Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026921 (Egfl7)
Chromosomal location
Chr 2: 26436576 - 26448202 (+)
Description
EGF-like domain 7 Gene [Source:MGI (curated);Acc:Egfl7-001]
RefSeq_dna
NM_198725 NM_178444 NM_198724 
RefSeq_peptide
NP_848538.2 NP_942017.1 NP_942018.1 
UniGene
Mm.268933 
MGI
MGI:2449923 
Uniprot/SWISSPROT
Q9QXT5 
Uniprot/SPTREMBL
A2AI25 A2BHS5 A2BHS6 A2BHS7 A2AI26 Q3UTJ7 
Human Ortholog
ENSG00000172889 (EGFL7)
Omim not available
UniTrap UNI17594
Vector Insertion
Chr 2: 26444564 - 26444690
Public Clones not available
Private Clones OST440039 (lexicon) OST248234 (lexicon) OST80956 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24570
Vector Insertion
Chr 2: 26444967 - 26445899
Public Clones not available
Private Clones OST214689 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25267
Vector Insertion
Chr 2: 26446016 - 26446176
Public Clones not available
Private Clones OST189793 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000080087
Sequence
ATATGCCTGGGCCTGCTGCCCGTCGGCCTTGCACTGTTCGAGATGCCCATGTAGGGCTCTGCCGGGACCTGGGTCTTCCCTCTCCTGGAGCTGCAGAGGC

CAGAAGTTCAGTGGTGAGGGGTCCAAGGAGAGTCCGGGGAGACCAGGGAGGCTCTGTCCATCCCCTGTCCCTGTCCCTGTGGGAAG CCCCCGGCAGCAG

CAAGACGCTGGCTGTTCCACCTGCCCACAAGAACAGCCACCACCAGTACCCAGGGGATGACTAGCGGCCGGACCACAG - UNI17594 - GCCACAAA

AAGAAGAAGGCTACCCCACTTACAGATGCAGACCATGTGGGGCTCCGGAGAACTGCTTGTAGCATGGTTTCTAGTGTTGGCAGCAGATGGTACTACTGAG

CATGTCTACAGACCCAG - UNI17594 - CCGTAGAGTGTGTACTGTGGGGATTTCCGGAGGTTCCATCTCGGAGACCTTTGTGCAGCGTGTATACCA

GCCTTACCTCACCACTTGCGACGGACACAGAGCCTGCAGCACCTACCG - UNI24570 - AACCATCTACCGGACTGCCTATCGCCGTAGCCCTGGGG

TGACTCCCGCAAGGCCTCGCTATGCTTGCTGCCCTGGTTGGAAGAGGACCAGTGGGCTCCCTGGGGCTTGTGGAGCAG - UNI25267 - CAATATGC

CAGCCTCCATGTGGGAATGGAGGGAGTTGCATCCGCCCAGGACACTGCCGCTGCCCTGTGGGATGGCAGGGAGATACTTGCCAGACAG ATGTTGATGAA

TGCAGTACAGGAGAGGCCAGTTGTCCCCAGCGCTGTGTCAATACTGTGGGAAGTTACTGGTGCCAGGGATGGGAGGGACAAAGCCCATCTGCAGATGGGA

CGCGCTGCCTGTCTAAGGAGGGGCCCTCCCCGGTGGCCCCAAACCCCACAGCAG GAGTGGACAGCATGGCGAGAGAGGAGGTGTACAGGCTGCAGGCTC

GGGTTGATGTGCTAGAACAG AAACTGCAGTTGGTGCTGGCCCCACTGCACAGCCTGGCCTCTCGGTCCACAGAGCATGGGCTACAAGATCCTGGCAGCC

TGCTGGCCCATTCCTTCCAGCAGCTGGACCGAATTGATTCACTGAGTGAGCAGGTGTCCTTCTTGGAGGAACATCTGGGGTCCT GCTCCTGCAAAAAAG

ATCTGTGATAACCTCTCACCACCCAGGCTGGATAGAGCAGTCATCCCTAGATCCCTTGTAGCCAGAGTTCAGGCGCTGTCTGGTGGTGCCTATGAGCAGA

AGGCCCTGCCTCATTGTCCCTCTTTCTTAGGAGGTTCCTAGGACTTGGGCATGGGGAGTGGGGTCTTGTGTGACTCTTCAGTGGGGCTCCCTGTCTAAGT

GGTAAGGTGGGGATTGTCTCCATCTTTGTCATAATAAAGCTGAGACTTGA
Translation
  - UNI17594 - MWGSGELLVAWFLVLAADGTTEHVYRPS - UNI17594 - SRRVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYR - 

UNI24570 - RTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPGACGAA - UNI25267 - AICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTD D

VDECSTGEASCPQRCVNTVGSYWCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAG GVDSMAREEVYRLQARVDVLEQ KLQLVLAPLHSLASRSTEHGL

QDPGSLLAHSFQQLDRIDSLSEQVSFLEEHLGSC CSCKKDL
Transcript ENSMUST00000100290
Sequence
GCCTCTGTGCACTGGCAGGCTGCTGTGCAGTCCACGAGGAAGGCTTCGGTCGACAGGACAGGCGTGCAGACTTCAGGAGGGACCCTGGGCAGCAGACATT

CCCTGGAAGGGCAGGTTGCATTGCATGGTTGGCTCATGGAGGCAGCAGAGGTGGCCTCAGCCAGGCCTGGGCAGCATCAG CCCCCGGCAGCAGCAAGAC

GCTGGCTGTTCCACCTGCCCACAAGAACAGCCACCACCAGTACCCAGGGGATGACTAGCGGCCGGACCACAG - UNI17594 - GCCACAAAAAGAAG

AAGGCTACCCCACTTACAGATGCAGACCATGTGGGGCTCCGGAGAACTGCTTGTAGCATGGTTTCTAGTGTTGGCAGCAGATGGTACTACTGAGCATGTC

TACAGACCCAG - UNI17594 - CCGTAGAGTGTGTACTGTGGGGATTTCCGGAGGTTCCATCTCGGAGACCTTTGTGCAGCGTGTATACCAGCCTTA

CCTCACCACTTGCGACGGACACAGAGCCTGCAGCACCTACCG - UNI24570 - AACCATCTACCGGACTGCCTATCGCCGTAGCCCTGGGGTGACTC

CCGCAAGGCCTCGCTATGCTTGCTGCCCTGGTTGGAAGAGGACCAGTGGGCTCCCTGGGGCTTGTGGAGCAG - UNI25267 - CAATATGCCAGCCT

CCATGTGGGAATGGAGGGAGTTGCATCCGCCCAGGACACTGCCGCTGCCCTGTGGGATGGCAGGGAGATACTTGCCAGACAG ATGTTGATGAATGCAGT

ACAGGAGAGGCCAGTTGTCCCCAGCGCTGTGTCAATACTGTGGGAAGTTACTGGTGCCAGGGATGGGAGGGACAAAGCCCATCTGCAGATGGGACGCGCT

GCCTGTCTAAGGAGGGGCCCTCCCCGGTGGCCCCAAACCCCACAGCAG GAGTGGACAGCATGGCGAGAGAGGAGGTGTACAGGCTGCAGGCTCGGGTTG

ATGTGCTAGAACAG AAACTGCAGTTGGTGCTGGCCCCACTGCACAGCCTGGCCTCTCGGTCCACAGAGCATGGGCTACAAGATCCTGGCAGCCTGCTGG

CCCATTCCTTCCAGCAGCTGGACCGAATTGATTCACTGA GCTCCTGCAAAAAAGATCTGTGATAACCTCTCACCACCCAGGCTGGATAGAGCAGTCATC

CCTAGATCCCTTGTAGCCAGAGTTCAGGCGCTGTCTGGTGGTGCCTATGAGCAGAAGGCCCTGCCTCATTGTCCCTCTTTCTTAGGAGGTTCCTAGGACT

TGGGCATGGGGAGTGGGGTCTTGTGTGACTCTTCAGTGGGGCTCCCTGTCTAAGTGGTAAGGTGGGGATTGTCTCCATCTTTGTCATAATAAAGCTGAGA

CTTG
Translation
  - UNI17594 - MWGSGELLVAWFLVLAADGTTEHVYRPS - UNI17594 - SRRVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYR - 

UNI24570 - RTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPGACGAA - UNI25267 - AICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTD D

VDECSTGEASCPQRCVNTVGSYWCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAG GVDSMAREEVYRLQARVDVLEQ KLQLVLAPLHSLASRSTEHGL

QDPGSLLAHSFQQLDRIDSLS SSCKKDL
Transcript ENSMUST00000102907
Sequence
GCCTCTGTGCACTGGCAGGCTGCTGTGCAGTCCACGAGGAAGGCTTCGGTCGACAGGACAGGCGTGCAGACTTCAGGAGGGACCCTGGGCAGCAGACATT

CCCTGGAAGGGCAGGTTGCATTGCATGGTTGGCTCATGGAGGCAGCAGAGGTGGCCTCAGCCAGGCCTGGGCAGCATCAG CCCCCGGCAGCAGCAAGAC

GCTGGCTGTTCCACCTGCCCACAAGAACAGCCACCACCAGTACCCAGGGGATGACTAGCGGCCGGACCACAG - UNI17594 - GCCACAAAAAGAAG

AAGGCTACCCCACTTACAGATGCAGACCATGTGGGGCTCCGGAGAACTGCTTGTAGCATGGTTTCTAGTGTTGGCAGCAGATGGTACTACTGAGCATGTC

TACAGACCCAG - UNI17594 - CCGTAGAGTGTGTACTGTGGGGATTTCCGGAGGTTCCATCTCGGAGACCTTTGTGCAGCGTGTATACCAGCCTTA

CCTCACCACTTGCGACGGACACAGAGCCTGCAGCACCTACCG - UNI24570 - AACCATCTACCGGACTGCCTATCGCCGTAGCCCTGGGGTGACTC

CCGCAAGGCCTCGCTATGCTTGCTGCCCTGGTTGGAAGAGGACCAGTGGGCTCCCTGGGGCTTGTGGAGCAG - UNI25267 - CAATATGCCAGCCT

CCATGTGGGAATGGAGGGAGTTGCATCCGCCCAGGACACTGCCGCTGCCCTGTGGGATGGCAGGGAGATACTTGCCAGACAG ATGTTGATGAATGCAGT

ACAGGAGAGGCCAGTTGTCCCCAGCGCTGTGTCAATACTGTGGGAAGTTACTGGTGCCAGGGATGGGAGGGACAAAGCCCATCTGCAGATGGGACGCGCT

GCCTGTCTAAGGAGGGGCCCTCCCCGGTGGCCCCAAACCCCACAGCAG GAGTGGACAGCATGGCGAGAGAGGAGGTGTACAGGCTGCAGGCTCGGGTTG

ATGTGCTAGAACAG AAACTGCAGTTGGTGCTGGCCCCACTGCACAGCCTGGCCTCTCGGTCCACAGAGCATGGGCTACAAGATCCTGGCAGCCTGCTGG

CCCATTCCTTCCAGCAGCTGGACCGAATTGATTCACTGAGTGAGCAGGTGTCCTTCTTGGAGGAACATCTGGGGTCCT GCTCCTGCAAAAAAGATCTGT

GATAACCTCTCACCACCCAGGCTGGATAGAGCAGTCATCCCTAGATCCCTTGTAGCCAGAGTTCAGGCGCTGTCTGGTGGTGCCTATGAGCAGAAGGCCC

TGCCTCATTGTCCCTCTTTCTTAGGAGGTTCCTAGGACTTGGGCATGGGGAGTGGGGTCTTGTGTGACTCTTCAGTGGGGCTCCCTGTCTAAGTGGTAAG

GTGGGGATTGTCTCCATCTTTGTCATAATAAAGCTGAGACTTG
Translation
  - UNI17594 - MWGSGELLVAWFLVLAADGTTEHVYRPS - UNI17594 - SRRVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYR - 

UNI24570 - RTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPGACGAA - UNI25267 - AICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTD D

VDECSTGEASCPQRCVNTVGSYWCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAG GVDSMAREEVYRLQARVDVLEQ KLQLVLAPLHSLASRSTEHGL

QDPGSLLAHSFQQLDRIDSLSEQVSFLEEHLGSC CSCKKDL
Transcript ENSMUST00000102906
Sequence
GCCTCTGTGCACTGGCAGGCTGCTGTGCAGTCCACGAGGAAGGCTTCGGTCGACAGGACAGGCGTGCAGACTTCAGGAGGGACCCTGGGCAGCAGACATT

CCCTGGAAGGGCAGGTTGCATTGCATGGTTGGCTCATGGAGGCAGCAGAGGTGGCCTCAGCCAGGCCTGGGCAGCATCAG CCCCCGGCAGCAGCAAGAC

GCTGGCTGTTCCACCTGCCCACAAGAACAGCCACCACCAGTACCCAGGGGATGACTAGCGGCCGGACCACAG - UNI17594 - GCCACAAAAAGAAG

AAGGCTACCCCACTTACAGATGCAGACCATGTGGGGCTCCGGAGAACTGCTTGTAGCATGGTTTCTAGTGTTGGCAGCAGATGGTACTACTGAGCATGTC

TACAGACCCAG - UNI17594 - CCGTAGAGTGTGTACTGTGGGGATTTCCGGAGGTTCCATCTCGGAGACCTTTGTGCAGCGTGTATACCAGCCTTA

CCTCACCACTTGCGACGGACACAGAGCCTGCAGCACCTACCG - UNI24570 - AACCATCTACCGGACTGCCTATCGCCGTAGCCCTGGGGTGACTC

CCGCAAGGCCTCGCTATGCTTGCTGCCCTGGTTGGAAGAGGACCAGTGGGCTCCCTGGGGCTTGTGGAGCAG - UNI25267 - CAATATGCCAGCCT

CCATGTGGGAATGGAGGGAGTTGCATCCGCCCAGGACACTGCCGCTGCCCTGTGGGATGGCAGGGAGATACTTGCCAGACAG ATGTTGATGAATGCAGT

ACAGGAGAGGCCAGTTGTCCCCAGCGCTGTGTCAATACTGTGGGAAGTTACTGGTGCCAGGGATGGGAGGGACAAAGCCCATCTGCAGATGGGACGCGCT

GCCTGTCTAAGGAGGGGCCCTCCCCGGTGGCCCCAAACCCCACAGCAG GAGTGGACAGCATGGCGAGAGAGGAGGTGTACAGGCTGCAGGCTCGGGTTG

ATGTGCTAGAACAG AAACTGCAGTTGGTGCTGGCCCCACTGCACAGCCTGGCCTCTCGGTCCACAGAGCATGGGCTACAAGATCCTGGCAGCCTGCTGG

CCCATTCCTTCCAGCAGCTGGACCGAATTGATTCACTGAGTGAGCAGGTGTCCTTCTTGGAGGAACATCTGGGGTCCT GCTCCTGCAAAAAAGATCTGT

GATAACCTCTCACCACCCAGGCTGGATAGAGCAGTCATCCCTAGATCCCTTGTAGCCAGAGTTCAGGCGCTGTCTGGTGGTGCCTATGAGCAGAAGGCCC

TGCCTCATTGTCCCTCTTTCTTAGGAGGTTCCTAGGACTTGGGCATGGGGAGTGGGGTCTTGTGTGACTCTTCAGTGGGGCTCCCTGTCTAAGTGGTAAG

GTGGGGATTGTCTCCATCTTTGTCATAATAAAGCTGAGACTTG
Translation
  - UNI17594 - MQTMWGSGELLVAWFLVLAADGTTEHVYRPS - UNI17594 - SRRVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYR

 - UNI24570 - RTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPGACGAA - UNI25267 - AICQPPCGNGGSCIRPGHCRCPVGWQGDTCQT

D DVDECSTGEASCPQRCVNTVGSYWCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAG GVDSMAREEVYRLQARVDVLEQ KLQLVLAPLHSLASRSTE

HGLQDPGSLLAHSFQQLDRIDSLSEQVSFLEEHLGSC CSCKKDL

For any suggestions or comments, please send an email to unitrap@crg.es