTGACACCCTCCACCCTCCTTCCCTTCCTTCCTTGCATTGCCAAACAGACAGCACTGCACTTTCTCTGCTGGGCCCTCAT

ACCCGTGGGAGGAGCCATAGCTTCCCACACTTCACATGCGGGCCTGGCTCATGCTCTTGGAACTCCAGAAGCCAGAGAGCTGGGCAGAGGTGGCCAGGTT

GCACCATGCGTTGTAGCTGCCTTCTCCAGGGTCCCAGTGTGGCCTGCACAGTGGCCCTGTGGGGAGAGGCCAGCCAGTGCTCACCCTGCAAAGGTGATCT

CTCTTCTCTGATAGTTTAAGAAAGAATTCTAAAGCCTGCCGGCCCTGAGAAGGTGGATAACTGTGATTTTTTTTCCTTTCACAGTATGCATTAGAAACAA

AAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTGAGCGAGCGCACTGCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCT

CTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCCTCTCCTCACCCTCCCAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGG

CATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTCTGTAGCATATCTGTCCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAG

CTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTCCAAGCCCTGGTTCTGAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAG

AATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACTAGAAAGCGTGGACATCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGT

CCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGACCAATGCTGGGAGAGGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGA

GGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTGTCCACACCCCTGCTCCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTG

GCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGGAGCCCTGTTTTCCTCCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCT

GTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGACAGGAGAGCGCAGGGCCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCA

GGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTCCACAGATTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAA

TTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTATTTCACCCAAGGGATGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCA

GGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCTGGGCAGGACAAAGAGCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGG

GGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGTTGATGGGGGCAAATGCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAA

CGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTGCCAGAGGCCCTGCTCTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAG

AGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTTCAACTTGTGTGTTAGGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTC

TGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACGTGTACCCCAGCACCTGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGA

GCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGCCACAAGGCTACCCGATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGA

AAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCAGTCGAGACTTTTAACCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGAC

TCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTATTTAGCTATTTT
Translation
 - UNI16497 - - UNI19310 - MPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFE - UNI2456 - - UNI16497 -

 - UNI16569 - - UNI19310 - VTTSSGSKCFSCRSAAERDKWMENLRRAVHPNK - UNI16569 - DNSRRVEHILKLWVIEAKDLPAKKKY

LCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIK

ARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVK DFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVG

QKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMCCELAFCKIINSYC CVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFL

CPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK KFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLL

WEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSG GLIDFTRLPSPTPENKD

LFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTT

PGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQN

SAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQ GPSPVSPNALDRTAAWLLT

MNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISR R

LMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAANARLMSALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC
Transcript ENSMUST00000112986
Sequence
AGCCAGCCCAAACTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCAGCCGCCGCCGCCGCGGACAATGAGAG - UNI16497

 - - UNI19310 - - UNI29787 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGG

AGGCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UN

I16497 - - UNI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGAGCGCGATAAGTGGAT

GGAGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGTGGGTGATTGAGGCCA

AGGATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGACGGACAATGTCTTCTG

GGGAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAAAAGGAACGCAACAGC

TACCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACCCCAAGGGTGGCAAAG

GCCCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCACATCACTAACCACTA

CCTGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAGAGCACGGGAAAGGTG

AAG GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATC

GAGGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAAAATTGTGAAGTGGAC

CCAAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCAACTCCTACTG CGTC

TTCCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCATCAGCGCCTCCCTCT

TCCTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCACCCTCACGCTCATTGC

CAAAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCACGAGTGGACCAACAT

GCAGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAGCTCTCTAGCCTGCAC

TCCCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATCCTGAGGGATGTCCAC

ACAGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCTCTGCTGGGCTTCAGA

AGATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCT

CCGGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAGCCTGTCCATGGTGGA

CCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCGACTCAGCTGCTGGCT

GGGTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCACCTCCGAGGGTGCAC

CAGGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGGCCTTGGTGACTCAGG

CTCTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCTGCAGAGGAGCTGGCA

AGGCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCGGTCCCCAGCGGAGGA

TTGACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTACCCACGACCCTCAAG

TGGAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGCCCAGAGCTGAAGCCC

CGAGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGAC

GAGGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTGCTACAAGACAAGCTA

CGGATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATCAGGCTCGGCTGGAAG

AAGGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAGAAGAACTGAAGAAGG

ATCATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTGCCAATGCCCGCCTCA

TGAGTGCCCTCACACAGCTGAAAGAGAG TATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTGAGCGAGCGCA

CTGCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCCTCTCCTCACC

CTCCCAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTCTGTAGCATAT

CTGTCCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTCCAAGCCCTGG

TTCTGAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACTAGAAAGCGTG

GACATCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGACCAATGCTGG

GAGAGGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTGTCCACACCCC

TGCTCCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGGAGCCCTGTTT

TCCTCCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGACAGGAGAGCGC

AGGGCCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTCCA

CAGATTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTATTTCACCCAA

GGGATGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCTGGGCAGGACA

AAGAGCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGTTGATGGGGGC

AAATGCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTGCCAGAGGCCC

TGCTCTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTTCAACTTGTGT

GTTAGGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACGTGTACCCCAG

CACCTGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGCCACAAGGCTA

CCCGATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCAGTCGAGACTT

TTAACCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTAT

TTAGCTATTTT
Translation
 - UNI16497 - - UNI19310 - - UNI29787 - MPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFE - UNI2456 -

 - UNI16497 - - UNI16569 - - UNI19310 - VTTSSGSKCFSCRSAAERDKWMENLRRAVHPNK - UNI16569 - DNSRRVEHILKLW

VIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNP

KGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVK DFLTDLMMSEVDRCGDNEHLIFRENTL

ATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMCCELAFCKIINSYC CVFPRELKEVFASWRQECSSRGRPDIS

ERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK KFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYI

DLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSG GLID

FTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAG

LATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSL

TEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQ GPSPVS

PNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQED

KDIQMKGIISR RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAANARLMSALTQLKES SMH
Transcript ENSMUST00000095461
Sequence
GCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCCGCCGGGCGGTCCGGAGCGGCCGATGGGGCCCGTGTGAGCGCCCAGGCCTGGCCCGGTGCCCGGC

GGGCGGCAGCATGTCCGCCGGCGGCAACGCCAGGAAGAGCACCGGGAGGCCATCCTACTACTACCGGCTGCTGCGGCGGCCCCGGCTGCAGCGACAGAGG

AGCCGCTCCCGCAGCCGGACCCGGCCAGCCAGGG - UNI24022 - AGTCGCCCCAAGAAAGGCCGGGCTCCCGGCGGAGCCTTCCCGGCAGCATGTC

AGAGAAAAACCCCAGCATGGAGCCCTCGGCTTCAACCCCGTTCCGGGTCACG GGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAG

CCAGCCCAAACTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCAGCCGCCGCCGCCGCGGACAATGAGAG - UNI16497 -

 - UNI19310 - - UNI29787 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGGAG

GCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UNI1

6497 - - UNI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGAGCGCGATAAGTGGATGG

AGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGTGGGTGATTGAGGCCAAG

GATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGACGGACAATGTCTTCTGGG

GAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAAAAGGAACGCAACAGCTA

CCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACCCCAAGGGTGGCAAAGGC

CCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCACATCACTAACCACTACC

TGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAGAGCACGGGAAAGGTGAA

G GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATCGA

GGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAAAATTGTGAAGTGGACCC

AAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCAACTCCTACTG CGTCTT

CCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCATCAGCGCCTCCCTCTTC

CTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCACCCTCACGCTCATTGCCA

AAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCACGAGTGGACCAACATGC

AGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAGCTCTCTAGCCTGCACTC

CCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATCCTGAGGGATGTCCACAC

AGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCTCTGCTGGGCTTCAGAAG

ATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCC

GGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAGCCTGTCCATGGTGGACC

TCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCGACTCAGCTGCTGGCTGG

GTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCACCTCCGAGGGTGCACCA

GGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGGCCTTGGTGACTCAGGCT

CTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCTGCAGAGGAGCTGGCAAG

GCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCGGTCCCCAGCGGAGGATT

GACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTACCCACGACCCTCAAGTG

GAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGCCCAGAGCTGAAGCCCCG

AGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGA

GGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTGCTACAAGACAAGCTACG

GATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATCAGGCTCGGCTGGAAGAA

GGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAGAAGAACTGAAGAAGGAT

CATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTGCCAATGCCCGCCTCATG

AGTGCCCTCACACAGCTGAAAGAGAG TATGCATTAG
Translation
 - UNI24022 -   - UNI16497 - - UNI19310 - - UNI29787 - MPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDY

CFE - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - VTTSSGSKCFSCRSAAERDKWMENLRRAVHPNK - UNI16569 

- DNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAG

RQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVK DFLTDLMMSEVD

RCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMCCELAFCKIINSYC CVFPRELKEVFA

SWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK KFGSKEEYMSFMNQFLEHEWTNMQRFLLEIS

NPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSVSAGLQ

KMVIENDLSG GLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPADGQVPATQL

LAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEE

LARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDWAGPGTRLRQQSSSSKGDSPEL

KPRAMHKQ GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQA

RLEEGEERLRRQQEDKDIQMKGIISR RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAANARLMSALTQLKES SMH
Transcript ENSMUST00000065001
Sequence
GAGAAGCCGCTTACTTTCAACTTCCAACTTCTTGGACCTGGAGGCTACTGTGTGGAAGACTGTAATTTTCCTTGTTCTCTGGGGAACCCGGAAATCTCTA

GATGTTGTCGCCTCTGTGTGCTTAAGACATTTTTGAGAGTTTCAACGTGGTGGACACAGACATAGTGTGTGCTCTGTGGTAAGGGGGAACCCAAAGGGTT

CACCTCTTAAATGTCCACCCTGGCCACCTGGATCTGCACCACCCTTGGGAATGGGCCTCTGTGGCCTTGGACTCCTCGGTGACAACCTTGGCAAGATCCT

GTGCTGGTCTGGAGGTGCCACTCTCTGGAGGCCCAGCCATCCTCGGAAGCCTCATCTGGCTGCTGGGCCTCAGATGCCCAGGTCAGCAGAGAGGCCTACA

CTCCTATCGTTGCCAAG - UNI16497 - - UNI19310 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCC

CCAGCAGCGCAGTGGAGGCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG -

 UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGA

GCGCGATAAGTGGATGGAGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGT

GGGTGATTGAGGCCAAGGATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGAC

GGACAATGTCTTCTGGGGAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAA

AAGGAACGCAACAGCTACCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACC

CCAAGGGTGGCAAAGGCCCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCA

CATCACTAACCACTACCTGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAG

AGCACGGGAAAGGTGAAG GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTG

GCCACCAAGGCCATCGAGGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAA

AATTGTGAAGTGGACCCAAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCA

ACTCCTACTG CGTCTTCCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCA

TCAGCGCCTCCCTCTTCCTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCAC

CCTCACGCTCATTGCCAAAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCA

CGAGTGGACCAACATGCAGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAG

CTCTCTAGCCTGCACTCCCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATC

CTGAGGGATGTCCACACAGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCT

CTGCTGGGCTTCAGAAGATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTT

TTGTCACAAGGTCCTCCGGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAG

CCTGTCCATGGTGGACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCG

ACTCAGCTGCTGGCTGGGTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCA

CCTCCGAGGGTGCACCAGGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGG

CCTTGGTGACTCAGGCTCTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCT

GCAGAGGAGCTGGCAAGGCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCG

GTCCCCAGCGGAGGATTGACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTA

CCCACGACCCTCAAGTGGAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGC

CCAGAGCTGAAGCCCCGAGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACGCG

CAGTTGTTAGAAGACGAGGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTG

CTACAAGACAAGCTACGGATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATC

AGGCTCGGCTGGAAGAAGGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAG

AAGAACTGAAGAAGGATCATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTG

CCAATGCCCGCCTCATGAGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCGTCTCCCCCACCAACCCCACCAAATTGCAGAT

TACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGTGGTGGCCCGGGACAGGGTCTCCGTCAGGAGACTCCC

ACAGTTGCAGGCTAGCCTGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCACAGTGGCCCCCCTTCTCTTTGCCCACCTGAACAGTGG

GTGTGGGTAGAGGCAGCGGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGAATGTGTCTCTGGTTGTTGAGTTTGGTATGTGGCACC

TTCTCTCTGAGCAGCCAGGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGCAAAGGGCTCAAGGAAGGTTTAGGGGCCACTGCTGTG

GGTTTCCCATGGCCCCCAGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTCTGCCCTGAGCCCCTGCCACTGCATGCAGCTGGTCAG

GGACCCTTCCAGGGGGTGAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTGACACCCTCCACCCTCCTTCCCTTCCTTCCTTGCATT

GCCAAACAGACAGCACTGCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTTCCCACACTTCACATGCGGGCCTGGCTCATGCTCTTG

GAACTCCAGAAGCCAGAGAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTTCTCCAGGGTCCCAGTGTGGCCTGCACAGTGGCCCTG

TGGGGAGAGGCCAGCCAGTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAAGAATTCTAAAGCCTGCCGGCCCTGAGAAGGTGGATA

ACTGTGATTTTTTTTCCTTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTGAGCGAGCGCACTGC

ATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCCTCTCCTCACCCTCC

CAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTCTGTAGCATATCTGT

CCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTCCAAGCCCTGGTTCT

GAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACTAGAAAGCGTGGACA

TCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGACCAATGCTGGGAGA

GGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTGTCCACACCCCTGCT

CCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGGAGCCCTGTTTTCCT

CCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGACAGGAGAGCGCAGGG

CCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTCCACAGA

TTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTATTTCACCCAAGGGA

TGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCTGGGCAGGACAAAGA

GCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGTTGATGGGGGCAAAT

GCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTGCCAGAGGCCCTGCT

CTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTTCAACTTGTGTGTTA

GGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACGTGTACCCCAGCACC

TGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGCCACAAGGCTACCCG

ATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCAGTCGAGACTTTTAA

CCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTATTTAG

CTATTTT
Translation
MGLCGLGLLGDNLGKILCWSGGATLWRPSHPRKPHLAAGPQMPRSAERPTLLSLPR - UNI16497 - - UNI19310 - RSHLMPRLKESRSHESL

LSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFE - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - VTTSSGSKCFSCR

SAAERDKWMENLRRAVHPNK - UNI16569 - DNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTV

TVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKT

KEEMASALVHILQSTGKVK DFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQ

GNLKMCCELAFCKIINSYC CVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK

 KFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHT

ALSTPGSGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSG GLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMV

DLQDARTLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDS

GSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPS

SGTLASASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQ GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQD

KLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISR RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAA

NARLMSALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC
Transcript ENSMUST00000112987
Sequence
TTTAGGCTCCTCCCACAACTCCGTGTGTGCAGATCCTGTCTGAGTCTTCACATCTTCATAGAAGGAACATGTAG - UNI24022 - - UNI31931 -

 AGTCGCCCCAAGAAAGGCCGGGCTCCCGGCGGAGCCTTCCCGGCAGCATGTCAGAGAAAAACCCCAGCATGGAGCCCTCGGCTTCAACCCCGTTCCGGG

TCACG GGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAGCCAGCCCAAACTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGG

GGTTCCGGAGCGCAGCCGCCGCCGCCGCGGACAATGAGAG - UNI16497 - - UNI19310 - - UNI29787 - GTCCCATCTGATGCCAAGGC

TGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGGAGGCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCA

CAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - GTGACAACATCATC

AGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGAGCGCGATAAGTGGATGGAGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - G

ACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGTGGGTGATTGAGGCCAAGGATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGA

TGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGACGGACAATGTCTTCTGGGGAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACT

GTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAAAAGGAACGCAACAGCTACCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGT

TTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACCCCAAGGGTGGCAAAGGCCCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCAT

CTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCACATCACTAACCACTACCTGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAG

GAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAGAGCACGGGAAAGGTGAAG GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGG

GACAATGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATCGAGGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG

 GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAAAATTGTGAAGTGGACCCAAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCA

AGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCAACTCCTACTG CGTCTTCCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTA

GCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCATCAGCGCCTCCCTCTTCCTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCT

GCTTCAGGAGTATCCTGACGACCGCACGGCTCGCACCCTCACGCTCATTGCCAAAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGA

AGAATACATGTCCTTCATGAACCAGTTCCTGGAGCACGAGTGGACCAACATGCAGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACA

GCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAGCTCTCTAGCCTGCACTCCCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - 

AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATCCTGAGGGATGTCCACACAGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACC

TGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCTCTGCTGGGCTTCAGAAGATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGT

TACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAA

TGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAGCCTGTCCATGGTGGACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGC

CCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCGACTCAGCTGCTGGCTGGGTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAG

TGCGGCGGGCAGTGCCAACACCAACCACACCAGGCACCTCCGAGGGTGCACCAGGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTA

CCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGGCCTTGGTGACTCAGGCTCTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTG

GCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCTGCAGAGGAGCTGGCAAGGCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGG

GTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCGGTCCCCAGCGGAGGATTGACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGG

CAGGACACCTCCTACCCTGCTGAGCACCCTACAGTACCCACGACCCTCAAGTGGAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGG

CTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGCCCAGAGCTGAAGCCCCGAGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTG

GACCGCACGGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGG

AGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTGCTACAAGACAAGCTACGGATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCC

AGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATCAGGCTCGGCTGGAAGAAGGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGAT

GAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAGAAGAACTGAAGAAGGATCATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGA

TGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTGCCAATGCCCGCCTCATGAGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAA

CGGCGTCTCCCCCACCAACCCCACCAAATTGCAGATTACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGT

GGTGGCCCGGGACAGGGTCTCCGTCAGGAGACTCCCACAGTTGCAGGCTAGCCTGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCAC

AGTGGCCCCCCTTCTCTTTGCCCACCTGAACAGTGGGTGTGGGTAGAGGCAGCGGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGA

ATGTGTCTCTGGTTGTTGAGTTTGGTATGTGGCACCTTCTCTCTGAGCAGCCAGGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGC

AAAGGGCTCAAGGAAGGTTTAGGGGCCACTGCTGTGGGTTTCCCATGGCCCCCAGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTC

TGCCCTGAGCCCCTGCCACTGCATGCAGCTGGTCAGGGACCCTTCCAGGGGGTGAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTG

ACACCCTCCACCCTCCTTCCCTTCCTTCCTTGCATTGCCAAACAGACAGCACTGCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTT

CCCACACTTCACATGCGGGCCTGGCTCATGCTCTTGGAACTCCAGAAGCCAGAGAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTT

CTCCAGGGTCCCAGTGTGGCCTGCACAGTGGCCCTGTGGGGAGAGGCCAGCCAGTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAA

GAATTCTAAAGCCTGCCGGCCCTGAGAAGGTGGATAACTGTGATTTTTTTTCCTTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGG

AACACAGGGGCCTTTTAAATTGAGCGAGCGCACTGCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCA

CCAGGCCCCGTGTGCAGTCGCCTCTCCTCACCCTCCCAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGT

TTTCCCCAGCTCTAGGCTGTTCTGTAGCATATCTGTCCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCA

TCTGTTCCCACACTCTAGATTCCAAGCCCTGGTTCTGAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACT

TAATGCTCCTAGAGTCCTCACTAGAAAGCGTGGACATCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAA

AAGAACCCAGTTAGGCTGCAGACCAATGCTGGGAGAGGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACT

GCCTCTTCCTGCCCCACTCCTGTCCACACCCCTGCTCCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGT

CTTGCCCTTCCACTGCCCAGGGAGCCCTGTTTTCCTCCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATAT

GGGGAGGTCCCCAGGCCTGGACAGGAGAGCGCAGGGCCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAG

TGCAAAAACTGTAAAAGTGTACAGACTCTCCACAGATTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTG

GTGTTTGACTGTAATGGAACTATTTCACCCAAGGGATGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATA

TTAGAGCCTGGAGAACGGTGCTGGGCAGGACAAAGAGCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAA

GCATGCTGTTTGGGTGGAAGGTTGATGGGGGCAAATGCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTG

CTTACAGCAAGGGCTGGAGTTGCCAGAGGCCCTGCTCTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAAC

ACAGACACCTGACCTTTTTGTTCAACTTGTGTGTTAGGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGG

GGACCAGGGCCAGAGCTCAACGTGTACCCCAGCACCTGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGC

CCCTCTTTTCTATATACTCGGCCACAAGGCTACCCGATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGA

TCGGCCGGAGCCCTTCCCTCCAGTCGAGACTTTTAACCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTG

TACATTTGCAATTAGAAATATTAAAGATTTATTTAGCTATTTT
Translation
 - UNI24022 - - UNI31931 - MSEKNPSMEPSASTPFRVT GFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNER - UNI16

497 - - UNI19310 - - UNI29787 - RSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFE - UNI2456 - - U

NI16497 - - UNI16569 - - UNI19310 - VTTSSGSKCFSCRSAAERDKWMENLRRAVHPNK - UNI16569 - DNSRRVEHILKLWVIEA

KDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGK

GPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVK DFLTDLMMSEVDRCGDNEHLIFRENTLATKA

IEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMCCELAFCKIINSYC CVFPRELKEVFASWRQECSSRGRPDISERLI

SASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK KFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGR

ELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSG GLIDFTRL

PSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAGLATV

RRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKG

GQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQ GPSPVSPNAL

DRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQ

MKGIISR RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAANARLMSALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC
Transcript ENSMUST00000112989
Sequence
ATGTCCGCCGGCGGCAACGCCAGGAAGAGCACCGGGAGGCCATCCTACTACTACCGGCTGCTGCGGCGGCCCCGGCTGCAGCGACAGAGGAGCCGCTCCC

GCAGCCGGACCCGGCCAGCCAGGG - UNI24022 - AGTCGCCCCAAGAAAGGCCGGGCTCCCGGCGGAGCCTTCCCGGCAGCATGTCAGAGAAAAAC

CCCAGCATGGAGCCCTCGGCTTCAACCCCGTTCCGGGTCACG GGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAGCCAGCCCAAA

CTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCAGCCGCCGCCGCCGCGGACAATGAGAG - UNI16497 - - UNI1931

0 - - UNI29787 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGGAGGCCCTGGACC

TCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UNI16497 - - U

NI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGAGCGCGATAAGTGGATGGAGAACCTGAG

GCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGTGGGTGATTGAGGCCAAGGATCTGCCGG

CCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGACGGACAATGTCTTCTGGGGAGAGCACTT

TGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAAAAGGAACGCAACAGCTACCTGGGCCTG

GTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACCCCAAGGGTGGCAAAGGCCCTGGGCCCA

TGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCACATCACTAACCACTACCTGGGGCTGTG

CGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAGAGCACGGGAAAGGTGAAG GACTTTCT

AACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATCGAGGAATACCTC

AAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAAAATTGTGAAGTGGACCCAAGCAAGTGC

TCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCAACTCCTACTG CGTCTTCCCACGGGAG

CTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCATCAGCGCCTCCCTCTTCCTTCGCTTCC

TGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCACCCTCACGCTCATTGCCAAAGTCACCCA

GAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCACGAGTGGACCAACATGCAGCGCTTCCT

GTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAGCTCTCTAGCCTGCACTCCCTGCTCTGG

GAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATCCTGAGGGATGTCCACACAGCACTGAGC

ACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCTCTGCTGGGCTTCAGAAGATGGTGATTG

AAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGC

CTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAGCCTGTCCATGGTGGACCTCCAGGACGC

CCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCGACTCAGCTGCTGGCTGGGTGGCCAGCC

AGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCACCTCCGAGGGTGCACCAGGACGGCCCC

AGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGGCCTTGGTGACTCAGGCTCTGAAGGCCA

CAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCTGCAGAGGAGCTGGCAAGGCGGCCTGGA

GAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCGGTCCCCAGCGGAGGATTGACCAGCCGC

CACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTACCCACGACCCTCAAGTGGAACCCTGGC

ATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGCCCAGAGCTGAAGCCCCGAGCCATGCAC

AAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGTCTGGGC

CCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTGCTACAAGACAAGCTACGGATCTCCACC

AAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATCAGGCTCGGCTGGAAGAAGGTGAGGAGC

GGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAGAAGAACTGAAGAAGGATCATGCAGAGA

TGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTGCCAATGCCCGCCTCATGAGTGCCCTCA

CACAGCTGAAAGAGAG CAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTGCCAGAGGCCCTGCTCTGGGAAGACCCTGGCCACTG

ACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTTCAACTTGTGTGTTAGGGTGAAGGAAACTGCCAAAC

TTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACGTGTACCCCAGCACCTGCCCGAGGGACACTCCTCCC

TCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGCCACAAGGCTACCCGATCCCCCACTGTGCCCAGCTC

CCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCAGTCGAGACTTTTAACCCTGTAATAATGTACAGAGA

AGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTATTTAGCTATTTT
Translation
MSAGGNARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARE - UNI24022 - ESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVT GFLSRRLK

GSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNER - UNI16497 - - UNI19310 - - UNI29787 - RSHLMPRLKESRSHESLLSPSSA

VEALDLSMEEEVIIKPVHSSILGQDYCFE - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 -  - UNI16569 -      

- UNI2504 -       
Transcript ENSMUST00000112992
Sequence
GCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCCGCCGGGCGGTCCGGAGCGGCCGATGGGGCCCGTGTGAGCGCCCAGGCCTGGCCCGGTGCCCGGC

GGGCGGCAGCATGTCCGCCGGCGGCAACGCCAGGAAGAGCACCGGGAGGCCATCCTACTACTACCGGCTGCTGCGGCGGCCCCGGCTGCAGCGACAGAGG

AGCCGCTCCCGCAGCCGGACCCGGCCAGCCAGGG - UNI24022 - AGTCGCCCCAAGAAAGGCCGGGCTCCCGGCGGAGCCTTCCCGGCAGCATGTC

AGAGAAAAACCCCAGCATGGAGCCCTCGGCTTCAACCCCGTTCCGGGTCACG GGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAG

CCAGCCCAAACTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCAGCCGCCGCCGCCGCGGACAATGAGAG - UNI16497 -

 - UNI19310 - - UNI29787 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGGAG

GCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UNI1

6497 - - UNI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGAGCGCGATAAGTGGATGG

AGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGTGGGTGATTGAGGCCAAG

GATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGACGGACAATGTCTTCTGGG

GAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAAAAGGAACGCAACAGCTA

CCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACCCCAAGGGTGGCAAAGGC

CCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCACATCACTAACCACTACC

TGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAGAGCACGGGAAAGGTGAA

G GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATCGA

GGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAAAATTGTGAAGTGGACCC

AAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCAACTCCTACTG CGTCTT

CCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCATCAGCGCCTCCCTCTTC

CTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCACCCTCACGCTCATTGCCA

AAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCACGAGTGGACCAACATGC

AGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAGCTCTCTAGCCTGCACTC

CCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATCCTGAGGGATGTCCACAC

AGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCTCTGCTGGGCTTCAGAAG

ATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCC

GGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAGCCTGTCCATGGTGGACC

TCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCGACTCAGCTGCTGGCTGG

GTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCACCTCCGAGGGTGCACCA

GGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGGCCTTGGTGACTCAGGCT

CTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCTGCAGAGGAGCTGGCAAG

GCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCGGTCCCCAGCGGAGGATT

GACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTACCCACGACCCTCAAGTG

GAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGCCCAGAGCTGAAGCCCCG

AGCCATGCACAAGCAG GATCTGGCAGTGCTACAAGACAAGCTACGGATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGA

GACGACGCAGAAGCTGGTGCTGGAGTATCAGGCTCGGCTGGAAGAAGGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGC

ATCATCAGCAG GTTGATGTCAGTGGAAGAAGAACTGAAGAAGGATCATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG

 GAAAAGCGCATTGCCTCGCTGGATGCTGCCAATGCCCGCCTCATGAGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCGTC

TCCCCCACCAACCCCACCAAATTGCAGATTACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGTGGTGGCC

CGGGACAGGGTCTCCGTCAGGAGACTCCCACAGTTGCAGGCTAGCCTGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCACAGTGGCC

CCCCTTCTCTTTGCCCACCTGAACAGTGGGTGTGGGTAGAGGCAGCGGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGAATGTGTC

TCTGGTTGTTGAGTTTGGTATGTGGCACCTTCTCTCTGAGCAGCCAGGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGCAAAGGGC

TCAAGGAAGGTTTAGGGGCCACTGCTGTGGGTTTCCCATGGCCCCCAGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTCTGCCCTG

AGCCCCTGCCACTGCATGCAGCTGGTCAGGGACCCTTCCAGGGGGTGAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTGACACCCT

CCACCCTCCTTCCCTTCCTTCCTTGCATTGCCAAACAGACAGCACTGCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTTCCCACAC

TTCACATGCGGGCCTGGCTCATGCTCTTGGAACTCCAGAAGCCAGAGAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTTCTCCAGG

GTCCCAGTGTGGCCTGCACAGTGGCCCTGTGGGGAGAGGCCAGCCAGTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAAGAATTCT

AAAGCCTGCCGGCCCTGAGAAGGTGGATAACTGTGATTTTTTTTCCTTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAG

GGGCCTTTTAAATTGAGCGAGCGCACTGCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCC

CCGTGTGCAGTCGCCTCTCCTCACCCTCCCAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCC

AGCTCTAGGCTGTTCTGTAGCATATCTGTCCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTC

CCACACTCTAGATTCCAAGCCCTGGTTCTGAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCT

CCTAGAGTCCTCACTAGAAAGCGTGGACATCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACC

CAGTTAGGCTGCAGACCAATGCTGGGAGAGGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTT

CCTGCCCCACTCCTGTCCACACCCCTGCTCCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCC

TTCCACTGCCCAGGGAGCCCTGTTTTCCTCCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGG

TCCCCAGGCCTGGACAGGAGAGCGCAGGGCCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAA

ACTGTAAAAGTGTACAGACTCTCCACAGATTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTG

ACTGTAATGGAACTATTTCACCCAAGGGATGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGC

CTGGAGAACGGTGCTGGGCAGGACAAAGAGCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCT

GTTTGGGTGGAAGGTTGATGGGGGCAAATGCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAG

CAAGGGCTGGAGTTGCCAGAGGCCCTGCTCTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACA

CCTGACCTTTTTGTTCAACTTGTGTGTTAGGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAG

GGCCAGAGCTCAACGTGTACCCCAGCACCTGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTT

TTCTATATACTCGGCCACAAGGCTACCCGATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCG

GAGCCCTTCCCTCCAGTCGAGACTTTTAACCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTT

GCAATTAGAAATATTAAAGATTTATTTAGCT
Translation
MSAGGNARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARE - UNI24022 - ESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVT GFLSRRLK

GSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNER - UNI16497 - - UNI19310 - - UNI29787 - RSHLMPRLKESRSHESLLSPSSA

VEALDLSMEEEVIIKPVHSSILGQDYCFE - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - VTTSSGSKCFSCRSAAERD

KWMENLRRAVHPNK - UNI16569 - DNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR

ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMAS

ALVHILQSTGKVK DFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMC

CELAFCKIINSYC CVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK KFGSK

EEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTALSTPG

SGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSG GLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDAR

TLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHS

SLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLAS

ASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQ DLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISR

 RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAANARLMSALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC
Transcript ENSMUST00000091010
Sequence
GCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCCGCCGGGCGGTCCGGAGCGGCCGATGGGGCCCGTGTGAGCGCCCAGGCCTGGCCCGGTGCCCGGC

GGGCGGCAGCATGTCCGCCGGCGGCAACGCCAGGAAGAGCACCGGGAGGCCATCCTACTACTACCGGCTGCTGCGGCGGCCCCGGCTGCAGCGACAGAGG

AGCCGCTCCCGCAGCCGGACCCGGCCAGCCAGGG - UNI24022 - AGTCGCCCCAAGAAAGGCCGGGCTCCCGGCGGAGCCTTCCCGGCAGCATGTC

AGAGAAAAACCCCAGCATGGAGCCCTCGGCTTCAACCCCGTTCCGGGTCACG GGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAG

CCAGCCCAAACTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCAGCCGCCGCCGCCGCGGACAATGAGAG - UNI16497 -

 - UNI19310 - - UNI29787 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAGCCCCAGCAGCGCAGTGGAG

GCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG - UNI2456 - - UNI1

6497 - - UNI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCTGAGCGCGATAAGTGGATGG

AGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCTGTGGGTGATTGAGGCCAAG

GATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAGACGGACAATGTCTTCTGGG

GAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGAAAAAGGAACGCAACAGCTA

CCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAACCCCAAGGGTGGCAAAGGC

CCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAGCACATCACTAACCACTACC

TGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGCAGAGCACGGGAAAGGTGAA

G GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATCGA

GGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATGAAAATTGTGAAGTGGACCC

AAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCATCAACTCCTACTG CGTCTT

CCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCTCATCAGCGCCTCCCTCTTC

CTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGCACCCTCACGCTCATTGCCA

AAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAGCACGAGTGGACCAACATGC

AGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGGAGCTCTCTAGCCTGCACTC

CCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTATCCTGAGGGATGTCCACAC

AGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGTCTCTGCTGGGCTTCAGAAG

ATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCC

GGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAGAGCCTGTCCATGGTGGACC

TCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTGCGACTCAGCTGCTGGCTGG

GTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGGCACCTCCGAGGGTGCACCA

GGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGTGGCCTTGGTGACTCAGGCT

CTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTGCTGCAGAGGAGCTGGCAAG

GCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGCCGGTCCCCAGCGGAGGATT

GACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAGTACCCACGACCCTCAAGTG

GAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACAGCCCAGAGCTGAAGCCCCG

AGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGA

GGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAGTGCTACAAGACAAGCTACG

GATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTATCAGGCTCGGCTGGAAGAA

GGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGAAGAAGAACTGAAGAAGGAT

CATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGCTGCCAATGCCCGCCTCATG

AGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCGTCTCCCCCACCAACCCCACCAAATTGCAGATTACTGAGAACGGCGAGT

TCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGTGGTGGCCCGGGACAGGGTCTCCGTCAGGAGACTCCCACAGTTGCAGGCTAGCC

TGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCACAGTGGCCCCCCTTCTCTTTGCCCACCTGAACAGTGGGTGTGGGTAGAGGCAGC

GGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGAATGTGTCTCTGGTTGTTGAGTTTGGTATGTGGCACCTTCTCTCTGAGCAGCCA

GGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGCAAAGGGCTCAAGGAAGGTTTAGGGGCCACTGCTGTGGGTTTCCCATGGCCCCC

AGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTCTGCCCTGAGCCCCTGCCACTGCATGCAGCTGGTCAGGGACCCTTCCAGGGGGT

GAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTGACACCCTCCACCCTCCTTCCCTTCCTTCCTTGCATTGCCAAACAGACAGCACT

GCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTTCCCACACTTCACATGCGGGCCTGGCTCATGCTCTTGGAACTCCAGAAGCCAGA

GAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTTCTCCAGGGTCCCAGTGTGGCCTGCACAGTGGCCCTGTGGGGAGAGGCCAGCCA

GTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAAGAATTCTAAAGCCTGCCGGCCCTGAGAAGGTGGATAACTGTGATTTTTTTTCC

TTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTGAGCGAGCGCACTGCATGGGAAATAGCGGCCC

TGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCCTCTCCTCACCCTCCCAGCCCCAGCCAAGGAC

CCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTCTGTAGCATATCTGTCCCTCCCCCCCCCCCCT

TTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTCCAAGCCCTGGTTCTGAGTCACCTAGGGCAGG

AGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACTAGAAAGCGTGGACATCCTGAGGTGTGGCCTA

GCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGACCAATGCTGGGAGAGGGCGTGGCTATCAAGG

GTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTGTCCACACCCCTGCTCCCATGCATTTCAGCAG

GGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGGAGCCCTGTTTTCCTCCTCACCCACACTCTCG

CCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGACAGGAGAGCGCAGGGCCAGATGCAATGGCCCC

CTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTCCACAGATTTTTATCTTAATTGCA

AGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTATTTCACCCAAGGGATGTACATAGTCCTTTAG

TCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCTGGGCAGGACAAAGAGCTTTGCAGTCTAGGTG

TCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGTTGATGGGGGCAAATGCCCCAGTGGGGCCAGT

AAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTGCCAGAGGCCCTGCTCTGGGAAGACCCTGGCC

ACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTTCAACTTGTGTGTTAGGGTGAAGGAAACTGCC

AAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACGTGTACCCCAGCACCTGCCCGAGGGACACTCC

TCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGCCACAAGGCTACCCGATCCCCCACTGTGCCCA

GCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCAGTCGAGACTTTTAACCCTGTAATAATGTACA

GAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTATTTAGCT
Translation
MSAGGNARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARE - UNI24022 - ESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVT GFLSRRLK

GSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNER - UNI16497 - - UNI19310 - - UNI29787 - RSHLMPRLKESRSHESLLSPSSA

VEALDLSMEEEVIIKPVHSSILGQDYCFE - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - VTTSSGSKCFSCRSAAERD

KWMENLRRAVHPNK - UNI16569 - DNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR

ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMAS

ALVHILQSTGKVK DFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALG GEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMC

CELAFCKIINSYC CVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAK KFGSK

EEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQ - UNI2504 - SVVSKLGPLPRILRDVHTALSTPG

SGQLPGTNDLASTPGSGSSSVSAGLQKMVIENDLSG GLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDAR

TLDGEAGSPVGPDALPADGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHS

SLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLAS

ASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQ GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEELSQAEK DLAVLQDKLRIST

KKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISR RLMSVEEELKKDHAEMQAAVDSKQKIIDAQ EKRIASLDAANARLMS

ALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC
Transcript ENSMUST00000112997
Sequence
ATGGAGCCCGACTCCCTCCTGGACCCAGGCGACTCCTACG - UNI24022 - - UNI31931 - AGTCGCCCCAAGAAAGGCCGGGCTCCCGGCGGA

GCCTTCCCGGCAGCATGTCAGAGAAAAACCCCAGCATGGAGCCCTCGGCTTCAACCCCGTTCCGGGTCACG GGCTTCCTCAGCCGCCGCCTCAAGGGCT

CCATCAAGCGCACCAAGAGCCAGCCCAAACTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCAGCCGCCGCCGCCGCGGACAA

TGAGAG - UNI16497 - - UNI19310 - - UNI29787 - GTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTCAG

CCCCAGCAGCGCAGTGGAGGCCCTGGACCTCAGCATGGAGGAGGAGGTGATTATCAAGCCCGTTCACAGCAGCATCCTGGGTCAGGACTACTGCTTCGAG

 - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - GTGACAACATCATCAGGAAGCAAGTGTTTTTCCTGCCGGTCAGCCGCT

GAGCGCGATAAGTGGATGGAGAACCTGAGGCGAGCAGTGCACCCCAACAAG - UNI16569 - GACAACAGCCGGCGTGTGGAGCATATCCTGAAGCT

GTGGGTGATTGAGGCCAAGGATCTGCCGGCCAAGAAGAAGTATCTATGTGAACTGTGCCTGGACGATGTGCTGTATGCCCGTACCACAAGCAAGCTCAAG

ACGGACAATGTCTTCTGGGGAGAGCACTTTGAGTTCCATAACCTGCCGCCTCTACGCACAGTCACTGTGCACCTGTATCGGGAGACTGACAAGAAAAAGA

AAAAGGAACGCAACAGCTACCTGGGCCTGGTGAGCCTGCCTGCCGCCTCTGTGGCTGGGCGGCAGTTTGTGGAGAAGTGGTACCCAGTGGTGACACCCAA

CCCCAAGGGTGGCAAAGGCCCTGGGCCCATGATCCGAATCAAGGCACGCTACCAGACCGTCAGCATCTTGCCTATGGAGATGTACAAGGAGTTTGCGGAG

CACATCACTAACCACTACCTGGGGCTGTGCGCAGCCCTGGAACCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCGTCGGCTCTGGTGCACATCCTGC

AGAGCACGGGAAAGGTGAAG GACTTTCTAACAGACCTGATGATGTCAGAGGTGGACCGCTGTGGGGACAATGAGCACCTCATCTTCCGGGAGAACACAC

TGGCCACCAAGGCCATCGAGGAATACCTCAAACTTGTGGGCCAGAAGTACCTGCAGGACGCACTAG GTGAGTTCATCAAAGCTCTGTATGAGTCAGATG

AAAATTGTGAAGTGGACCCAAGCAAGTGCTCATCCGCTGACCTCCCTGAGCACCAGGGCAACCTCAAGATGTGCTGTGAGCTGGCCTTCTGCAAGATCAT

CAACTCCTACTG CGTCTTCCCACGGGAGCTTAAGGAGGTGTTCGCCTCATGGCGGCAGGAGTGTAGCAGCCGAGGCCGGCCAGATATCAGTGAACGGCT

CATCAGCGCCTCCCTCTTCCTTCGCTTCCTGTGCCCTGCCATCATGTCACCCTCGCTCTTCAACCTGCTTCAGGAGTATCCTGACGACCGCACGGCTCGC

ACCCTCACGCTCATTGCCAAAGTCACCCAGAACCTGGCCAACTTTGCCAA GTTTGGCAGCAAGGAAGAATACATGTCCTTCATGAACCAGTTCCTGGAG

CACGAGTGGACCAACATGCAGCGCTTCCTGTTGGAGATCTCCAACCCCGAGACCCTTTCCAACACAGCAGGCTTCGAGGGCTACATAGACCTGGGCCGGG

AGCTCTCTAGCCTGCACTCCCTGCTCTGGGAAGCTGTCAGCCAGCTTGATCAG - UNI2504 - AGCGTTGTGTCGAAGCTGGGACCTCTGCCTCGTA

TCCTGAGGGATGTCCACACAGCACTGAGCACTCCTGGCAGTGGGCAGCTCCCTGGCACCAATGACCTGGCCTCCACCCCGGGCTCCGGCAGCAGCAGCGT

CTCTGCTGGGCTTCAGAAGATGGTGATTGAAAATGACCTCTCTGG TCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTT

TTTTGTCACAAGGTCCTCCGGGGTCCAGCCTTCACCTGCCCGCAGCTCAAGCTACTCAGAAGCCAATGAACCTGACCTGCAGATGGCCAATGGCAGCAAG

AGCCTGTCCATGGTGGACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGTTCCCCAGTGGGCCCAGACGCCCTACCTGCTGACGGGCAGGTGCCTG

CGACTCAGCTGCTGGCTGGGTGGCCAGCCAGGGCAGCCCCAGTGAGCCTGGCAGGATTGGCCACAGTGCGGCGGGCAGTGCCAACACCAACCACACCAGG

CACCTCCGAGGGTGCACCAGGACGGCCCCAGTTGTTGGCCCCACTTTCCTTCCAGAATCCTGTGTACCAGATGGCGGCCGGCCTGCCACTGTCACCCCGT

GGCCTTGGTGACTCAGGCTCTGAAGGCCACAGCTCCCTGAGCTCTCACAGCAACAGTGAAGAGCTGGCAGCCGCTGCCAAACTAGGAAGTTTCAGCACTG

CTGCAGAGGAGCTGGCAAGGCGGCCTGGAGAACTGGCACGGAGGCAGATGTCACTGACTGAGAAGGGTGGGCAGCCCACAGTGCCGAGGCAAAATAGTGC

CGGTCCCCAGCGGAGGATTGACCAGCCGCCACCGCCACCACCACCACCGCCTCCTGCTCCCCGGGGCAGGACACCTCCTACCCTGCTGAGCACCCTACAG

TACCCACGACCCTCAAGTGGAACCCTGGCATCAGCATCCCCCGACTGGGCTGGCCCTGGCACCCGGCTGCGGCAACAGTCCTCCTCCTCCAAGGGAGACA

GCCCAGAGCTGAAGCCCCGAGCCATGCACAAGCAG GGCCCTTCACCCGTCAGTCCCAATGCCCTGGACCGCACGGCCGCTTGGCTCTTGACCATGAACG

CGCAGTTGTTAGAAGACGAGGGTCTGGGCCCAGATCCCCCCCACAGGGATAGGCTAAGGAGTAAGGAGGAACTCAGCCAAGCAGAAAAG GATCTGGCAG

TGCTACAAGACAAGCTACGGATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTATTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTA

TCAGGCTCGGCTGGAAGAAGGTGAGGAGCGGCTGCGGCGGCAGCAGGAAGACAAGGATATCCAGATGAAAGGCATCATCAGCAG GTTGATGTCAGTGGA

AGAAGAACTGAAGAAGGATCATGCAGAGATGCAAGCAGCTGTAGATTCCAAACAGAAGATCATCGATGCCCAG GAAAAGCGCATTGCCTCGCTGGATGC

TGCCAATGCCCGCCTCATGAGTGCCCTCACACAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCGTCTCCCCCACCAACCCCACCAAATTGCAG

ATTACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGAGGGGGACTGTGGTGGCCCGGGACAGGGTCTCCGTCAGGAGACTC

CCACAGTTGCAGGCTAGCCTGCAGTGGAGGGGGCGTAAGACTGATGGAGCGTGAGACTGAGGGCACAGTGGCCCCCCTTCTCTTTGCCCACCTGAACAGT

GGGTGTGGGTAGAGGCAGCGGAGACTGCACTGGGGAGTGGGGCCAGTCTGCAGGGAGGCCTGCCGAATGTGTCTCTGGTTGTTGAGTTTGGTATGTGGCA

CCTTCTCTCTGAGCAGCCAGGTGCATGTACCCCTCCTTACCCTTTCCCATGGAGGAAGCTACCTGCAAAGGGCTCAAGGAAGGTTTAGGGGCCACTGCTG

TGGGTTTCCCATGGCCCCCAGGACCTGATGGAGTAGTTGACAGGCAGAGTGGCCCCTGTTCATCTCTGCCCTGAGCCCCTGCCACTGCATGCAGCTGGTC

AGGGACCCTTCCAGGGGGTGAGGAACTGAAGAACAGAACCTCGGTCCTATGCCCATCCCAGACGTGACACCCTCCACCCTCCTTCCCTTCCTTCCTTGCA

TTGCCAAACAGACAGCACTGCACTTTCTCTGCTGGGCCCTCATACCCGTGGGAGGAGCCATAGCTTCCCACACTTCACATGCGGGCCTGGCTCATGCTCT

TGGAACTCCAGAAGCCAGAGAGCTGGGCAGAGGTGGCCAGGTTGCACCATGCGTTGTAGCTGCCTTCTCCAGGGTCCCAGTGTGGCCTGCACAGTGGCCC

TGTGGGGAGAGGCCAGCCAGTGCTCACCCTGCAAAGGTGATCTCTCTTCTCTGATAGTTTAAGAAAGAATTCTAAAGCCTGCCGGCCCTGAGAAGGTGGA

TAACTGTGATTTTTTTTCCTTTCACAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAATTGAGCGAGCGCACT

GCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCAGGCCCCGTGTGCAGTCGCCTCTCCTCACCCT

CCCAGCCCCAGCCAAGGACCCAGGCACTGCAGGCAGGGAGGGGCATCCCCCACAGCTGGGGCTGGTTTTCCCCAGCTCTAGGCTGTTCTGTAGCATATCT

GTCCCTCCCCCCCCCCCCTTTGTGGGACAGAGAAGGGCAGGAGCTTGGGTCTTTCTTGGGTCCCCATCTGTTCCCACACTCTAGATTCCAAGCCCTGGTT

CTGAGTCACCTAGGGCAGGAGCTAGGCTTTGCCCAGGCAGCAGAATGGGGCTAGGCAAGCTGCACTTAATGCTCCTAGAGTCCTCACTAGAAAGCGTGGA

CATCCTGAGGTGTGGCCTAGCTAGGCTGCGCCCTGTCCTCAGTCCACGATGGACAGGCAAGGGTAAAAGAACCCAGTTAGGCTGCAGACCAATGCTGGGA

GAGGGCGTGGCTATCAAGGGTCAGAGACCTCAGGAAGGAAGGAGGTGGGGCTGAGGGCCTGCCACTGCCTCTTCCTGCCCCACTCCTGTCCACACCCCTG

CTCCCATGCATTTCAGCAGGGGTGGCCTCTTGGGCAGGGCCTGGCCTGGCCTGGCCTGGCCTGGGTCTTGCCCTTCCACTGCCCAGGGAGCCCTGTTTTC

CTCCTCACCCACACTCTCGCCCATGCCTCGTAAAGTGACCTCTGTCTGAGCGCCTCCTAGCAATATGGGGAGGTCCCCAGGCCTGGACAGGAGAGCGCAG

GGCCAGATGCAATGGCCCCCTCTGGTGGGGTTGTTAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTCCACA

GATTTTTATCTTAATTGCAAGTCTGCAATATTTTTTTTGTAAATTTTTTTTTTGTAAATGTTCTTGGTGTTTGACTGTAATGGAACTATTTCACCCAAGG

GATGTACATAGTCCTTTAGTCCTGGTGCTGCGAGGGCTGGCCAGGACACTGCTCTCACGGTTGATATTAGAGCCTGGAGAACGGTGCTGGGCAGGACAAA

GAGCTTTGCAGTCTAGGTGTCTGTCTGTCTGTTTCCTGCCCGGGGCATTGATTCGTTGGCTTTCAAGCATGCTGTTTGGGTGGAAGGTTGATGGGGGCAA

ATGCCCCAGTGGGGCCAGTAAAGCATCCTCCTGCCCACAGCAACGGCTTGGGGCGTCTGAGCTCTGCTTACAGCAAGGGCTGGAGTTGCCAGAGGCCCTG

CTCTGGGAAGACCCTGGCCACTGACACCCAAGATCTGATGGAGAGAGCGGCCCCACCCTTGCCAACACAGACACCTGACCTTTTTGTTCAACTTGTGTGT

TAGGGTGAAGGAAACTGCCAAACTTCCTCTGAGTGAAGACCTCTGACTGCCCAGGAGTAGGGGTGGGGACCAGGGCCAGAGCTCAACGTGTACCCCAGCA

CCTGCCCGAGGGACACTCCTCCCTCATACTCATAGGTCTGGGAGCCAGACTGTCCAGGGAACCAGCCCCTCTTTTCTATATACTCGGCCACAAGGCTACC

CGATCCCCCACTGTGCCCAGCTCCCCCTTTTGTAAGTATGTGAAAAGGAAAAATGCAAAGGTTGGATCGGCCGGAGCCCTTCCCTCCAGTCGAGACTTTT

AACCCTGTAATAATGTACAGAGAAGTTGTTGGTGTTCGAAGACTCCGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTATTT

AGCTATTTT
Translation
MEPDSLLDPGDSYE - UNI24022 - - UNI31931 - ESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVT GFLSRRLKGSIKRTKSQPKLDRN

HSFRHILPGFRSAAAAAADNER - UNI16497 - - UNI19310 - - UNI29787 - RSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVIIK

PVHSSILGQDYCFE - UNI2456 - - UNI16497 - - UNI16569 - - UNI19310 - VTTSSGSKCFSCRSAAERDKWMENLRRAVHPNK 

- UNI16569 - DNSRRVEHILKLWVIEAKDLPAKKKYLCEL     - UNI2504 -      

For any suggestions or comments, please send an email to unitrap@crg.es