Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026923 (Notch1)
Chromosomal location
Chr 2: 26313556 - 26365177 (-)
Description
Notch gene homolog 1 (Drosophila) Gene [Source:MGI (curated);Acc:Notch1-001]
RefSeq_dna
NM_008714 
RefSeq_peptide
NP_032740.2 
UniGene
Mm.290610 
MGI
MGI:97363 
Uniprot/SWISSPROT
Q01705 
Uniprot/SPTREMBL
A2AIX5 Q8BY39 Q3TZW2 Q3U3Y2 Q7TQ50 Q7TQ51 Q7TQ52 Q8K428 
Human Ortholog
ENSG00000148400 (NOTCH1)
Omim 109730 - AORTIC VALVE DISEASE  
UniTrap UNI32968
Vector Insertion
Chr 2: 26359017 - 26365178
Public Clones IST12747G6 (tigm) IST10281C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38531
Vector Insertion
Chr 2: 26357400 - 26359319
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10323
Vector Insertion
Chr 2: 26340970 - 26357400
Public Clones (sanger) LST022 (baygenomics) 5SE224F02 (ggtc) CMHD-GT_474A8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33315
Vector Insertion
Chr 2: 26313555 - 26317766
Public Clones (ggtc) IST12482B3 (tigm) IST10143B9 (tigm) IST14711C10 (tigm) IST12372C8 (tigm)
IST15046F3 (tigm) IST10258A4 (tigm) IST11399G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114062
Sequence
ATGAAGAACTCAAATACACTGACCAACAAATGGAGGATGGAGCAAT - UNI10323 - - UNI32968 - CTCCTGCTTCAATGGTGGTACCTGTGT

GGATGGTATCAACTCCTTCACCTGTCTGTGTCCACCTGGCTTCACGGGCAGCTACTGTCAGTATGATGTCAATGAGTGTGATTCACGGCCCTGTCTGCAC

GGTGGTACCTGCCAAGACAGCTATGGTACTTATAAGTGTACCTGCCCACAGGGCTACACTGGTCTCAACTGCCAG AACCTTGTGCGCTGGTGCGACTCG

GCTCCCTGCAAGAATGGTGGCAGGTGCTGGCAGACCAACACGCAGTACCACTGTGAGTGCCGCAGCGGCTGGACTGGCGTCAACTGCGACGTGCTCAGTG

TGTCCTGTGAGGTGGCT AGGCATTGACGTCACTCTCCTGTGCCAGCATGGAGGGCTCTGTGTGGATGAGGGAGATAAACATTACTGCCACTGCCAGGCA

GGCTACACGGGCAGCTACTGTGAGGACGAGGTGGACGAGTGCTCACCTAACCCCTGCCAGAATGGAGCTACCTGCACTGACTATCTCGGCGGCTTTTCCT

GCAAG TGTGTGGCTGGCTACCATGGGTCTAACTGCTCCGAGGAGATCAACGAGTGCCTGTCCCAGCCCTGCCAGAATGGGGGTACCTGCATTGATCTGA

CCAACTCCTACAAGTGTTCCTGCCCCCGGGGGACACAGG GTGTACACTGTGAGATCAATGTTGATGACTGCCATCCCCCCCTTGACCCTGCCTCCCGAA

GCCCCAAGTGCTTCAACAATGGCACCTGTGTGGACCAGGTGGGTGGCTATACCTGCACCTGCCCACCAGGCTTCGTCGGGGAGCGGTGTGAGGGTGATGT

CAATGAATGTCTCTCCAACCCCTGTGACCCACGTGGCACCCAGAACTGTGTGCAGCGTGTTAATGACTTCCACTGCGAGTGCCGGGCTGGCCACACTG G

ACGCCGCTGTGAGTCAGTCATCAATGGCTGCAGGGGCAAACCTTGCAAGAATGGGGGTGTCTGTGCCGTGGCCTCCAACACC CGCTGCCTCAACGGTGG

TACATGCATCTCGGGCCCACGTAGTCCCACCTGCCTATGCCTGGGATCCTTCACCGGCCCTGAGTGCCAGTTCCCAGCCAGCAGCCCCTGTGTGGGTAGC

AACCCCTGCTACAATCAGGGCACCTGTGAGCCCACATCCGAGAACCCTTTCTACCGCTGTCTATGCCCTGCCAAATTCAACGGGCTACTGTGCCACATCC

TGGACTACAGCTTCACAGGTGGCGCTGGGCGCGACATTCCCCCACCGCAGATTGAGGAGGCCTGTGAGCTGCCTGAGTGCCAGGTGGATGCAGGCAATAA

GGTCTGCAACCTGCAGTGTAATAATCACGCATGTGGCTGGGATGGTGGCGACTGCTCCCTCAACTTCAATGACCCCTGGAAGAACTGCACGCAGTCTCTA

CAGTGCTGGAAGTATTTTAGCGACGGCCACTGTGACAGCCAGTGCAACTCGGCCGGCTGCCTCTTTGATGGCTTCGACTGCCAGCTCACCGAGGGACAGT

GCAA CCCCCTGTATGACCAGTACTGCAAGGACCACTTCAGTGATGGCCACTGCGACCAGGGCTGTAACAGTGCCGAATGTGAGTGGGATGGCCTAGACT

GTGCTGAGCATGTACCCGAGCGGCTGGCAGCCGGCACCCTGGTGCTGGTGGTGCTGCTTCCACCCGACCAGCTACGGAACAACTCCTTCCACTTTCTGCG

GGAGCTCAGCCACGTGCTGCACACCAACGTGGTCTTCAAGCGTGATGCGCAAGGCCAGCAGATGATCTTCCCGTACTATGGCCACGAGGAAGAGCTGCGC

AAGCACCCAATCAAGCGCTCTACA GGGGAGGTGGATGCTGACTGCATGGATGTCAATGTTCGAGGACCAG ATGGCTTCACACCCCTCATGATTGCCTC

CTGCAGTGGAGGGGGCCTTGAGACAGGCAACAGTGAAGAAGAAGAAGATGCACCTGCTGT
Translation
MKNSNTLTNKWRMEQS - UNI10323 - - UNI32968 - SPASMVVPVWMVSTPSPVCVHLASRAATVSMMSMSVIHGPVCTVVPAKTAMVLISVP

AHRATLVSTAR RTLCAGATRLP        
Transcript ENSMUST00000102908
Sequence
CGCAGGGGCGTGGGGCGCAGGGCGCGGGCGCTGGGCGCGGGTGCGAGCGCAGTGAAGGAACGAGCCCGGGTGCCTTGTAGGGCCCAGCGCCGCTGAGAGC

CCAGCGCCGCCCACCCGCCAGGAAAGAGGGCATCAGAGGGTGGACGCCTGCGGGACCGCCGGTGGTGTGCGTCAACGTCCGATCCCCGCCGGCCACCCCA

AGAGGCCGCCGCCCGGGCTGCGGGCAGCTGGCGAGCAGGCATGCCACGGCTCCTGACGCCCTTGCTCTGCCTAACGCTGCTGCCCGCGCTCGCCGCAAGA

G - UNI32968 - GCTTGAGATGCTCCCAGCCAAGTGGGACCTGCCTGAATGGAGGGAGGTGCGAAGTGGCCAACGGCACTGAAGCCTGTGT - UNI

10323 - CTGCAGCGGAGCCTTTGTGGGCCAACGATGCCAGGACTCCAATCCTTGCCTCAGCACACCGTGTAAGAATGCTGGAACGTGCCACGTTGTGG

ACCATGGTGGCACTGTGGATTATGCCTGCAGCTGTCCCCTGGGTTTCTCTGGGCCCCTCTGCCTGACACCTCTGGACAACGCCTGCCTGGCCAACCCCTG

CCGCAATGGGGGCACCTGTGACCTGCTCACTCTCACAGAGTACAAGTGCCGCTGCCCACCAGGGTGGTCAG GAAAATCATGTCAGCAGGCTGACCCCTG

TGCCTCCAACCCCTGTGCCAATGGTGGCCAGTGCCTGCCCTTTGAGTCTTCATACATCTGTCGCTGCCCGCCTGGCTTCCATGGCCCCACCTGCAGGCAA

GATGTTAATGAGTGCAGCCAGAACCCTGGGCTGTGCCGCCATGGAGGCACCTGCCACAATGAGATCGGCTCCTATCGCTGTGCCTGCCGTGCCACCCATA

CTGGTCCCCACTGTGAACTGCCCTATGTGCCCTGCAGCCCCTCACCCTGCCAGAATGGAGGCACCTGCCGTCCTACAGGGGACACCACCCACGAGTGTGC

CTGCTTGCCAG GTTTTGCTGGACAGAACTGTGAAGAAAATGTGGATGACTGTCCAGGAAACAACTGCAAGAATGGGGGTGCCTGTGTGGACGGCGTGAA

TACCTACAATTGCCGCTGCCCACCGGAGTGGACGG GTCAGTACTGTACAGAGGATGTGGACGAATGTCAGCTCATGCCCAATGCCTGCCAGAATGGCGG

AACCTGCCACAACACACACGGCGGCTACAACTGTGTGTGTGTCAATGGGTGGACTGGCGAGGACTGCAGTGAGAACATTGATGACTGTGCCAGTGCCGCC

TGTTTCCAGGGTGCCACTTGCCACGACCGTGTGGCTTCCTTCTACTGCGAATGTCCGCATGGGCGCACAG GTCTGCTGTGCCACCTCAACGATGCGTGC

ATCAGCAACCCCTGCAACGAGGGCTCCAACTGTGACACCAACCCTGTCAACGGCAAAGCCATCTGCACCTGCCCCTCGGGGTACACAGGGCCAGCCTGCA

GCCAGGACGTGGATGAGTGTGCTCTGG GTGCCAACCCTTGTGAGCACGCAGGCAAATGCCTCAACACACTGGGTTCTTTTGAGTGCCAGTGTCTACAGG

GCTACACGGGACCCCGCTGTGAGATTGATGTTAATGAGTGCATCTCCAACCCATGTCAGAATGATGCCACTTGCCTGGACCAGATTGGGGAGTTCCAATG

CATATGTATGCCAG GTTATGAAGGTGTATACTGTGAAATCAACACGGATGAGTGCGCCAGCAGCCCCTGTCTGCACAATGGCCACTGCATGGACAAGAT

CAATGAGTTCCAATGTCAGTGCCCCAAAG GCTTCAACGGGCACCTGTGCCAGTATGATGTGGATGAGTGTGCCAGCACACCATGCAAGAACGGTGCCAA

GTGCCTGGATGGGCCCAACACCTATACCTGCGTGTGTACAGAAG GTTACACAGGGACCCACTGCGAAGTGGACATTGACGAGTGTGACCCTGACCCCTG

CCACTATGGTTCCTGTAAGGATGGTGTGGCCACCTTTACCTGCCTGTGCCAGCCAGGCTACACAGGCCATCACTGTGAGACCAACATCAATGAGTGCCAC

AGCCAACCGTGCCGCCATGGGGGCACCTGCCAGGACCGTGACAACTCCTACCTCTGCTTATGCCTCAAGGGAACCACAG GGCCCAACTGTGAGATCAAC

CTGGATGACTGCGCCAGCAACCCCTGTGACTCTGGCACCTGTCTGGACAAGATTGATGGCTACGAATGTGCCTGTGAACCAGGCTACACAG GAAGCATG

TGTAACGTCAACATTGACGAATGTGCGGGCAGCCCCTGCCACAACGGGGGCACTTGTGAGGATGGCATCGCGGGCTTCACTTGCCGCTGCCCCGAGGGCT

ACCATGACCCCACGTGCCTGTCCGAGGTCAACGAGTGCAACAGTAACCCCTGCATCCACGGAGCTTGCCGGGATGGCCTCAATGG GTACAAGTGTGACT

GTGCCCCTGGGTGGAGTGGAACAAACTGTGACATCAACAACAACGAGTGTGAGTCCAACCCTTGTGTCAACGGTGGCACCTGCAAGGACATGACCAGTGG

CTACGTATGCACCTGCCGAGAAGGCTTCAGTG GCCCTAATTGCCAGACCAACATCAACGAATGTGCCTCCAACCCCTGCCTGAACCAGGGGACCTGCAT

TGATGATGTCGCTGGATACAAGTGCAACTGTCCTCTGCCATATACAG GAGCCACGTGTGAGGTGGTGTTGGCCCCATGTGCTACCAGCCCCTGCAAAAA

CAGCGGGGTATGCAAGGAGTCTGAAGACTATGAGAGTTTTTCCTGT GACCCGTGTCACAATGGGGGTTCCTGCACCGATGGCATCAACACAGCCTTCTG

CGACTGCCTGCCCGGCTTCCAGGGTGCCTTCTGTGAGGAGGACATCAATGAATGTGCCAGCAATCCCTGCCAAAATGGTGCCAATTGCACTGACTGTGTG

GACAGCTACACATGTACCTGCCCCGTGGGCTTCAATGGCATCCACTGCGAGAACAACACACCTGACTGTACTGAGAG CTCCTGCTTCAATGGTGGTACC

TGTGTGGATGGTATCAACTCCTTCACCTGTCTGTGTCCACCTGGCTTCACGGGCAGCTACTGTCAGTATGATGTCAATGAGTGTGATTCACGGCCCTGTC

TGCACGGTGGTACCTGCCAAGACAGCTATGGTACTTATAAGTGTACCTGCCCACAGGGCTACACTGGTCTCAACTGCCAG AACCTTGTGCGCTGGTGCG

ACTCGGCTCCCTGCAAGAATGGTGGCAGGTGCTGGCAGACCAACACGCAGTACCACTGTGAGTGCCGCAGCGGCTGGACTGGCGTCAACTGCGACGTGCT

CAGTGTGTCCTGTGAGGTGGCTGCACAGAAGCGAG GCATTGACGTCACTCTCCTGTGCCAGCATGGAGGGCTCTGTGTGGATGAGGGAGATAAACATTA

CTGCCACTGCCAGGCAGGCTACACGGGCAGCTACTGTGAGGACGAGGTGGACGAGTGCTCACCTAACCCCTGCCAGAATGGAGCTACCTGCACTGACTAT

CTCGGCGGCTTTTCCTGCAAG TGTGTGGCTGGCTACCATGGGTCTAACTGCTCCGAGGAGATCAACGAGTGCCTGTCCCAGCCCTGCCAGAATGGGGGT

ACCTGCATTGATCTGACCAACTCCTACAAGTGTTCCTGCCCCCGGGGGACACAGG GTGTACACTGTGAGATCAATGTTGATGACTGCCATCCCCCCCTT

GACCCTGCCTCCCGAAGCCCCAAGTGCTTCAACAATGGCACCTGTGTGGACCAGGTGGGTGGCTATACCTGCACCTGCCCACCAGGCTTCGTCGGGGAGC

GGTGTGAGGGTGATGTCAATGAATGTCTCTCCAACCCCTGTGACCCACGTGGCACCCAGAACTGTGTGCAGCGTGTTAATGACTTCCACTGCGAGTGCCG

GGCTGGCCACACTG GACGCCGCTGTGAGTCAGTCATCAATGGCTGCAGGGGCAAACCTTGCAAGAATGGGGGTGTCTGTGCCGTGGCCTCCAA CTTAC

GCTGCCTCAACGGTGGTACATGCATCTCGGGCCCACGTAGTCCCACCTGCCTATGCCTGGGATCCTTCACCGGCCCTGAGTGCCAGTTCCCAGCCAGCAG

CCCCTGTGTGGGTAGCAACCCCTGCTACAATCAGGGCACCTGTGAGCCCACATCCGAGAACCCTTTCTACCGCTGTCTATGCCCTGCCAAATTCAACGGG

CTACTGTGCCACATCCTGGACTACAGCTTCACAGGTGGCGCTGGGCGCGACATTCCCCCACCGCAGATTGAGGAGGCCTGTGAGCTGCCTGAGTGCCAGG

TGGATGCAGGCAATAAGGTCTGCAACCTGCAGTGTAATAATCACGCATGTGGCTGGGATGGTGGCGACTGCTCCCTCAACTTCAATGACCCCTGGAAGAA

CTGCACGCAGTCTCTACAGTGCTGGAAGTATTTTAGCGACGGCCACTGTGACAGCCAGTGCAACTCGGCCGGCTGCCTCTTTGATGGCTTCGACTGCCAG

CTCACCGAGGGACAGTGCAA CCCCCTGTATGACCAGTACTGCAAGGACCACTTCAGTGATGGCCACTGCGACCAGGGCTGTAACAGTGCCGAATGTGAG

TGGGATGGCCTAGACTGTGCTGAGCATGTACCCGAGCGGCTGGCAGCCGGCACCCTGGTGCTGGTGGTGCTGCTTCCACCCGACCAGCTACGGAACAACT

CCTTCCACTTTCTGCGGGAGCTCAGCCACGTGCTGCACACCAACGTGGTCTTCAAGCGTGATGCGCAAGGCCAGCAGATGATCTTCCCGTACTATGGCCA

CGAGGAAGAGCTGCGCAAGCACCCAATCAAGCGCTCTACA GGGGAGGTGGATGCTGACTGCATGGATGTCAATGTTCGAGGACCAG ATGGCTTCACAC

CCCTCATGATTGCCTCCTGCAGTGGAGGGGGCCTTGAGACAGGCAACAGTGAAGAAGAAGAAGATGCACCTGCTGTCATCTCTGACTTCATCTACCAGGG

CGCCAGCTTGCACAACCAGACAGACCGCACCGGGGAGACCGCCTTGCACTTGGCTGCCCGATACTCTCGTTCAGATGCTGCAAAGCGCTTGCTGGAGGCC

AGTGCAGATGCCAACATCCAGGACAACATGGGCCGTACTCCGTTACATGCAGCAGTTTCTGCAGATGCTCAGGGTGTCTTCCAG ATCCTGCTCCGGAAC

AGGGCCACAGATCTGGATGCCCGAATGCATGATGGCACAACTCCACTGATCCTGGCTGCGCGCCTGGCCGTGGAGGGCATGCTGGAGGACCTCATCAACT

CACATGCTGACGTCAATGCCGTGGATGACCTAG - UNI33315 - GCAAGTCGGCTTTGCATTGGGCGGCCGCGGTGAACAATGTGGATGCTGCTGTT

GTGCTCCTGAAGAACGGAGCCAACAAGGACATGCAGAACAACAAG - UNI33315 - GAGGAGACTCCCCTGTTCCTGGCCGCCCGTGAGGGCAGCTA

TGAGACTGCCAAAGTGTTGCTGGACCACTTTGCCAACCGGGACATCACGGATCACATGGACCGATTGCCGCGGGACATCGCACAGGAGCGTATGCACCAC

GATATCGTGCGGCTTTTGGATGAGTACAACCTGGTGCGCAGCCCACAGCTGCATGGCACTGCCCTGGGTGGCACACCCACTCTGTCTCCCACACTCTGCT

CGCCCAATGGCTACCTGGGCAATCTCAAGTCTGCCACACAGGGCAAGAAGGCCCGCAAGCCCAGCACCAAAGGGCTGGCTTGTGGTAGCAAGGAAGCTAA

GGACCTCAAGGCACGGAGGAAGAAGTCCCAGGATGGCAAGGGCTGCCTGTTGGACAGCTCGAGCATGCTGTCGCCTGTGGACTCCCTCGAGTCACCCCAT

GGCTACTTGTCAGATGTGGCCTCGCCACCCCTCCTCCCCTCCCCATTCCAGCAGTCTCCATCCATGCCTCTCAGCCACCTGCCTGGTATGCCTGACACTC

ACCTGGGCATCAGCCACTTGAATGTGGCAGCCAAGCCTGAGATGGCAGCACTGGCTGGAGGTAGCCGGTTGGCCTTTGAGCCACCCCCGCCACGCCTCTC

CCACCTGCCTGTAGCCTCCAGTGCCAGCACAGTGCTGAGTACCAATGGCACGGGGGCTATGAATTTCACCGTGGGTGCACCGGCAAGCTTGAATGGCCAG

TGTGAGTGGCTTCCCCGGCTCCAGAATGGCATGGTGCCCAGCCAGTACAACCCACTACGGCCGGGTGTGACGCCGGGCACACTGAGCACACAGGCAGCTG

GCCTCCAGCATAGCATGATGGGGCCACTACACAGCAGCCTCTCCACCAATACCTTGTCCCCGATTATTTACCAGGGCCTGCCCAACACACGGCTGGCAAC

ACAGCCTCACCTGGTGCAGACCCAGCAGGTGCAGCCACAGAACTTACAGCTCCAGCCTCAGAACCTGCAGCCACCATCACAGCCACACCTCAGTGTGAGC

TCGGCAGCCAATGGGCACCTGGGCCGGAGCTTCTTGAGTGGGGAGCCCAGTCAGGCAGATGTACAACCGCTGGGCCCCAGCAGTCTGCCTGTGCACACCA

TTCTGCCCCAGGAAAGCCAGGCCCTGCCCACATCACTGCCATCCTCCATGGTCCCACCCATGACCACTACCCAGTTCCTGACCCCTCCTTCCCAGCACAG

TTACTCCTCCTCCCCTGTGGACAACACCCCCAGCCACCAGCTGCAGGTGCCAGAGCACCCCTTCCTCACCCCATCCCCTGAGTCCCCTGACCAGTGGTCC

AGCTCCTCCCCGCATTCCAACATCTCTGATTGGTCCGAGGGCATCTCCAGCCCGCCCACCACCATGCCGTCCCAGATCACCCACATTCCAGAGGCATTTA

AATAAACAGAGATGTGGGATGCAGGACCCCAGCTTCCGTTCCCAAGCCCTGTTGGGAGTCCTTTCCAGTGCTTCAGGATGCTGGGGCGACCAAAGGAGCC

TTTTAAAAAATGTTTTTATACAAAATAAGAGGACAAGAATTTCCATTTTTTTTTTTAGTATTTATTTATGTACTTTTATTTTCCACAGAAACACTGCCTT

TTTATTTATATGTATTGTTTTCTATGGCACTAGGGAAAAACATATCTGTTCCAAGAAAATAAACTAGTTCTCAGAGCCTTGATTTTCCTGGTCAGGGTGA

AGTTCCCTGTGTGTCTGTAAAATATGAACAAGGATTCATGATTTGTAAATGCTGTTTATTTATTGATTGCTTCTTTCCAAAATCGAAAAGAAAGAAAAAA

GAACGTGACAGGAGAAGGGAAGCTGGAAACTGCCATGGCCAGAATTGCCCCTCCCCCACACTCACTGCCCCTCCCCCCAGCGTCACCTGGGATTTGCAGA

TGTGTTTAGAAACACGCCCAGACCTTGAACCTTGGGTTCATGGATTAGTTTTGTATCTAAAACAGGAAACAAGTCAGATGATGTGGTTTGTACACTTTCT

GTAACCACCAGTGTGGACTTGAAGAAGTGTCCTCAGCATGTGCAGAGTCTACTACCCAGTACCAGTCGTGAGTCTGCAGGCTCCAGTGTTCTGTAGTAGT

GTTTATGGGCCTTGGGAGTACTTCTCCCCTGCCCTGCCCCACTGTCCCCTTCCTGACAACTTGAGCCAGTAAGCCATGCAGGGTGTGGTGCCTCCTAGAG

AAAACACTGCCTGGACTGTTCTGTGCATCCCTCCAAACAGCATCATCCAAATCCAACTGAGGACAGACGGACTGTCCCGGCCTGGGCCTGGGCTCCTAAC

ACCTGACTGCCAAAGGGCTCCAATGTGCATTGTGGACTCGCCAGAGTAGCCTGCATTGAGACTCCAAGAAAACAGAAGCTATGTGGCCTCTGATCCCCAA

ACTGGCCTGGGTGGGGACATGCCTTGAGTGTGCTGGAATGTGGGTGGAGCCTGCTTCTGGGCCACCCCTCCTGGTTCAGGGCTGTGCTCACAGCAGATTC

TTGCAGTATCAAGTATACGCCTGTGGCAGAATAAGTATCTGTAAATACATGTTTAAAGATGGATTTTGTTTAAAAAATCTAAAGGAACAAGTGTGTCGTG

TGTCAAGCTGATGAGGACTGTCAGACTGTGGCTTAGCTCAGTGTGACCCAGACCTTGTGACCTGTAGCTGCCGAACCAGTAGCTCCTAAGAGCACAACCC

AGGATGGCCCATCTGCTGCCCACCAAGTCCCTTTCCAGCCACTGTGTGCTGGGGGCTTTCGGGGGCAGTTGCCCACCTCCTCAGGGCAGCTCTTTCTGGC

CTTTTGGGGGGCAGTGTCTGTGCCATGCCTAATAGATATGACCAGACGCATCCTAAGATGTTGATTCTTACTGTGTTGTATAAAATAAAGTGTAGTTTAC

Translation
MPRLLTPLLCLTLLPALAARG - UNI32968 - GLRCSQPSGTCLNGGRCEVANGTEACV - UNI10323 - VCSGAFVGQRCQDSNPCLSTPCKN

AGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSG GKSCQQADPCASNPCANGGQCLPFESSYICRCPP

GFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPG GFAGQNCEENVDDCPGNNC

KNGGACVDGVNTYNCRCPPEWTG GQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHG

RTG GLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALG GANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNP

CQNDATCLDQIGEFQCICMPG GYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKG GFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTE

G GYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTG GPNCEINLDDCASNPCDS

GTCLDKIDGYECACEPGYTG GSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNG GYKCDCAPGWSGT

NCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSG GPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTG GATCEVVLAPCATSPCKNSGVC

KESEDYESFSC DPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTES SSCFNGGTCV

DGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQ NLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLS

VSCEVAAQKRG GIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCK CVAGYHGSNCSEEINECLSQPCQNG

GTCIDLTNSYKCSCPRGTQG GVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHC

ECRAGHTG GRRCESVINGCRGKPCKNGGVCAVASN NLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLC

PAKFNGLLCHILDYSFTGGAGRDIPPPQIEEACELPECQVDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLF

DGFDCQLTEGQCN NPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQ

MIFPYYGHEEELRKHPIKRST GEVDADCMDVNVRGPD DGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSR

SDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQ ILLRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLG - UNI33315

 - GKSALHWAAAVNNVDAAVVLLKNGANKDMQNNK - UNI33315 - EETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV

RLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACGSKEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYL

SDVASPPLLPSPFQQSPSMPLSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNGTGAMNFTVGAPASLNGQCEW

LPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHSMMGPLHSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQLQPQNLQPPSQPHLSVSSAA

NGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSS

PHSNISDWSEGISSPPTTMPSQITHIPEAFK
Transcript ENSMUST00000028288
Sequence
CGCAGGGGCGTGGGGCGCAGGGCGCGGGCGCTGGGCGCGGGTGCGAGCGCAGTGAAGGAACGAGCCCGGGTGCCTTGTAGGGCCCAGCGCCGCTGAGAGC

CCAGCGCCGCCCACCCGCCAGGAAAGAGGGCATCAGAGGGTGGACGCCTGCGGGACCGCCGGTGGTGTGCGTCAACGTCCGATCCCCGCCGGCCACCCCA

AGAGGCCGCCGCCCGGGCTGCGGGCAGCTGGCGAGCAGGCATGCCACGGCTCCTGACGCCCTTGCTCTGCCTAACGCTGCTGCCCGCGCTCGCCGCAAGA

G - UNI32968 - GCTTGAGATGCTCCCAGCCAAGTGGGACCTGCCTGAATGGAGGGAGGTGCGAAGTGGCCAACGGCACTGAAGCCTGTGT - UNI

10323 - CTGCAGCGGAGCCTTTGTGGGCCAACGATGCCAGGACTCCAATCCTTGCCTCAGCACACCGTGTAAGAATGCTGGAACGTGCCACGTTGTGG

ACCATGGTGGCACTGTGGATTATGCCTGCAGCTGTCCCCTGGGTTTCTCTGGGCCCCTCTGCCTGACACCTCTGGACAACGCCTGCCTGGCCAACCCCTG

CCGCAATGGGGGCACCTGTGACCTGCTCACTCTCACAGAGTACAAGTGCCGCTGCCCACCAGGGTGGTCAG GAAAATCATGTCAGCAGGCTGACCCCTG

TGCCTCCAACCCCTGTGCCAATGGTGGCCAGTGCCTGCCCTTTGAGTCTTCATACATCTGTCGCTGCCCGCCTGGCTTCCATGGCCCCACCTGCAGGCAA

GATGTTAATGAGTGCAGCCAGAACCCTGGGCTGTGCCGCCATGGAGGCACCTGCCACAATGAGATCGGCTCCTATCGCTGTGCCTGCCGTGCCACCCATA

CTGGTCCCCACTGTGAACTGCCCTATGTGCCCTGCAGCCCCTCACCCTGCCAGAATGGAGGCACCTGCCGTCCTACAGGGGACACCACCCACGAGTGTGC

CTGCTTGCCAG GTTTTGCTGGACAGAACTGTGAAGAAAATGTGGATGACTGTCCAGGAAACAACTGCAAGAATGGGGGTGCCTGTGTGGACGGCGTGAA

TACCTACAATTGCCGCTGCCCACCGGAGTGGACGG GTCAGTACTGTACAGAGGATGTGGACGAATGTCAGCTCATGCCCAATGCCTGCCAGAATGGCGG

AACCTGCCACAACACACACGGCGGCTACAACTGTGTGTGTGTCAATGGGTGGACTGGCGAGGACTGCAGTGAGAACATTGATGACTGTGCCAGTGCCGCC

TGTTTCCAGGGTGCCACTTGCCACGACCGTGTGGCTTCCTTCTACTGCGAATGTCCGCATGGGCGCACAG GTCTGCTGTGCCACCTCAACGATGCGTGC

ATCAGCAACCCCTGCAACGAGGGCTCCAACTGTGACACCAACCCTGTCAACGGCAAAGCCATCTGCACCTGCCCCTCGGGGTACACAGGGCCAGCCTGCA

GCCAGGACGTGGATGAGTGTGCTCTGG GTGCCAACCCTTGTGAGCACGCAGGCAAATGCCTCAACACACTGGGTTCTTTTGAGTGCCAGTGTCTACAGG

GCTACACGGGACCCCGCTGTGAGATTGATGTTAATGAGTGCATCTCCAACCCATGTCAGAATGATGCCACTTGCCTGGACCAGATTGGGGAGTTCCAATG

CATATGTATGCCAG GTTATGAAGGTGTATACTGTGAAATCAACACGGATGAGTGCGCCAGCAGCCCCTGTCTGCACAATGGCCACTGCATGGACAAGAT

CAATGAGTTCCAATGTCAGTGCCCCAAAG GCTTCAACGGGCACCTGTGCCAGTATGATGTGGATGAGTGTGCCAGCACACCATGCAAGAACGGTGCCAA

GTGCCTGGATGGGCCCAACACCTATACCTGCGTGTGTACAGAAG GTTACACAGGGACCCACTGCGAAGTGGACATTGACGAGTGTGACCCTGACCCCTG

CCACTATGGTTCCTGTAAGGATGGTGTGGCCACCTTTACCTGCCTGTGCCAGCCAGGCTACACAGGCCATCACTGTGAGACCAACATCAATGAGTGCCAC

AGCCAACCGTGCCGCCATGGGGGCACCTGCCAGGACCGTGACAACTCCTACCTCTGCTTATGCCTCAAGGGAACCACAG GGCCCAACTGTGAGATCAAC

CTGGATGACTGCGCCAGCAACCCCTGTGACTCTGGCACCTGTCTGGACAAGATTGATGGCTACGAATGTGCCTGTGAACCAGGCTACACAG GAAGCATG

TGTAACGTCAACATTGACGAATGTGCGGGCAGCCCCTGCCACAACGGGGGCACTTGTGAGGATGGCATCGCGGGCTTCACTTGCCGCTGCCCCGAGGGCT

ACCATGACCCCACGTGCCTGTCCGAGGTCAACGAGTGCAACAGTAACCCCTGCATCCACGGAGCTTGCCGGGATGGCCTCAATGG GTACAAGTGTGACT

GTGCCCCTGGGTGGAGTGGAACAAACTGTGACATCAACAACAACGAGTGTGAGTCCAACCCTTGTGTCAACGGTGGCACCTGCAAGGACATGACCAGTGG

CTACGTATGCACCTGCCGAGAAGGCTTCAGTG GCCCTAATTGCCAGACCAACATCAACGAATGTGCCTCCAACCCCTGCCTGAACCAGGGGACCTGCAT

TGATGATGTCGCTGGATACAAGTGCAACTGTCCTCTGCCATATACAG GAGCCACGTGTGAGGTGGTGTTGGCCCCATGTGCTACCAGCCCCTGCAAAAA

CAGCGGGGTATGCAAGGAGTCTGAAGACTATGAGAGTTTTTCCTGTGTCTGTCCCACAGGCTGGCAAG GTCAAACCTGCGAGGTTGACATCAATGAGTG

TGTGAAAAGCCCATGTCGCCATGGGGCCTCCTGCCAGAACACCAATGGCAGCTACCGCTGCCTCTGCCAGGCCGGCTATACAGGTCGCAACTGTGAGAGT

GACATCGATGACTGCCGCCCCA ACCCGTGTCACAATGGGGGTTCCTGCACCGATGGCATCAACACAGCCTTCTGCGACTGCCTGCCCGGCTTCCAGGGT

GCCTTCTGTGAGGAGGACATCAATGAATGTGCCAGCAATCCCTGCCAAAATGGTGCCAATTGCACTGACTGTGTGGACAGCTACACATGTACCTGCCCCG

TGGGCTTCAATGGCATCCACTGCGAGAACAACACACCTGACTGTACTGAGAG CTCCTGCTTCAATGGTGGTACCTGTGTGGATGGTATCAACTCCTTCA

CCTGTCTGTGTCCACCTGGCTTCACGGGCAGCTACTGTCAGTATGATGTCAATGAGTGTGATTCACGGCCCTGTCTGCACGGTGGTACCTGCCAAGACAG

CTATGGTACTTATAAGTGTACCTGCCCACAGGGCTACACTGGTCTCAACTGCCAG AACCTTGTGCGCTGGTGCGACTCGGCTCCCTGCAAGAATGGTGG

CAGGTGCTGGCAGACCAACACGCAGTACCACTGTGAGTGCCGCAGCGGCTGGACTGGCGTCAACTGCGACGTGCTCAGTGTGTCCTGTGAGGTGGCTGCA

CAGAAGCGAG GCATTGACGTCACTCTCCTGTGCCAGCATGGAGGGCTCTGTGTGGATGAGGGAGATAAACATTACTGCCACTGCCAGGCAGGCTACACG

GGCAGCTACTGTGAGGACGAGGTGGACGAGTGCTCACCTAACCCCTGCCAGAATGGAGCTACCTGCACTGACTATCTCGGCGGCTTTTCCTGCAAG TGT

GTGGCTGGCTACCATGGGTCTAACTGCTCCGAGGAGATCAACGAGTGCCTGTCCCAGCCCTGCCAGAATGGGGGTACCTGCATTGATCTGACCAACTCCT

ACAAGTGTTCCTGCCCCCGGGGGACACAGG GTGTACACTGTGAGATCAATGTTGATGACTGCCATCCCCCCCTTGACCCTGCCTCCCGAAGCCCCAAGT

GCTTCAACAATGGCACCTGTGTGGACCAGGTGGGTGGCTATACCTGCACCTGCCCACCAGGCTTCGTCGGGGAGCGGTGTGAGGGTGATGTCAATGAATG

TCTCTCCAACCCCTGTGACCCACGTGGCACCCAGAACTGTGTGCAGCGTGTTAATGACTTCCACTGCGAGTGCCGGGCTGGCCACACTG GACGCCGCTG

TGAGTCAGTCATCAATGGCTGCAGGGGCAAACCTTGCAAGAATGGGGGTGTCTGTGCCGTGGCCTCCAACACCGCCCGTGGATTCATCTGTAGGTGCCCT

GCG GGCTTCGAGGGTGCCACATGTGAGAATGATGCCCGCACTTGTGGCAGCTTACGCTGCCTCAACGGTGGTACATGCATCTCGGGCCCACGTAGTCCC

ACCTGCCTATGCCTGGGATCCTTCACCGGCCCTGAGTGCCAGTTCCCAGCCAGCAGCCCCTGTGTGGGTAGCAACCCCTGCTACAATCAGGGCACCTGTG

AGCCCACATCCGAGAACCCTTTCTACCGCTGTCTATGCCCTGCCAAATTCAACGGGCTACTGTGCCACATCCTGGACTACAGCTTCACAGGTGGCGCTGG

GCGCGACATTCCCCCACCGCAGATTGAGGAGGCCTGTGAGCTGCCTGAGTGCCAGGTGGATGCAGGCAATAAGGTCTGCAACCTGCAGTGTAATAATCAC

GCATGTGGCTGGGATGGTGGCGACTGCTCCCTCAACTTCAATGACCCCTGGAAGAACTGCACGCAGTCTCTACAGTGCTGGAAGTATTTTAGCGACGGCC

ACTGTGACAGCCAGTGCAACTCGGCCGGCTGCCTCTTTGATGGCTTCGACTGCCAGCTCACCGAGGGACAGTGCAA CCCCCTGTATGACCAGTACTGCA

AGGACCACTTCAGTGATGGCCACTGCGACCAGGGCTGTAACAGTGCCGAATGTGAGTGGGATGGCCTAGACTGTGCTGAGCATGTACCCGAGCGGCTGGC

AGCCGGCACCCTGGTGCTGGTGGTGCTGCTTCCACCCGACCAGCTACGGAACAACTCCTTCCACTTTCTGCGGGAGCTCAGCCACGTGCTGCACACCAAC

GTGGTCTTCAAGCGTGATGCGCAAGGCCAGCAGATGATCTTCCCGTACTATGGCCACGAGGAAGAGCTGCGCAAGCACCCAATCAAGCGCTCTACAGTGG

GTTGGGCCACCTCTTCACTGCTTCCTGGTACCAGTGGTGGGCGCCAGCGCAGGGAGCTGGACCCCATGGACATCCGTGG CTCCATTGTCTACCTGGAGA

TCGACAACCGGCAATGTGTGCAGTCATCCTCGCAGTGCTTCCAGAGTGCCACCGATGTGGCTGCCTTCCTAGGTGCTCTTGCGTCACTTGGCAGCCTCAA

TATTCCTTACAAGATTGAGGCCGTGAAGA GTGAGCCGGTGGAGCCTCCGCTGCCCTCGCAGCTGCACCTCATGTACGTGGCAGCGGCCGCCTTCGTGCT

CCTGTTCTTTGTGGGCTGTGGGGTGCTGCTGTCCCGCAAGCGCCGGCGGCAGCATGGCCAGCTCTGGTTCCCTGAGGGTTTCAAAGTGTCAGAGGCCAGC

AAGAAGAAGCGGAGAGAGCCCCTCGGCGAGGACTCAGTCGGCCTCAA GCCCCTGAAGAATGCCTCAGATGGTGCTCTGATGGACGACAATCAGAACGAG

TGGGGAGACGAAGACCTGGAGACCAAGAAGTTCCGG TTTGAGGAGCCAGTAGTTCTCCCTGACCTGAGTGATCAGACTGACCACAGGCAGTGGACCCAG

CAGCACCTGGACGCTGCTGACCTGCGCATGTCTGCCATGGCCCCAACACCGCCTCAGGGGGAGGTGGATGCTGACTGCATGGATGTCAATGTTCGAGGAC

CAG ATGGCTTCACACCCCTCATGATTGCCTCCTGCAGTGGAGGGGGCCTTGAGACAGGCAACAGTGAAGAAGAAGAAGATGCACCTGCTGTCATCTCTG

ACTTCATCTACCAGGGCGCCAGCTTGCACAACCAGACAGACCGCACCGGGGAGACCGCCTTGCACTTGGCTGCCCGATACTCTCGTTCAGATGCTGCAAA

GCGCTTGCTGGAGGCCAGTGCAGATGCCAACATCCAGGACAACATGGGCCGTACTCCGTTACATGCAGCAGTTTCTGCAGATGCTCAGGGTGTCTTCCAG

 ATCCTGCTCCGGAACAGGGCCACAGATCTGGATGCCCGAATGCATGATGGCACAACTCCACTGATCCTGGCTGCGCGCCTGGCCGTGGAGGGCATGCTG

GAGGACCTCATCAACTCACATGCTGACGTCAATGCCGTGGATGACCTAG - UNI33315 - GCAAGTCGGCTTTGCATTGGGCGGCCGCGGTGAACAA

TGTGGATGCTGCTGTTGTGCTCCTGAAGAACGGAGCCAACAAGGACATGCAGAACAACAAG - UNI33315 - GAGGAGACTCCCCTGTTCCTGGCCG

CCCGTGAGGGCAGCTATGAGACTGCCAAAGTGTTGCTGGACCACTTTGCCAACCGGGACATCACGGATCACATGGACCGATTGCCGCGGGACATCGCACA

GGAGCGTATGCACCACGATATCGTGCGGCTTTTGGATGAGTACAACCTGGTGCGCAGCCCACAGCTGCATGGCACTGCCCTGGGTGGCACACCCACTCTG

TCTCCCACACTCTGCTCGCCCAATGGCTACCTGGGCAATCTCAAGTCTGCCACACAGGGCAAGAAGGCCCGCAAGCCCAGCACCAAAGGGCTGGCTTGTG

GTAGCAAGGAAGCTAAGGACCTCAAGGCACGGAGGAAGAAGTCCCAGGATGGCAAGGGCTGCCTGTTGGACAGCTCGAGCATGCTGTCGCCTGTGGACTC

CCTCGAGTCACCCCATGGCTACTTGTCAGATGTGGCCTCGCCACCCCTCCTCCCCTCCCCATTCCAGCAGTCTCCATCCATGCCTCTCAGCCACCTGCCT

GGTATGCCTGACACTCACCTGGGCATCAGCCACTTGAATGTGGCAGCCAAGCCTGAGATGGCAGCACTGGCTGGAGGTAGCCGGTTGGCCTTTGAGCCAC

CCCCGCCACGCCTCTCCCACCTGCCTGTAGCCTCCAGTGCCAGCACAGTGCTGAGTACCAATGGCACGGGGGCTATGAATTTCACCGTGGGTGCACCGGC

AAGCTTGAATGGCCAGTGTGAGTGGCTTCCCCGGCTCCAGAATGGCATGGTGCCCAGCCAGTACAACCCACTACGGCCGGGTGTGACGCCGGGCACACTG

AGCACACAGGCAGCTGGCCTCCAGCATAGCATGATGGGGCCACTACACAGCAGCCTCTCCACCAATACCTTGTCCCCGATTATTTACCAGGGCCTGCCCA

ACACACGGCTGGCAACACAGCCTCACCTGGTGCAGACCCAGCAGGTGCAGCCACAGAACTTACAGCTCCAGCCTCAGAACCTGCAGCCACCATCACAGCC

ACACCTCAGTGTGAGCTCGGCAGCCAATGGGCACCTGGGCCGGAGCTTCTTGAGTGGGGAGCCCAGTCAGGCAGATGTACAACCGCTGGGCCCCAGCAGT

CTGCCTGTGCACACCATTCTGCCCCAGGAAAGCCAGGCCCTGCCCACATCACTGCCATCCTCCATGGTCCCACCCATGACCACTACCCAGTTCCTGACCC

CTCCTTCCCAGCACAGTTACTCCTCCTCCCCTGTGGACAACACCCCCAGCCACCAGCTGCAGGTGCCAGAGCACCCCTTCCTCACCCCATCCCCTGAGTC

CCCTGACCAGTGGTCCAGCTCCTCCCCGCATTCCAACATCTCTGATTGGTCCGAGGGCATCTCCAGCCCGCCCACCACCATGCCGTCCCAGATCACCCAC

ATTCCAGAGGCATTTAAATAAACAGAGATGTGGGATGCAGGACCCCAGCTTCCGTTCCCAAGCCCTGTTGGGAGTCCTTTCCAGTGCTTCAGGATGCTGG

GGCGACCAAAGGAGCCTTTTAAAAAATGTTTTTATACAAAATAAGAGGACAAGAATTTCCATTTTTTTTTTTAGTATTTATTTATGTACTTTTATTTTCC

ACAGAAACACTGCCTTTTTATTTATATGTATTGTTTTCTATGGCACTAGGGAAAAACATATCTGTTCCAAGAAAATAAACTAGTTCTCAGAGCCTTGATT

TTCCTGGTCAGGGTGAAGTTCCCTGTGTGTCTGTAAAATATGAACAAGGATTCATGATTTGTAAATGCTGTTTATTTATTGATTGCTTCTTTCCAAAATC

GAAAAGAAAGAAAAAAGAACGTGACAGGAGAAGGGAAGCTGGAAACTGCCATGGCCAGAATTGCCCCTCCCCCACACTCACTGCCCCTCCCCCCAGCGTC

ACCTGGGATTTGCAGATGTGTTTAGAAACACGCCCAGACCTTGAACCTTGGGTTCATGGATTAGTTTTGTATCTAAAACAGGAAACAAGTCAGATGATGT

GGTTTGTACACTTTCTGTAACCACCAGTGTGGACTTGAAGAAGTGTCCTCAGCATGTGCAGAGTCTACTACCCAGTACCAGTCGTGAGTCTGCAGGCTCC

AGTGTTCTGTAGTAGTGTTTATGGGCCTTGGGAGTACTTCTCCCCTGCCCTGCCCCACTGTCCCCTTCCTGACAACTTGAGCCAGTAAGCCATGCAGGGT

GTGGTGCCTCCTAGAGAAAACACTGCCTGGACTGTTCTGTGCATCCCTCCAAACAGCATCATCCAAATCCAACTGAGGACAGACGGACTGTCCCGGCCTG

GGCCTGGGCTCCTAACACCTGACTGCCAAAGGGCTCCAATGTGCATTGTGGACTCGCCAGAGTAGCCTGCATTGAGACTCCAAGAAAACAGAAGCTATGT

GGCCTCTGATCCCCAAACTGGCCTGGGTGGGGACATGCCTTGAGTGTGCTGGAATGTGGGTGGAGCCTGCTTCTGGGCCACCCCTCCTGGTTCAGGGCTG

TGCTCACAGCAGATTCTTGCAGTATCAAGTATACGCCTGTGGCAGAATAAGTATCTGTAAATACATGTTTAAAGATGGATTTTGTTTAAAAAATCTAAAG

GAACAAGTGTGTCGTGTGTCAAGCTGATGAGGACTGTCAGACTGTGGCTTAGCTCAGTGTGACCCAGACCTTGTGACCTGTAGCTGCCGAACCAGTAGCT

CCTAAGAGCACAACCCAGGATGGCCCATCTGCTGCCCACCAAGTCCCTTTCCAGCCACTGTGTGCTGGGGGCTTTCGGGGGCAGTTGCCCACCTCCTCAG

GGCAGCTCTTTCTGGCCTTTTGGGGGGCAGTGTCTGTGCCATGCCTAATAGATATGACCAGACGCATCCTAAGATGTTGATTCTTACTGTGTTGTATAAA

ATAAAGTGTAGTTTAC
Translation
MPRLLTPLLCLTLLPALAARG - UNI32968 - GLRCSQPSGTCLNGGRCEVANGTEACV - UNI10323 - VCSGAFVGQRCQDSNPCLSTPCKN

AGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSG GKSCQQADPCASNPCANGGQCLPFESSYICRCPP

GFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPG GFAGQNCEENVDDCPGNNC

KNGGACVDGVNTYNCRCPPEWTG GQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHG

RTG GLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALG GANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNP

CQNDATCLDQIGEFQCICMPG GYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKG GFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTE

G GYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTG GPNCEINLDDCASNPCDS

GTCLDKIDGYECACEPGYTG GSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNG GYKCDCAPGWSGT

NCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSG GPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTG GATCEVVLAPCATSPCKNSGVC

KESEDYESFSCVCPTGWQG GQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPN NPCHNGGSCTDGINTAFCDCLPGFQGA

FCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTES SSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQD

SYGTYKCTCPQGYTGLNCQ NLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRG GIDVTLLCQHGGLCVDEGDKHYCHCQA

GYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCK CVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQG GVHCEINVDDCHPPLDPA

SRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTG GRRCESVINGCRGKPCKNGGVCAVASNTAR

GFICRCPA GFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHILD

YSFTGGAGRDIPPPQIEEACELPECQVDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQLTEGQCN

 NPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYYGHEEELR

KHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRG GSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALASLGSLNIPYKIEAVKS SEPVEPPLPSQ

LHLMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLK KPLKNASDGALMDDNQNEWGDEDLETKKFR FEEPVV

LPDLSDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGPD DGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTG

ETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQ ILLRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDL

G - UNI33315 - GKSALHWAAAVNNVDAAVVLLKNGANKDMQNNK - UNI33315 - EETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPR

DIAQERMHHDIVRLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACGSKEAKDLKARRKKSQDGKGCLLDSSSMLS

PVDSLESPHGYLSDVASPPLLPSPFQQSPSMPLSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNGTGAMNFTV

GAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHSMMGPLHSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQLQPQNLQP

PSQPHLSVSSAANGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTP

SPESPDQWSSSSPHSNISDWSEGISSPPTTMPSQITHIPEAFK

For any suggestions or comments, please send an email to unitrap@crg.es