Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026917 (Wdr5)
Chromosomal location
Chr 2: 27370726 - 27392053 (+)
Description
WD repeat domain 5 Gene [Source:MGI (curated);Acc:Wdr5-001]
RefSeq_peptide
NP_543124.1 
UniGene
Mm.28265 Mm.473222 
MGI
MGI:2155884 
Uniprot/SWISSPROT
P61965 
Uniprot/SPTREMBL
A2AKB1 Q3UNQ3 A2AKB2 
Human Ortholog
ENSG00000196363 (WDR5)
Omim not available
UniTrap UNI2641
Vector Insertion
Chr 2: 27370801 - 27374148
Public Clones DD0718 (sanger) (sanger) D161G04 (ggtc) D039A05 (ggtc) D027G03 (ggtc)
P093G10 (ggtc) D139H07 (ggtc) PST11190-NR (escells) PST8700-NR (escells)
PST10206-NR (escells) PST22077-NR (escells) IST14192B4 (tigm) IST13570H4 (tigm)
Private Clones OST319789 (lexicon) OST309030 (lexicon) OST252639 (lexicon) OST218629 (lexicon)
OST168806 (lexicon) OST150578 (lexicon) OST65981 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19561
Vector Insertion
Chr 2: 27374313 - 27374868
Public Clones not available
Private Clones OST388905 (lexicon) OST243069 (lexicon) OST208615 (lexicon) OST109703 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24249
Vector Insertion
Chr 2: 27374978 - 27375262
Public Clones not available
Private Clones OST227071 (lexicon) OST222041 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29872
Vector Insertion
Chr 2: 27375337 - 27375846
Public Clones E040E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17765
Vector Insertion
Chr 2: 27389376 - 27390276
Public Clones not available
Private Clones OST436755 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113952
Sequence
GATCGTCTGCTCTCGCGCGTAGGGCTAGCCGACGCGACGCCAGAGCGCCCGGCCCCGCCGCCGCGGCCCCGGCAG - UNI2641 - GCCCCTTACTAT

AGAGTTCAGCTGACAGCCTCTTCCATTGTGACTCCCCCTTCACGGTGTCCTGCCCTGTGGGCTTCAGAGCCATGGCCACAGAGGAGAAGAAGCCAGAGAC

AGAGGCTGCAAGAGCACAGCCCACTCCTTCCTCATCAGCCACACAGAGCAAG - UNI19561 - CCCACACCAGTTAAGCCAAACTATGCCCTGAAGT

TCACCCTGGCTGGCCACACCAAAGCTGTGTCCTCTGTGAAGTTCAGCCCCAATGGGGAATGGTTGGCAAGTTCAT - UNI24249 - CTGCTGATAAA

CTCATTAAAATTTGGGGAGCATATGATGGAAAGTTTGAGAAAACTATATCTGGTCACAAACTG - UNI29872 - GGAATATCTGATGTAGCGTGGTC

ATCAGATTCTAACCTCCTTGTGTCTGCCTCTGATGATAAAACTTTGAAGATTTGGGACGTGAGTTCC GGGAAGTGTCTGAAGACCCTGAAGGGCCACAG

TAACTACGTCTTCTGCTGCAACTTCAACCCCCAGTCCAACCTCATCGTCTCAGGGTCT TTTGATGAAAGTGTGAGGATATGGGACGTGAAGACAGGGAA

GTGCCTCAAGACTTTGCCTGCCCATTCGGACCCAGTCTCAGCC GTTCATTTCAACCGTGATGGATCATTGATTGTTTCCAGTAGCTATGATGGCCTCTG

 CCGAATCTGGGACACCGCCTCTGGCCAGTGTCTGAAGACACTCATTG ATGATGACAATCCTCCAGTGTCCTTCGTGAAGTTCTCTCCAAATGGCAAAT

ACATCCTGGCTGCAACTTTGGACAA CACACTGAAGCTCTGGGACTACAGCAAGGGGAAG TGCCTGAAGACATACACTGGCCACAAGAATGAGAAGTAC

TGCATATTTGCCAACTTCTCCGTGACAGGCGGGAAG TGGATTGTGTCTGGTTCTGAAGATAACCTGGTGTATATCTGGAATCTGCAGACCAAGGAGATT

GTGCAGAAGTTGCAGGGTCACACAG - UNI17765 - ATGTTGTGATTTCCACGGCTTGTCACCCGACAGAGAACATCATTGCCTCAGCAGCGTTAGA

GAACGACAAAACAATCAAACTGTGGAAGAGTGACTGCTAAGTCCTGGCTCCATGGGAGACTTAAGGAAGCCACCCGGATTGGCAAGAAACACATGTGGGG

CAGAGGCATGGGGCCAGGCTGGGTTGACAGGCCTGGTGCACCTCCTATCTGAAGATGTCGGCTCAGGGGAGTGCACACTACCGAGTCTTGATAGCCACTG

TGATATTTCTTGCCAATTCTGTCTCTGCCTGGGGAAGTTCCTGGTCTGTTCTGTGCTCAGAGGCAACAAATTTTTAATTTTTTTATTACAAGAGTGAGTT

CAGCTCCTCATGGGTTGTTTTTCTCTGTGGTTGTTGTTTTGGTATTGTATTGCCCAGTGCACACTGGAACAGGACCTACAGCCCTACTCCCATTCCCTGC

CTCCTGCCCTGGCCTGCTTGTTCAATTTTCCTGCCTGTAATAGTACCCAGCGTGCTTCCATGAGTTTCTGGAAACACAGAAAGGTTGTAAGTTGTATCCG

TGTCAAGTCCCTTTGTTCTTTTGGAGTTCATAGGTCAACACTGACCTCTCAGTGGTTGAAATGTCTCCTTGTCTCACTGGTATCACTCAGTAAGCTACAC

ACACTGTAATAAAAGGTGGGTATGGACTGGGTGTGGCCCTGAGTTCTGACCAGGCTCTTTGACACCTGGCTTTATAAAGCCCTCCTCCCTTCCTGGCAGG

AGTTGGAAAGGTCTCTGGGAGGATGGATCCTTGTTGTGCCTCTTCTTCCCAGTGGCTGCTGTGGGTGCTGAGTGTTGGAGAGGAAGAACCTCAGATGAGA

AAGAGTGGAAGGAAGTCTTGGAAAGGCACCATGTAGTGAGGTTCTGGACCTCTTTATTCTGTGAGAGGCTCAGGGTCACCTGTGCAGGAGGGAGGAGTTC

AATATGGTGCTTGCCCCAGCAGGTACAGCTTCCTGCCTTGGCCTCTAAACCCACCAAACCTCTCTTATGTCCTTGGCCCCCGCCCCAGGTCACCGCCTCA

GGTGACCAGGACTGGAAAGAGGTAGTGGCCAAGCTCAGGACTACACAGCATTTTCACAACTGCTGCTGGCTGAACCCAGGGTGACCTACTGTGGAGCAGA

CTGCAGAGGTTCTGGGAGTACAGATGGGTGGCGGAGGCTGCTGGGCACAGACATGGGTGGAAAGGAGATTCTGGGTTTGCTCTGGTTGCAGCAGCAACCA

TCTGTGAGGCCAACACTGATGTGTATTGAAGCCACATCACCCAGGGCAGTAGCTGCTCTACTCTGCCTTTGCCAAGGCTTGTCCCCAGCTGTGGTCCTGA

CAGCCCTTTCTCCCTCCATCGTGCATAATAAGAATCCAAAGGTATTGGAAAAGAAACCCCATACATTGTCACTTCCTTGAGGGAGATGGTGTGTAAATGG

GCTATCACATCGAAGAAGCCATTGTTAAAGAGGGTGGCTTGTCACACTGACATGGGCTCTGGGGCCCCTGGCGTCTGTTGGATAGATGAACCTGGGTTCT

GGTCAATGTTGTGGGCATGTTGCTGGGGTTTCTGGAGGGTAGTAAGGTCCTTCCAGCTGTGGCCTGGTGTGCGGCCTCCTCCTGAGGGAGGGAGCTTGCT

TGCCATGTCGAGCACAGTATCCCCGAGTATAGTTTATTTTTTCTACAGTTGAACTCTGTTGTAGATTTATGTAAAAATACATTCTCTTTTTAAAAATAAA

GATTTTCATGCCTTGT
Translation
 - UNI2641 - MATEEKKPETEAARAQPTPSSSATQSK - UNI19561 - PTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSS - UNI242

49 - SADKLIKIWGAYDGKFEKTISGHKL - UNI29872 - GISDVAWSSDSNLLVSASDDKTLKIWDVSS GKCLKTLKGHSNYVFCCNFNPQSNL

IVSGS FDESVRIWDVKTGKCLKTLPAHSDPVSA VHFNRDGSLIVSSSYDGLC CRIWDTASGQCLKTLID DDDNPPVSFVKFSPNGKYILAATLDN 

NTLKLWDYSKGK CLKTYTGHKNEKYCIFANFSVTGGK WIVSGSEDNLVYIWNLQTKEIVQKLQGHTD - UNI17765 - DVVISTACHPTENIIAS

AALENDKTIKLWKSDC
Transcript ENSMUST00000113953
Sequence
GATCGTCTGCTCTCGCGCGTAGGGCTAGCCGACGCGACGCCAGAGCGCCCGGCCCCGCCGCCGCGGCCCCGGCAG - UNI2641 - GCCCCTTACTAT

AGAGTTCAGCTGACAGCCTCTTCCATTGTGACTCCCCCTTCACGGTGTCCTGCCCTGTGGGCTTCAGAGCCATGGCCACAGAGGAGAAGAAGCCAGAGAC

AGAGGCTGCAAGAGCACAGCCCACTCCTTCCTCATCAGCCACACAGAGCAAG - UNI19561 - CCCACACCAGTTAAGCCAAACTATGCCCTGAAGT

TCACCCTGGCTGGCCACACCAAAGCTGTGTCCTCTGTGAAGTTCAGCCCCAATGGGGAATGGTTGGCAAGTTCAT - UNI24249 - CTGCTGATAAA

CTCATTAAAATTTGGGGAGCATATGATGGAAAGTTTGAGAAAACTATATCTGGTCACAAACTG - UNI29872 - GGAATATCTGATGTAGCGTGGTC

ATCAGATTCTAACCTCCTTGTGTCTGCCTCTGATGATAAAACTTTGAAGATTTGGGACGTGAGTTCC GGGAAGTGTCTGAAGACCCTGAAGGGCCACAG

TAACTACGTCTTCTGCTGCAACTTCAACCCCCAGTCCAACCTCATCGTCTCAGGGTCT TTTGATGAAAGTGTGAGGATATGGGACGTGAAGACAGGGAA

GTGCCTCAAGACTTTGCCTGCCCATTCGGACCCAGTCTCAGCC GTTCATTTCAACCGTGATGGATCATTGATTGTTTCCAGTAGCTATGATGGCCTCTG

 CCGAATCTGGGACACCGCCTCTGGCCAGTGTCTGAAGACACTCATTG TGTTTGTGACCAGTCACGAGAAACGGAGCCCCCTGCGAACCCCCTGTG AT

GATGACAATCCTCCAGTGTCCTTCGTGAAGTTCTCTCCAAATGGCAAATACATCCTGGCTGCAACTTTGGACAA CACACTGAAGCTCTGGGACTACAGC

AAGGGGAAG TGCCTGAAGACATACACTGGCCACAAGAATGAGAAGTACTGCATATTTGCCAACTTCTCCGTGACAGGCGGGAAG TGGATTGTGTCTGG

TTCTGAAGATAACCTGGTGTATATCTGGAATCTGCAGACCAAGGAGATTGTGCAGAAGTTGCAGGGTCACACAG - UNI17765 - ATGTTGTGATTT

CCACGGCTTGTCACCCGACAGAGAACATCATTGCCTCAGCAGCGTTAGAGAACGACAAAACAATCAAACTGTGGAAGAGTGACTGCTAAGTCCTGGCTCC

ATGGGAGACTTAAGGAAGCCACCCGGATTGGCAAGAAACACATGTGGGGCAGAGGCATGGGGCCAGGCTGGGTTGACAGGCCTGGTGCACCTCCTATCTG

AAGATGTCGGCTCAGGGGAGTGCACACTACCGAGTCTTGATAGCCACTGTGATATTTCTTGCCAATTCTGTCTCTGCCTGGGGAAGTTCCTGGTCTGTTC

TGTGCTCAGAGGCAACAAATTTTTAATTTTTTTATTACAAGAGTGAGTTCAGCTCCTCATGGGTTGTTTTTCTCTGTGGTTGTTGTTTTGGTATTGTATT

GCCCAGTGCACACTGGAACAGGACCTACAGCCCTACTCCCATTCCCTGCCTCCTGCCCTGGCCTGCTTGTTCAATTTTCCTGCCTGTAATAGTACCCAGC

GTGCTTCCATGAGTTTCTGGAAACACAGAAAGGTTGTAAGTTGTATCCGTGTCAAGTCCCTTTGTTCTTTTGGAGTTCATAGGTCAACACTGACCTCTCA

GTGGTTGAAATGTCTCCTTGTCTCACTGGTATCACTCAGTAAGCTACACACACTGTAATAAAAGGTGGGTATGGACTGGGTGTGGCCCTGAGTTCTGACC

AGGCTCTTTGACACCTGGCTTTATAAAGCCCTCCTCCCTTCCTGGCAGGAGTTGGAAAGGTCTCTGGGAGGATGGATCCTTGTTGTGCCTCTTCTTCCCA

GTGGCTGCTGTGGGTGCTGAGTGTTGGAGAGGAAGAACCTCAGATGAGAAAGAGTGGAAGGAAGTCTTGGAAAGGCACCATGTAGTGAGGTTCTGGACCT

CTTTATTCTGTGAGAGGCTCAGGGTCACCTGTGCAGGAGGGAGGAGTTCAATATGGTGCTTGCCCCAGCAGGTACAGCTTCCTGCCTTGGCCTCTAAACC

CACCAAACCTCTCTTATGTCCTTGGCCCCCGCCCCAGGTCACCGCCTCAGGTGACCAGGACTGGAAAGAGGTAGTGGCCAAGCTCAGGACTACACAGCAT

TTTCACAACTGCTGCTGGCTGAACCCAGGGTGACCTACTGTGGAGCAGACTGCAGAGGTTCTGGGAGTACAGATGGGTGGCGGAGGCTGCTGGGCACAGA

CATGGGTGGAAAGGAGATTCTGGGTTTGCTCTGGTTGCAGCAGCAACCATCTGTGAGGCCAACACTGATGTGTATTGAAGCCACATCACCCAGGGCAGTA

GCTGCTCTACTCTGCCTTTGCCAAGGCTTGTCCCCAGCTGTGGTCCTGACAGCCCTTTCTCCCTCCATCGTGCATAATAAGAATCCAAAGGTATTGGAAA

AGAAACCCCATACATTGTCACTTCCTTGAGGGAGATGGTGTGTAAATGGGCTATCACATCGAAGAAGCCATTGTTAAAGAGGGTGGCTTGTCACACTGAC

ATGGGCTCTGGGGCCCCTGGCGTCTGTTGGATAGATGAACCTGGGTTCTGGTCAATGTTGTGGGCATGTTGCTGGGGTTTCTGGAGGGTAGTAAGGTCCT

TCCAGCTGTGGCCTGGTGTGCGGCCTCCTCCTGAGGGAGGGAGCTTGCTTGCCATGTCGAGCACAGTATCCCCGAGTATAGTTTATTTTTTCTACAGTTG

AACTCTGTTGTAGATTTATGTAAAAATACATTCTCTTTTTAAAAATAAAGATTTTCATGCCTTGT
Translation
 - UNI2641 - MATEEKKPETEAARAQPTPSSSATQSK - UNI19561 - PTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSS - UNI242

49 - SADKLIKIWGAYDGKFEKTISGHKL - UNI29872 - GISDVAWSSDSNLLVSASDDKTLKIWDVSS GKCLKTLKGHSNYVFCCNFNPQSNL

IVSGS FDESVRIWDVKTGKCLKTLPAHSDPVSA VHFNRDGSLIVSSSYDGLC CRIWDTASGQCLKTLIV VFVTSHEKRSPLRTPCD DDDNPPVSF

VKFSPNGKYILAATLDN NTLKLWDYSKGK CLKTYTGHKNEKYCIFANFSVTGGK WIVSGSEDNLVYIWNLQTKEIVQKLQGHTD - UNI17765 -

 DVVISTACHPTENIIASAALENDKTIKLWKSDC

For any suggestions or comments, please send an email to unitrap@crg.es