Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026924 (Sec16a)
Chromosomal location
Chr 2: 26264953 - 26300736 (-)
Description
SEC16 homolog A (S. cerevisiae) Gene [Source:MGI (curated);Acc:Sec16a-001]
RefSeq_dna
NM_153125 
RefSeq_peptide
NP_694765.2 
UniGene
Mm.206371 
MGI
MGI:2139207 
Uniprot/SPTREMBL
A2AIX2 Q8R336 Q3TRA8 Q3TZR0 Q80U43 A2AIX1 Q811L5 Q8K000 
Human Ortholog
ENSG00000148396 (SEC16A)
Omim not available
UniTrap UNI6163
Vector Insertion
Chr 2: 26297591 - 26300594
Public Clones (sanger) CSG116 (baygenomics)
Private Clones OST305659 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI440
Vector Insertion
Chr 2: 26286749 - 26288850
Public Clones DC0508 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2146
Vector Insertion
Chr 2: 26279517 - 26279936
Public Clones AA0160 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6038
Vector Insertion
Chr 2: 26275291 - 26276893
Public Clones YHD038 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114078
Sequence
CAAAATGAGCTGCCAGATTTTGGTGGCAATGTCCTTCTAGCCCCTGCTGCCCCTGCACTTTATGTTCCTGTAAAACCAAAACCTTCAGAGGTTGTTCATC

ATCCAGAAAAGGGAATGTCTGGACAGAAGGCCTGGAAACAAGGGTCTGTGCCACCTTTGCAGAACCAAGACCCTCCTGGTGCTTCTGAGAACCTTGAGAA

CCCTCCCAAGGTAGGAGAAGAGGAGGCCCTTCCAGTGCAG GTAACAAAAGATGCTCAGGACCAGCATAGACTAGAAAGAGCCCAGCCAGAGCTGGTGCC

TCCTCGGCCACAGAATTCTCCCCAAGTGCCCCAAGCATCGTGTCCAGAGCCTTCAAATCCTGAAAGCCCACCCACACAAGGACAGTCTGAAAGCTTGGCC

CAGCCACCAGCAAGTCCAGCTTCAGTCAACACAGGCCAGCTGCTGCCTCAGCCACCACAGGCTTCCAGTGCATCCGTTACATCTACCAACTCCAGCCAGG

CAGCTGTGCGGTCAGAGCAGCTGTGGCTACACCCACCACCTCCTAATACTTTTGGCCCAGCACCTCAAGACTTGGCATCCTACTACTATTACAGACCCCT

GTATGATGCCTACCAGTCTCAGTACCCTTCACCGTACCCGTCAGATCCTGGGACAGCCTCGCTGTACTACCAG GATATGTATGGCCTGTATGAGCCTCG

TTACAGACCCTATGACAGCTCAGCATCTGCTTATGCCGAGAACCACCGCTATTCTGAGCCTGAGCGGCCCAGCTCCCGTGCAAGTCACTATTCCGACCAG

CTTGCTCCCAGGTGGGAGCTGCGTCTGTGCAGCTGCTTTACCCTCACACTCAGTTTGTGTATTGTTGGCTATGATGGTAACTTAGTGATGATAATAATTC

TTCATCTGTAGAGAATCCTACAAACCCATGATGTCAGCATGAGCAAACCAGAACTAAGTACACTGCCACATGTAGTCCTAGCAGAGCTATCACTTAGCAT

TTGTCCCCAATCCTTAGCCAGGTCAGGCTCTATGTAAGGCCATAAAGAAGTGGCCTCTATGCTAATAGATGGATGGTTGTTCTGTCCCTGAGACACCCAT

TCTGCTGCTGGCAGTTTGGTTGTGTGGTGGTTTGGGTTGTATGTGACTCTTAGACTGCTGCAGATGTTTTTAAAGTCTTGAGAATCCTGATCACAGAGAT

AACACAATCCACAGATCCATCAAATGATCTCTACCAGGGACTAAAAGCTGTGGACTGTGCCTGGCTATGCTGACTTTGGTGAAAGCTCCCCTCCCCCGCA

GCCTGCATATCTCCTATCCTGACTATCCACAACCCTGGCATTGTGACCTTTGAGTAAGTCTGTAAGCCAGGTCAAAGTTCCATCTCATTCTCATTTGCCC

AGAGCCTGCTTTTCATCTTGTGTCCACTCTGGGCCATTGACTACATTGTGAAAAGTAGTGGGGCGTCAGCCTTGGTCACTGTACTCTGCTACCTCAGCTC

CTCAGTGTCCTGCTTAGTCAGGCCCAGTAGTCAAGGAAAGCTTATGGTAGCTGACTTTGCTCTAAGGATGTGTCCTTCTTTGCTTAGAAACCCCAGCTGC

TGAGGTTACATGGGCCTTGCTTTCAGCGTTTTCTCTAGGTTCTTCTCTAAGAAGTTATTTGGTAACTTGTCTAAAGACACACTGCTCTGGGTGTGAACCT

TGGTCCATTTAGCTAGCCATAATGTCCTTTGCTCCAGAGGTACACACTGAACCATGGGCAGGTCCGTTCTGGGTCTCTAGGAAGCAGCAGTGCCGAGGCT

TGGGTGAGTTCTGGAGTACCTGCCTGGTAGATAGGAGGCTCTGGATTGGCTCGCTAATACATACACTTCAAGCACTTGCACACGTGTGTGCTTGAGCAAC

AGAGACAGAGACAGAGACAGACATACTTAATTGTGAGAAAATGTGGGGATCTTAGAGGGGAAGTAGCTCAATTTTCCAATTCAGAATCTATGAGAAGGCA

AGAGGCATGTGGATCTGTTTGCTGGAGTGCAGAAGGGAGAAAGCATGGGGCCAGAGCCAGGGTGTATCAGTTTGCCTTCCACATGTCTGCCTGCAGCTTC

ATTTAAGAATTAACTTTCAAGAGTGACTGTATCTAGGCTGAGGCTAGATGAGGTTACTATTGTGTGATCTGTCACTGTGACGGCAGCTTTCCTTCATCTC

TTCAGTTCTCATTTGTCACAGCTTACAGGAGCCTGTCCTCTTGTCTGTGTGTCTATGTGTGTGGACACTCAGTGTTGATGATACTCAATATTAGGTGGTA

GCACCACTGGAGGACCTGCTTGAGGCGGGACACATTCCCCATGTTTGTCTGTGTCCTCCCTGAACTAAATGTAAGTAGGTTGGTGAGAACAGTTGAGGTA

GTGGCAGGCTCTTGATCTTACTCTGTCACGGTGTTTTTCTGGAATCAATGTCAGATGAAGGTCTAGGGTGGCCAGCCTAAATGAAACCTTAAGGCCAGGT

TGGTGGTGTTCCTGGGCTGGGCATCTGGCTGAACAGATACTATGCTAGCCAAATAGCCAAGCTCAGCTGAGCAGTTTCCTAAAACGGTATCAGAAAATTT

AACAATGTTTAGTGCTTTTGACAATTCTGAGAGTGCCAAACCCTCTTAAGTGCACTTACACCTCTTTTTTGAGTAAATCTCACCTTCTCTGTAATGAGTC

AGGGCCATGGTTCAGTTTATTGGGCATAGAAGAGGCTAACTCCTTATTGATCTGTTGGCCCTGGCCCTGGCCCACCTCATAGATCCACTCCTCCAAGGCC

ACACGAAGCACTCATAGTTAGTGAAGTCATTTTCTTGTGGTTTACCTCTGTAATCCCATCACTATGGAGGTGCAGGCAGGAAGGTTGTCATGAGTTTAAG

GCGTGCCTAAGCTACACAGTGAGACCTGTC
Translation
QNELPDFGGNVLLAPAAPALYVPVKPKPSEVVHHPEKGMSGQKAWKQGSVPPLQNQDPPGASENLENPPKVGEEEALPVQ VTKDAQDQHRLERAQPELV

PPRPQNSPQVPQASCPEPSNPESPPTQGQSESLAQPPASPASVNTGQLLPQPPQASSASVTSTNSSQAAVRSEQLWLHPPPPNTFGPAPQDLASYYYYRP

LYDAYQSQYPSPYPSDPGTASLYYQ DMYGLYEPRYRPYDSSASAYAENHRYSEPERPSSRASHYSDQLAPRWELRLCSCFTLTLSLCIVGYDGNLVMII

ILHL
Transcript ENSMUST00000028290
Sequence
CAAAGCTATAATTTGGCTCAGCCTATTAATTTTTCTGTGTCCTTACTGAATCCTAATGAGAAGAATCAGTCCTGGGGAGATGCTGTGGTGGGGGAGAGAT

CCATAGTGAGCAACAACTGGGCTCTCGGTGGTGATCCTGAAGAACGTGCTGCTCTGTCTGGAGTTCCAGCCAGTGCTGTCACTGGCGCGTCTTTGCCTAG

CAGTATCCCCCAGAATTGTGCCCCTCAAGGTTCGGGGTCTTCTGAAATGATTGCTAGCCAGTCTGCCAGTTGGTTGGTTCAACAGCTATCCCCTCAAACC

CCTCAAAGTCCGCATCCAAATGCAGAAAAGGGCCCTTCCGAGTTTGTTAGTAGCCCTGCTGGCAATACAAGTGTGATGCTAGTTCCACCTGCAAGCAGTA

CTTTGGTTCCTAACAGTAATAAGGCAAAGCACTCTAGTAACCAGGAAGAAGCTGTTGGCGCCCTAGACTTCACATTAAATAGAACTTTGGAAAATCCTGT

GAGAATGTACAGCCCATCTCCTTCAGATGGCCCAGCTTCTCAGCAGCCTCTTCCCAATCATCCCAGACAATCTGGGCCTGGGCTGCATAACCAGGATCAT

TTCTACCAGCAGGTAACAAAAGATGCTCAGGACCAGCATAGACTAGAAAGAGCCCAG - UNI440 - CTCTCATTTCTCACAGACAGTCAGACAGTGA

CCACCAGCGTGCTGGAGAAGGAGACTGAGCGGTTCCGTGAGCTCTTGCTGTATGGCCGGAAGAAG GATGCTCTGGAGTCTGCCATGAAAAATGGCTTAT

GGGGTCATGCTCTTCTGCTTGCAAGTAAGATGGACAGCCGGACACATGCCCGTGTCATGACCAG GTTTGCCAACAGTCTTCCAATCAATGACCCCCTGC

AGACTGTCTACCAGCTCATGTCTGGACGGATGCCTGCTGCATCCACG TGTTGTGGCGATGAGAAGTGGGGAGATTGGAGGCCACATCTTGCAATGGTTT

TGTCCAACCTGAACAACAACATGGATGTTGAATCTAGGACCATGGCTACGATGGGTGATACTCTAG CATCAAAAGGCCTGTTGGATGCTGCACACTTCT

GCTACCTGATGGCCCAGGTTGGATTTGGGGTTTATACAAAGAAAACTACAAAACTTGTCTTGATAGGCTCAAATCACAG TTTGCCCTTTTTAAAGTTTG

CCACCAATGAAGCCATTCAAAGGACGGAGGCTTATGAGTATGCTCAGTCCCTTGGGGCACATACCTGTTCCTTACCTAACTTCCAG GTGTTTAAATTCA

TCTACTTGTGCCGCCTGGCTGAAATGGGACTTGCCACACAGGCCTTCCACTACTGCGAAGTAATAGCCAAGAGTGTCCTGACACAGCCTGGTGCATACTC

TCCAGTACTGATTAGCCAGTTGACTCAG - UNI2146 - ATGGCTTCCCAGTTACGCCTCTTCGATCCTCAACTGAAGGAGAAGCCAGAAGAGGAGTC

CTTTGTGGAGCCTGCCTGGTTGGTGCAGCTGCAGCACGTGGAGAGGCAGATCCAG GAGGGCACTGTGCTGTGGAGCCAGGATGGAACTGAACCCCAGCA

GTGTCGCATTACATCGGGCTCTGAGGTGGAGCAGTCAGATGGCCCTGGACTCAACCAGCAGGCAGGGCCACAGGCCGACAACCCTCTACTGATGCCAAGC

ACTGAGCCTTTGATGCATGGCGTGCAACTGCTGCCCACAG CTCCTCAGACATTGCCTGATGGCCAGCCTGCTCACCTTTCCAGGGTGCCGATGTTCCCA

GTGCCAATGTCTCGTGGGCCCCTGGAGCTGAGTCCTGCCTATGGACCCCCAGGATCTGCACTTGGCTTCCCAGAATCCTCCAGATCTGATCCTGCAGTGC

TGCATCCTGGGCAGGCCCTGCCACCCACTACACTAAGTCTCCAGGAAAGTGGGCTTCCACCCCAGGAGGCCAAAAGTCCAGACCCAG AAATGGTGCCAC

GGGGCTCACCTGTCAGACACTCCCCTCCGGAGCTCAGTCAAGAGGAGTTTGGCGAGAGCTTCGCTGACCCG - UNI6038 - GGCTCTTCCAGAACAG

CACAGGACTTGGAAACCTCCCCAGTGTGGGATCTTGGCAGCTCCAGTTTGACACGTGCACCATCTTTGACATCTGATTCTGAAGGGAAGAAACCTGCACA

GGCTGTCAAAAAGGAGCCCAAGGAGCCCAAGAAG ACTGAGTCCTGGTTCTCTCGTTGGCTGCCTGGAAAAAAAAGGACAGAAGCTTATCTACCAGATGA

CAAGAACAAATCA ATTGTTTGGGATGAAAAGAAAAACCAGTGGGTGAATTTGAATGAACCAGAGGAGGAG AAGAAGGCTCCACCCCCACCTCCAACAT

CGTTCCCCAGGGTTCCCCAGGTGGCTCCCACTGGGCCTGCAGGACCACCCACGGCCTCCGTGAATGTGTTTTCTAGAAAAGCAG GTGGGTCCAGAGCTC

GCTATGTGGATGTTCTAAACCCAAGTGGAACACAGCGGAGTGAACCAGCTCTTGCTCCTGCAGATTTCTTTGCTCCTCTCGCCCCACTGCCAATTCCTTC

TAACTTATTTGTACCAAACCCAG ATGCAGAAGAGCCACAACCTGCAGATGGGACTGGCTGTAGGGGACAGGCACCAGCTGGGACTCAGTCTAAGGCAGA

GTCCACCCTGGAACCCAAG GTGGGAAGTTCTACAGTATCAGCCCCTGGACCTGAGCTCTTACCCTCCAAACCAGATGGCTCCCAAGGAGGAGAG GCTC

CTGGAGACCATTGTCCTACAGGGGCCCCTCATGGTGGGTCTGTGCCCTTTTACAACCCTGCTCAGTTGGTGCAG GCTTCTGTCACCTCGGGAAATTCAA

GGCCAGGGAGGATTGGCCAAAGAAAATATGCGGCATTGAACTAGGATTGCTGCTGGATTCTTATTTGGAACCCTGAGATGATTAGATAACTGTTCTTCAC

CAAGAACCAACTAGCTGCCTCAGGTCTCGTGGATCCCAGATGGACATGGCAGTAACTCAGAGCCGGTCATACTGTGTGTCTCCTTCCTTGCAGCCTATGT

ATATGAATGATTGAAAAATTGATTTCAAGGTTCCTTTCAAATGCTGGATAGAATGAATCTAATTCAAAGTCTTTTATGTAAAAGAACAATGTTTCTTTTT

TAGTCACTTTAGACAAATTAAGGTTTGAGCCACTTGAGAATATCCCCGCAGAGAGGCTAGGCAGGGATTCACTACAGGAGAGCACAGTTACTTGGACACC

AAGGCCTTTCTCACCTGAGAAATGGTGCAAACCAACCAGGGATCCTTAGGCTACTGAGAAGGCTGTCTGCTTACCTGGAGAGGACTGACTGCTGGGATGT

CTGGCCTAAGAGGAGCCTCAAACTGCACTGGGCAACTGTGCCTTGTCCTGTGAACTGGGGAGTACATGCCAGCTCCTCAAAGGGTCACCAGATGGCAGCG

GCTCCCAGGCTGGGGAGGAAGTGGTTACAAGGGCATGTCTCTCCAACATTTCCAGCCTCACTCCATTTTCTGTGGCCTCATTAGTGCTGGGTGCGTTTTT

TTTTTGCTCCGAGCTTTCCGTCATGGCTCAGTCACTGGGGAGAGCCCCAGGGAGCTGATATTCTGAAGCTGCTGATCTGATTAACCAGGTCAAAAACTGG

CTGTGTGCTGCAACGTACTGCCCTCCTAGCCAGGAGTCTGTATGGAGCCCTCTAGCTGACTCAATGTCACCTGCAGACAGCACTTAAAGCCTTGGTGGTA

TCTTGGAGTGGCTTACGGTGTCCTAGCGCACACTCTGGAACCTTGCATCTCTACCCCAAAGCCCACCAGGGACCTTCAGCAGCGACTCACTGGCTCACCC

ATATCACTTCAAGGAGCTGCCACCACATAAGAGTCAAAGCTTTAAGGCTTCACTGACTGTTCCTAAAACTATCCTTACACTCTAAAGAGGAAGGGAAAGA

GAGTTAAATATTTAAAAATCAGCAGGTAGAAAACATAAATGGTTTGTTTGGTATTAAATTTAGAAATTGTAGAACATGGAATTAGTACAGCCCTTCCCGG

TTTTCTGGTTCCTTGCATCATCTAGGAAAGACTCACAGAATGGCTTCCAGGACGTTCCATAGATGAGTGTACTTGGACCCTCCTGTTCCTGTCATTAAGA

AAGGCCTGTCCCTGTGGGTCAGTAGCAACTTGTGTCCTTGCTGGGACCAGGCAGGACCCTTGCCTCTGGTTCAACCCTGCCCAGGCTCTGTGTTGACTGC

CAACCACTTTGGATTCAAGAAGCTTCCTCCCTGGGAGCTGCTATTTTTCCAAAATTCACATTGTTAAATAAAATATTTTGGGCTCTCAAGTAACTT
Translation
QSYNLAQPINFSVSLLNPNEKNQSWGDAVVGERSIVSNNWALGGDPEERAALSGVPASAVTGASLPSSIPQNCAPQGSGSSEMIASQSASWLVQQLSPQT

PQSPHPNAEKGPSEFVSSPAGNTSVMLVPPASSTLVPNSNKAKHSSNQEEAVGALDFTLNRTLENPVRMYSPSPSDGPASQQPLPNHPRQSGPGLHNQDH

FYQQVTKDAQDQHRLERAQ - UNI440 - LSFLTDSQTVTTSVLEKETERFRELLLYGRKK DALESAMKNGLWGHALLLASKMDSRTHARVMTR RF

ANSLPINDPLQTVYQLMSGRMPAAST CCGDEKWGDWRPHLAMVLSNLNNNMDVESRTMATMGDTLA ASKGLLDAAHFCYLMAQVGFGVYTKKTTKLVL

IGSNHS SLPFLKFATNEAIQRTEAYEYAQSLGAHTCSLPNFQ VFKFIYLCRLAEMGLATQAFHYCEVIAKSVLTQPGAYSPVLISQLTQ - UNI214

6 - MASQLRLFDPQLKEKPEEESFVEPAWLVQLQHVERQIQ EGTVLWSQDGTEPQQCRITSGSEVEQSDGPGLNQQAGPQADNPLLMPSTEPLMHGVQ

LLPTA APQTLPDGQPAHLSRVPMFPVPMSRGPLELSPAYGPPGSALGFPESSRSDPAVLHPGQALPPTTLSLQESGLPPQEAKSPDPE EMVPRGSPVR

HSPPELSQEEFGESFADP - UNI6038 - GSSRTAQDLETSPVWDLGSSSLTRAPSLTSDSEGKKPAQAVKKEPKEPKK TESWFSRWLPGKKRTEAY

LPDDKNKS IVWDEKKNQWVNLNEPEEE KKAPPPPPTSFPRVPQVAPTGPAGPPTASVNVFSRKAG GGSRARYVDVLNPSGTQRSEPALAPADFFAPL

APLPIPSNLFVPNPD DAEEPQPADGTGCRGQAPAGTQSKAESTLEPK VGSSTVSAPGPELLPSKPDGSQGGE APGDHCPTGAPHGGSVPFYNPAQLV

Q ASVTSGNSRPGRIGQRKYAALN
Transcript ENSMUST00000091252
Sequence
ACGTCGGCGGCGGCACCTGGAGCCGGATGTGCCAAGATGGCTGCGGCTGCTGCTGGGAACGCGCTAGTTCCCCCTACTGCCGCCGCCGTCGCCGGCTGGG

TTTCAGTTCGCGGCGCCTGAGAAGCCAACCACAGCTCACAGG - UNI6163 - CACAAATTAAAGAAAAGCTCTACTCTGCCCCCTTGATAAGCAGCA

TCTCCTTGTGGAAAAGACTCCAACATGCAGCCACCACCTCAGGCAGTCCCGTCTGGGGTGGCTGGACCACCCCCAGCTGGGAATCCTCGGAGCATGTTCT

GGGCCAACAGCCCTTACAGGAAGCCAGCCAATAATGCACCAGTGGCTCCCATAACACGCCCATTGCAGCCAGTAACGGATCCGTTTGCTTTTAATAGACA

GACTCTTCAAAACACACCAGTAGGAAGTTCATCCAAAAGCAGCCTGCCCAATTTGCCTGGCCCAGCCCTCTCTGTTTTTTCTCAGTGGCCTGGTTTGCCT

GTGACTCCCACAAATGCTGGGGATAGCTCCACAGGATTGCATGAGCCTCTGTCAGGAACTCTGTCACAGCCTAGAGCAGATGCCAGTCTATTTCCTCCTG

CATCTACCCCTTCTTCACTCCCTGGGCTGGAGGTGAGCAGGAATGCTGAGGCTGATCCCAGCTCAGGACATGAAGTCCAGATGCTGCCACATTCAGCTCA

CTACATTCCAGGAGTGGGTCCTGAGCAGCCTCTCGGGGGCCAAATGAATGACAGTGGGTCCGGGCCTGACCAACCCATGAATAGGCATGCCCCCCATGAT

GGTGCCGTGACCCACGCAGCATCTCCTTTCCTCCCTCAGCCACAGATGCCAGGTCAGTGGGGGCCTGCACAAGGAGGCCCTCAGCCCTCCTATCAGCATC

ACTCACCCTACCTGGAGGGACCTGTTCAGAACATGGGGCTCCAGGCTGCCAGCTTGCCCCATTTTCCCCCTCCATCTAGTCTACACCAGGGACCTGGCCA

TGAGTCTCATGCCCCACAAACATTTACTCCAGCATCCTTGGCCAGTGGTGAAGGGAATGAGATAGTTCACCAGCAAAGTAAAAATCACCCATTGAGTAGC

TTCCCCCCTAAACACACTTTTGAGCAGAATTCCAGAATTGGGAATATGTGGGCAAGCCCAGAGTTGAAGCAGAATCCGGGAGTGAATAAAGAGCATCTGC

TAGACCCTGCCCATGTCAATCCCTTCACTCAGGGAAATAGTCCTGAAAACCAGGCGCATCATCCCCCAGTGGCAGCAACTAACCATGCCCTGCAAGAAGC

AGCCTCTGGAGCTCTCTCAATGTTTTTTCAAGGGGAAGAGACAGAGAATGAGGAAAATCTCTCATCTGAAAAAGCAGGCCTCGATAAGAGATTGAACTTG

GATAGCTTTTCTTCTACCTCCAGACTGGGCCATCCACCACCACCTGGAGCTAGTGGTGTCTACCAGGCCTTTCCTAGAGGCCCTAGCAGTGAGGCTGCGC

AGGAAGGAGATGCGCAACCTTATTTTTCGCAGTCTGTGGGCGTCCGTCTTGACAAACAGAGCACTGTGCCCCCTGCTAATGATGCATGGGGTGATGTTCC

GGGGACCGGGACCCGCTGTGCCAGTGGGCCACAGTGTGAGAATGTTGAGAACTTAGAATTTGTTCAGAATCAAGAAGTTTTGCCCCGTGAGACCCTGAGT

GTGGATCCCTTCCCCCTGAGTGATCAGATCCGATATGGGCCCCTTCCTGGGCCAGCTGCCTCCAGGCCTGCTACTGTGGGCCTCACCAGAGGTGGGGGGC

TAAATCTTGAGGCCCCAGACACACCACTGCACCCTACACGACCTGACAGTGTGTCATCCAGCTACAGCAGCCATAGCCACAGAAGTCCTCCTGGGTCAGC

CAGACCCCAAGAATTGGTGGGCACATTCATTCAGCAAGAAGTTGGGAAACTTGAAGATGATACTTCAGGGAGTTTTTTTAAGCAAATTGATTCTTCTCCT

GTTGGAGGTGAAACAGATGAGGTGACTGGGAGCCAAAATTGCTGCAGCAGTCTGTCCCAGCCTTCAACCCCAAGCCCTCCAAAACCTACAGGAGTATTCC

AAACAAGTGCAAACAGTTCTTTTGAGCCAGTAAAATCCCACTTGGTTGGAGTGAAACCAGTTGAAGCAGATCGTGCCAACATGGTGGTTGAAGTGAGAGG

GACCCAATACTGTCCGAAGAAGCGCAGGGCAGCTGTTGCACCACCTGATGCTACCTCAGGAAACCTGGAACAGCCACCAGACAACATGGAGACCCCGTGT

GCACCTCAGGCCTGCCCTTTGCCTCTTAGCACCACTGGAGAGGCTGGGCAACTGGTTTCAAACACGGCAGGGACACCCCTGGATACTGTGCGCCCAGTGC

CTGATAAGAGGCCCTCAGCCAGGGCCCAGGGACCTGTGAAGTGTGAGAGCCCAGCAACAACTCTGTGGGCACAAAATGAGCTGCCAGATTTTGGTGGCAA

TGTCCTTCTAGCCCCTGCTGCCCCTGCACTTTATGTTCCTGTAAAACCAAAACCTTCAGAGGTTGTTCATCATCCAGAAAAGGGAATGTCTGGACAGAAG

GCCTGGAAACAAGGGTCTGTGCCACCTTTGCAGAACCAAGACCCTCCTGGTGCTTCTGAGAACCTTGAGAACCCTCCCAAGGTAGGAGAAGAGGAGGCCC

TTCCAGTGCAGGCAAGTTCTGGTTATGCGAGTTTGCTTTCTTCGCCACCCACTGAATCTTTGCACAATCAACCTGTCCTGATTGCTCAGCCTGATCAAAG

CTATAATTTGGCTCAGCCTATTAATTTTTCTGTGTCCTTACTGAATCCTAATGAGAAGAATCAGTCCTGGGGAGATGCTGTGGTGGGGGAGAGATCCATA

GTGAGCAACAACTGGGCTCTCGGTGGTGATCCTGAAGAACGTGCTGCTCTGTCTGGAGTTCCAGCCAGTGCTGTCACTGGCGCGTCTTTGCCTAGCAGTA

TCCCCCAGAATTGTGCCCCTCAAGGTTCGGGGTCTTCTGAAATGATTGCTAGCCAGTCTGCCAGTTGGTTGGTTCAACAGCTATCCCCTCAAACCCCTCA

AAGTCCGCATCCAAATGCAGAAAAGGGCCCTTCCGAGTTTGTTAGTAGCCCTGCTGGCAATACAAGTGTGATGCTAGTTCCACCTGCAAGCAGTACTTTG

GTTCCTAACAGTAATAAGGCAAAGCACTCTAGTAACCAGGAAGAAGCTGTTGGCGCCCTAGACTTCACATTAAATAGAACTTTGGAAAATCCTGTGAGAA

TGTACAGCCCATCTCCTTCAGATGGCCCAGCTTCTCAGCAGCCTCTTCCCAATCATCCCAGACAATCTGGGCCTGGGCTGCATAACCAGGATCATTTCTA

CCAGCAGGTAACAAAAGATGCTCAGGACCAGCATAGACTAGAAAGAGCCCAGCCAGAGCTGGTGCCTCCTCGGCCACAGAATTCTCCCCAAGTGCCCCAA

GCATCGTGTCCAGAGCCTTCAAATCCTGAAAGCCCACCCACACAAGGACAGTCTGAAAGCTTGGCCCAGCCACCAGCAAGTCCAGCTTCAGTCAACACAG

GCCAGCTGCTGCCTCAGCCACCACAGGCTTCCAGTGCATCCGTTACATCTACCAACTCCAGCCAGGCAGCTGTGCGGTCAGAGCAGCTGTGGCTACACCC

ACCACCTCCTAATACTTTTGGCCCAGCACCTCAAGACTTGGCATCCTACTACTATTACAGACCCCTGTATGATGCCTACCAGTCTCAGTACCCTTCACCG

TACCCGTCAGATCCTGGGACAGCCTCGCTGTACTACCAG GATATGTATGGCCTGTATGAGCCTCGTTACAGACCCTATGACAGCTCAGCATCTGCTTAT

GCCGAGAACCACCGCTATTCTGAGCCTGAGCGGCCCAGCTCCCGTGCAAGTCACTATTCCGACCAGCTTGCTCCCAG GCAAGGATATCCTGAAGGATAC

TATAATTCCAAGAGTGGATGGAGCAGTCACAGTGATTACTATGCAAATTATTACTCTGGCCAGTATGATTATGGAG - UNI440 - ACCCCAGCCGCT

GGGATCGTTACTATGGGTCTCGCCTTAGGGATCCTCGCACCTGGGACCGGAGGTACTGGTATGACTCTGAACATGACCCATACAGGAAGGACCACTATGC

TTACAGTGACAG GCCTGAGAAATGTGATGATCACTGGAGGTATGACCCTCGCTTCACTGGGAGCTTCGACGATGACGCTGAGATCCACAGGGACCCCTA

TGGAGAAGAAGCAGACAGACGCAGCATCCACAGTGAGCACTCGGCACGGAGCCTGCGCAGCACTCACAGTCTGCCCAGCCGCCGCAGCAGCCTCAGCTCC

CATTCACACCAG AGTCAGATTTACAGAAGCCACCATGTGACTGGCGGTTCCTTTGAGGCCCCTCATGCCCCAGGCTCATTTCATGGTGATTATGCCTAT

GGCACATATGCCAGCAATTTCAGCGGTGCCCATGGTTTTCCAGAGTACAGCTACCCTGCAGACACCTCCTGGCCTGCTGTGGAGCAAG TTCCATCAAGA

CCGACCTCTCCTGAGAAGTTTACGGTGCCTCATGTCTGTGCCAGGTTTGGTCCTGGTGGTCAGCTCCTTAAAGTGATTCCCAACCTGCCTTCAGAAGGAC

AGCCTGCACTGGTGGAGATCCACAGCTTAGAG ACCTTGCTGCAGCACACACCTGAGCAGGAAGAGATGCGCTCCTTCCCAGGACCTCTCGGCAA AGAT

GATACCCACAAAGTAGATGTTATTAACTTTGCACAGAACAAAGCAACAAAATGTTTGCAGAATGAAAGTTTAATTGATAAAGAGTCTGCAAGTCTTCTTT

GGAAATTCATTATTCTGTTATGCAGACAGAATGGG ACTGTTGTGGGAACAGACATTGCAGAGCTTTTGTTACGGGACCATAGAACTGTATGGCTTCCTG

GGAAGTCACCCAATGAGGCAAACCTGATAGATTTTACCAATGAGGCTGTGGAACAAGTGGAAGAGGAGGAGTCAGGGGAGGCCCAGCTCTCATTTCTCAC

AGACAGTCAGACAGTGACCACCAGCGTGCTGGAGAAGGAGACTGAGCGGTTCCGTGAGCTCTTGCTGTATGGCCGGAAGAAG GATGCTCTGGAGTCTGC

CATGAAAAATGGCTTATGGGGTCATGCTCTTCTGCTTGCAAGTAAGATGGACAGCCGGACACATGCCCGTGTCATGACCAG GTTTGCCAACAGTCTTCC

AATCAATGACCCCCTGCAGACTGTCTACCAGCTCATGTCTGGACGGATGCCTGCTGCATCCACG TGTTGTGGCGATGAGAAGTGGGGAGATTGGAGGCC

ACATCTTGCAATGGTTTTGTCCAACCTGAACAACAACATGGATGTTGAATCTAGGACCATGGCTACGATGGGTGATACTCTAG CATCAAAAGGCCTGTT

GGATGCTGCACACTTCTGCTACCTGATGGCCCAGGTTGGATTTGGGGTTTATACAAAGAAAACTACAAAACTTGTCTTGATAGGCTCAAATCACAG TTT

GCCCTTTTTAAAGTTTGCCACCAATGAAGCCATTCAAAGGACGGAGGCTTATGAGTATGCTCAGTCCCTTGGGGCACATACCTGTTCCTTACCTAACTTC

CAG GTGTTTAAATTCATCTACTTGTGCCGCCTGGCTGAAATGGGACTTGCCACACAGGCCTTCCACTACTGCGAAGTAATAGCCAAGAGTGTCCTGACA

CAGCCTGGTGCATACTCTCCAGTACTGATTAGCCAGTTGACTCAG - UNI2146 - ATGGCTTCCCAGTTACGCCTCTTCGATCCTCAACTGAAGGAG

AAGCCAGAAGAGGAGTCCTTTGTGGAGCCTGCCTGGTTGGTGCAGCTGCAGCACGTGGAGAGGCAGATCCAG GAGGGCACTGTGCTGTGGAGCCAGGAT

GGAACTGAACCCCAGCAGTGTCGCATTACATCGGGCTCTGAGGTGGAGCAGTCAGATGGCCCTGGACTCAACCAGCAGGCAGGGCCACAGGCCGACAACC

CTCTACTGATGCCAAGCACTGAGCCTTTGATGCATGGCGTGCAACTGCTGCCCACAG CTCCTCAGACATTGCCTGATGGCCAGCCTGCTCACCTTTCCA

GGGTGCCGATGTTCCCAGTGCCAATGTCTCGTGGGCCCCTGGAGCTGAGTCCTGCCTATGGACCCCCAGGATCTGCACTTGGCTTCCCAGAATCCTCCAG

ATCTGATCCTGCAGTGCTGCATCCTGGGCAGGCCCTGCCACCCACTACACTAAGTCTCCAGGAAAGTGGGCTTCCACCCCAGGAGGCCAAAAGTCCAGAC

CCAG AAATGGTGCCACGGGGCTCACCTGTCAGACACTCCCCTCCGGAGCTCAGTCAAGAGGAGTTTGGCGAGAGCTTCGCTGACCCG - UNI6038 -

 GGCTCTTCCAGAACAGCACAGGACTTGGAAACCTCCCCAGTGTGGGATCTTGGCAGCTCCAGTTTGACACGTGCACCATCTTTGACATCTGATTCTGAA

GGGAAGAAACCTGCACAGGCTGTCAAAAAGGAGCCCAAGGAGCCCAAGAAG ACTGAGTCCTGGTTCTCTCGTTGGCTGCCTGGAAAAAAAAGGACAGAA

GCTTATCTACCAGATGACAAGAACAAATCA ATTGTTTGGGATGAAAAGAAAAACCAGTGGGTGAATTTGAATGAACCAGAGGAGGAG AAGAAGGCTCC

ACCCCCACCTCCAACATCGTTCCCCAGGGTTCCCCAGGTGGCTCCCACTGGGCCTGCAGGACCACCCACGGCCTCCGTGAATGTGTTTTCTAGAAAAGCA

G GTGGGTCCAGAGCTCGCTATGTGGATGTTCTAAACCCAAGTGGAACACAGCGGAGTGAACCAGCTCTTGCTCCTGCAGATTTCTTTGCTCCTCTCGCC

CCACTGCCAATTCCTTCTAACTTATTTGTACCAAACCCAG ATGCAGAAGAGCCACAACCTGCAGATGGGACTGGCTGTAGGGGACAGGCACCAGCTGGG

ACTCAGTCTAAGGCAGAGTCCACCCTGGAACCCAAG GTGGGAAGTTCTACAGTATCAGCCCCTGGACCTGAGCTCTTACCCTCCAAACCAGATGGCTCC

CAAGGAGGAGAG GCTCCTGGAGACCATTGTCCTACAGGGGCCCCTCATGGTGGGTCTGTGCCCTTTTACAACCCTGCTCAGTTGGTGCAG GCTTCTGT

CACCTCGGGAAATTCAAGGCCAGGGAGGATTGGCCAAAGAAAATATGCGGCATTGAACTAGGATTGCTGCTGGATTCTTATTTGGAACCCTGAGATGATT

AGATAACTGTTCTTCACCAAGAACCAACTAGCTGCCTCAGGTCTCGTGGATCCCAGATGGACATGGCAGTAACTCAGAGCCGGTCATACTGTGTGTCTCC

TTCCTTGCAGCCTATGTATATGAATGATTGAAAAATTGATTTCAAGGTTCCTTTCAAATGCTGGATAGAATGAATCTAATTCAAAGTCTTTTATGTAAAA

GAACAATGTTTCTTTTTTAGTCACTTTAGACAAATTAAGGTTTGAGCCACTTGAGAATATCCCCGCAGAGAGGCTAGGCAGGGATTCACTACAGGAGAGC

ACAGTTACTTGGACACCAAGGCCTTTCTCACCTGAGAAATGGTGCAAACCAACCAGGGATCCTTAGGCTACTGAGAAGGCTGTCTGCTTACCTGGAGAGG

ACTGACTGCTGGGATGTCTGGCCTAAGAGGAGCCTCAAACTGCACTGGGCAACTGTGCCTTGTCCTGTGAACTGGGGAGTACATGCCAGCTCCTCAAAGG

GTCACCAGATGGCAGCGGCTCCCAGGCTGGGGAGGAAGTGGTTACAAGGGCATGTCTCTCCAACATTTCCAGCCTCACTCCATTTTCTGTGGCCTCATTA

GTGCTGGGTGCGTTTTTTTTTTGCTCCGAGCTTTCCGTCATGGCTCAGTCACTGGGGAGAGCCCCAGGGAGCTGATATTCTGAAGCTGCTGATCTGATTA

ACCAGGTCAAAAACTGGCTGTGTGCTGCAACGTACTGCCCTCCTAGCCAGGAGTCTGTATGGAGCCCTCTAGCTGACTCAATGTCACCTGCAGACAGCAC

TTAAAGCCTTGGTGGTATCTTGGAGTGGCTTACGGTGTCCTAGCGCACACTCTGGAACCTTGCATCTCTACCCCAAAGCCCACCAGGGACCTTCAGCAGC

GACTCACTGGCTCACCCATATCACTTCAAGGAGCTGCCACCACATAAGAGTCAAAGCTTTAAGGCTTCACTGACTGTTCCTAAAACTATCCTTACACTCT

AAAGAGGAAGGGAAAGAGAGTTAAATATTTAAAAATCAGCAGGTAGAAAACATAAATGGTTTGTTTGGTATTAAATTTAGAAATTGTAGAACATGGAATT

AGTACAGCCCTTCCCGGTTTTCTGGTTCCTTGCATCATCTAGGAAAGACTCACAGAATGGCTTCCAGGACGTTCCATAGATGAGTGTACTTGGACCCTCC

TGTTCCTGTCATTAAGAAAGGCCTGTCCCTGTGGGTCAGTAGCAACTTGTGTCCTTGCTGGGACCAGGCAGGACCCTTGCCTCTGGTTCAACCCTGCCCA

GGCTCTGTGTTGACTGCCAACCACTTTGGATTCAAGAAGCTTCCTCCCTGGGAGCTGCTATTTTTCCAAAATTCACATTGTTAAATAAAATATTTTGGGC

TCTCAAGTAACTT
Translation
 - UNI6163 - MQPPPQAVPSGVAGPPPAGNPRSMFWANSPYRKPANNAPVAPITRPLQPVTDPFAFNRQTLQNTPVGSSSKSSLPNLPGPALSVFSQ

WPGLPVTPTNAGDSSTGLHEPLSGTLSQPRADASLFPPASTPSSLPGLEVSRNAEADPSSGHEVQMLPHSAHYIPGVGPEQPLGGQMNDSGSGPDQPMNR

HAPHDGAVTHAASPFLPQPQMPGQWGPAQGGPQPSYQHHSPYLEGPVQNMGLQAASLPHFPPPSSLHQGPGHESHAPQTFTPASLASGEGNEIVHQQSKN

HPLSSFPPKHTFEQNSRIGNMWASPELKQNPGVNKEHLLDPAHVNPFTQGNSPENQAHHPPVAATNHALQEAASGALSMFFQGEETENEENLSSEKAGLD

KRLNLDSFSSTSRLGHPPPPGASGVYQAFPRGPSSEAAQEGDAQPYFSQSVGVRLDKQSTVPPANDAWGDVPGTGTRCASGPQCENVENLEFVQNQEVLP

RETLSVDPFPLSDQIRYGPLPGPAASRPATVGLTRGGGLNLEAPDTPLHPTRPDSVSSSYSSHSHRSPPGSARPQELVGTFIQQEVGKLEDDTSGSFFKQ

IDSSPVGGETDEVTGSQNCCSSLSQPSTPSPPKPTGVFQTSANSSFEPVKSHLVGVKPVEADRANMVVEVRGTQYCPKKRRAAVAPPDATSGNLEQPPDN

METPCAPQACPLPLSTTGEAGQLVSNTAGTPLDTVRPVPDKRPSARAQGPVKCESPATTLWAQNELPDFGGNVLLAPAAPALYVPVKPKPSEVVHHPEKG

MSGQKAWKQGSVPPLQNQDPPGASENLENPPKVGEEEALPVQASSGYASLLSSPPTESLHNQPVLIAQPDQSYNLAQPINFSVSLLNPNEKNQSWGDAVV

GERSIVSNNWALGGDPEERAALSGVPASAVTGASLPSSIPQNCAPQGSGSSEMIASQSASWLVQQLSPQTPQSPHPNAEKGPSEFVSSPAGNTSVMLVPP

ASSTLVPNSNKAKHSSNQEEAVGALDFTLNRTLENPVRMYSPSPSDGPASQQPLPNHPRQSGPGLHNQDHFYQQVTKDAQDQHRLERAQPELVPPRPQNS

PQVPQASCPEPSNPESPPTQGQSESLAQPPASPASVNTGQLLPQPPQASSASVTSTNSSQAAVRSEQLWLHPPPPNTFGPAPQDLASYYYYRPLYDAYQS

QYPSPYPSDPGTASLYYQ DMYGLYEPRYRPYDSSASAYAENHRYSEPERPSSRASHYSDQLAPR RQGYPEGYYNSKSGWSSHSDYYANYYSGQYDYGD

 - UNI440 - DPSRWDRYYGSRLRDPRTWDRRYWYDSEHDPYRKDHYAYSDR RPEKCDDHWRYDPRFTGSFDDDAEIHRDPYGEEADRRSIHSEHSA

RSLRSTHSLPSRRSSLSSHSHQ SQIYRSHHVTGGSFEAPHAPGSFHGDYAYGTYASNFSGAHGFPEYSYPADTSWPAVEQV VPSRPTSPEKFTVPHVC

ARFGPGGQLLKVIPNLPSEGQPALVEIHSLE TLLQHTPEQEEMRSFPGPLGK KDDTHKVDVINFAQNKATKCLQNESLIDKESASLLWKFIILLCRQN

G TVVGTDIAELLLRDHRTVWLPGKSPNEANLIDFTNEAVEQVEEEESGEAQLSFLTDSQTVTTSVLEKETERFRELLLYGRKK DALESAMKNGLWGHA

LLLASKMDSRTHARVMTR RFANSLPINDPLQTVYQLMSGRMPAAST CCGDEKWGDWRPHLAMVLSNLNNNMDVESRTMATMGDTLA ASKGLLDAAHF

CYLMAQVGFGVYTKKTTKLVLIGSNHS SLPFLKFATNEAIQRTEAYEYAQSLGAHTCSLPNFQ VFKFIYLCRLAEMGLATQAFHYCEVIAKSVLTQPG

AYSPVLISQLTQ - UNI2146 - MASQLRLFDPQLKEKPEEESFVEPAWLVQLQHVERQIQ EGTVLWSQDGTEPQQCRITSGSEVEQSDGPGLNQQA

GPQADNPLLMPSTEPLMHGVQLLPTA APQTLPDGQPAHLSRVPMFPVPMSRGPLELSPAYGPPGSALGFPESSRSDPAVLHPGQALPPTTLSLQESGLP

PQEAKSPDPE EMVPRGSPVRHSPPELSQEEFGESFADP - UNI6038 - GSSRTAQDLETSPVWDLGSSSLTRAPSLTSDSEGKKPAQAVKKEPKEP

KK TESWFSRWLPGKKRTEAYLPDDKNKS IVWDEKKNQWVNLNEPEEE KKAPPPPPTSFPRVPQVAPTGPAGPPTASVNVFSRKAG GGSRARYVDVL

NPSGTQRSEPALAPADFFAPLAPLPIPSNLFVPNPD DAEEPQPADGTGCRGQAPAGTQSKAESTLEPK VGSSTVSAPGPELLPSKPDGSQGGE APGD

HCPTGAPHGGSVPFYNPAQLVQ ASVTSGNSRPGRIGQRKYAALN
Transcript ENSMUST00000114082
Sequence
ACGTCGGCGGCGGCACCTGGAGCCGGATGTGCCAAGATGGCTGCGGCTGCTGCTGGGAACGCGCTAGTTCCCCCTACTGCCGCCGCCGTCGCCGGCTGGG

TTTCAGTTCGCGGCGCCTGAGAAGCCAACCACAGCTCACAGG - UNI6163 - CACAAATTAAAGAAAAGCTCTACTCTGCCCCCTTGATAAGCAGCA

TCTCCTTGTGGAAAAGACTCCAACATGCAGCCACCACCTCAGGCAGTCCCGTCTGGGGTGGCTGGACCACCCCCAGCTGGGAATCCTCGGAGCATGTTCT

GGGCCAACAGCCCTTACAGGAAGCCAGCCAATAATGCACCAGTGGCTCCCATAACACGCCCATTGCAGCCAGTAACGGATCCGTTTGCTTTTAATAGACA

GACTCTTCAAAACACACCAGTAGGAAGTTCATCCAAAAGCAGCCTGCCCAATTTGCCTGGCCCAGCCCTCTCTGTTTTTTCTCAGTGGCCTGGTTTGCCT

GTGACTCCCACAAATGCTGGGGATAGCTCCACAGGATTGCATGAGCCTCTGTCAGGAACTCTGTCACAGCCTAGAGCAGATGCCAGTCTATTTCCTCCTG

CATCTACCCCTTCTTCACTCCCTGGGCTGGAGGTGAGCAGGAATGCTGAGGCTGATCCCAGCTCAGGACATGAAGTCCAGATGCTGCCACATTCAGCTCA

CTACATTCCAGGAGTGGGTCCTGAGCAGCCTCTCGGGGGCCAAATGAATGACAGTGGGTCCGGGCCTGACCAACCCATGAATAGGCATGCCCCCCATGAT

GGTGCCGTGACCCACGCAGCATCTCCTTTCCTCCCTCAGCCACAGATGCCAGGTCAGTGGGGGCCTGCACAAGGAGGCCCTCAGCCCTCCTATCAGCATC

ACTCACCCTACCTGGAGGGACCTGTTCAGAACATGGGGCTCCAGGCTGCCAGCTTGCCCCATTTTCCCCCTCCATCTAGTCTACACCAGGGACCTGGCCA

TGAGTCTCATGCCCCACAAACATTTACTCCAGCATCCTTGGCCAGTGGTGAAGGGAATGAGATAGTTCACCAGCAAAGTAAAAATCACCCATTGAGTAGC

TTCCCCCCTAAACACACTTTTGAGCAGAATTCCAGAATTGGGAATATGTGGGCAAGCCCAGAGTTGAAGCAGAATCCGGGAGTGAATAAAGAGCATCTGC

TAGACCCTGCCCATGTCAATCCCTTCACTCAGGGAAATAGTCCTGAAAACCAGGCGCATCATCCCCCAGTGGCAGCAACTAACCATGCCCTGCAAGAAGC

AGCCTCTGGAGCTCTCTCAATGTTTTTTCAAGGGGAAGAGACAGAGAATGAGGAAAATCTCTCATCTGAAAAAGCAGGCCTCGATAAGAGATTGAACTTG

GATAGCTTTTCTTCTACCTCCAGACTGGGCCATCCACCACCACCTGGAGCTAGTGGTGTCTACCAGGCCTTTCCTAGAGGCCCTAGCAGTGAGGCTGCGC

AGGAAGGAGATGCGCAACCTTATTTTTCGCAGTCTGTGGGCGTCCGTCTTGACAAACAGAGCACTGTGCCCCCTGCTAATGATGCATGGGGTGATGTTCC

GGGGACCGGGACCCGCTGTGCCAGTGGGCCACAGTGTGAGAATGTTGAGAACTTAGAATTTGTTCAGAATCAAGAAGTTTTGCCCCGTGAGACCCTGAGT

GTGGATCCCTTCCCCCTGAGTGATCAGATCCGATATGGGCCCCTTCCTGGGCCAGCTGCCTCCAGGCCTGCTACTGTGGGCCTCACCAGAGGTGGGGGGC

TAAATCTTGAGGCCCCAGACACACCACTGCACCCTACACGACCTGACAGTGTGTCATCCAGCTACAGCAGCCATAGCCACAGAAGTCCTCCTGGGTCAGC

CAGACCCCAAGAATTGGTGGGCACATTCATTCAGCAAGAAGTTGGGAAACTTGAAGATGATACTTCAGGGAGTTTTTTTAAGCAAATTGATTCTTCTCCT

GTTGGAGGTGAAACAGATGAGGTGACTGGGAGCCAAAATTGCTGCAGCAGTCTGTCCCAGCCTTCAACCCCAAGCCCTCCAAAACCTACAGGAGTATTCC

AAACAAGTGCAAACAGTTCTTTTGAGCCAGTAAAATCCCACTTGGTTGGAGTGAAACCAGTTGAAGCAGATCGTGCCAACATGGTGGTTGAAGTGAGAGG

GACCCAATACTGTCCGAAGAAGCGCAGGGCAGCTGTTGCACCACCTGATGCTACCTCAGGAAACCTGGAACAGCCACCAGACAACATGGAGACCCCGTGT

GCACCTCAGGCCTGCCCTTTGCCTCTTAGCACCACTGGAGAGGCTGGGCAACTGGTTTCAAACACGGCAGGGACACCCCTGGATACTGTGCGCCCAGTGC

CTGATAAGAGGCCCTCAGCCAGGGCCCAGGGACCTGTGAAGTGTGAGAGCCCAGCAACAACTCTGTGGGCACAAAATGAGCTGCCAGATTTTGGTGGCAA

TGTCCTTCTAGCCCCTGCTGCCCCTGCACTTTATGTTCCTGTAAAACCAAAACCTTCAGAGGTTGTTCATCATCCAGAAAAGGGAATGTCTGGACAGAAG

GCCTGGAAACAAGGGTCTGTGCCACCTTTGCAGAACCAAGACCCTCCTGGTGCTTCTGAGAACCTTGAGAACCCTCCCAAGGTAGGAGAAGAGGAGGCCC

TTCCAGTGCAGGCAAGTTCTGGTTATGCGAGTTTGCTTTCTTCGCCACCCACTGAATCTTTGCACAATCAACCTGTCCTGATTGCTCAGCCTGATCAAAG

CTATAATTTGGCTCAGCCTATTAATTTTTCTGTGTCCTTACTGAATCCTAATGAGAAGAATCAGTCCTGGGGAGATGCTGTGGTGGGGGAGAGATCCATA

GTGAGCAACAACTGGGCTCTCGGTGGTGATCCTGAAGAACGTGCTGCTCTGTCTGGAGTTCCAGCCAGTGCTGTCACTGGCGCGTCTTTGCCTAGCAGTA

TCCCCCAGAATTGTGCCCCTCAAGGTTCGGGGTCTTCTGAAATGATTGCTAGCCAGTCTGCCAGTTGGTTGGTTCAACAGCTATCCCCTCAAACCCCTCA

AAGTCCGCATCCAAATGCAGAAAAGGGCCCTTCCGAGTTTGTTAGTAGCCCTGCTGGCAATACAAGTGTGATGCTAGTTCCACCTGCAAGCAGTACTTTG

GTTCCTAACAGTAATAAGGCAAAGCACTCTAGTAACCAGGAAGAAGCTGTTGGCGCCCTAGACTTCACATTAAATAGAACTTTGGAAAATCCTGTGAGAA

TGTACAGCCCATCTCCTTCAGATGGCCCAGCTTCTCAGCAGCCTCTTCCCAATCATCCCAGACAATCTGGGCCTGGGCTGCATAACCAGGATCATTTCTA

CCAGCAGGTAACAAAAGATGCTCAGGACCAGCATAGACTAGAAAGAGCCCAGCCAGAGCTGGTGCCTCCTCGGCCACAGAATTCTCCCCAAGTGCCCCAA

GCATCGTGTCCAGAGCCTTCAAATCCTGAAAGCCCACCCACACAAGGACAGTCTGAAAGCTTGGCCCAGCCACCAGCAAGTCCAGCTTCAGTCAACACAG

GCCAGCTGCTGCCTCAGCCACCACAGGCTTCCAGTGCATCCGTTACATCTACCAACTCCAGCCAGGCAGCTGTGCGGTCAGAGCAGCTGTGGCTACACCC

ACCACCTCCTAATACTTTTGGCCCAGCACCTCAAGACTTGGCATCCTACTACTATTACAGACCCCTGTATGATGCCTACCAGTCTCAGTACCCTTCACCG

TACCCGTCAGATCCTGGGACAGCCTCGCTGTACTACCAG GATATGTATGGCCTGTATGAGCCTCGTTACAGACCCTATGACAGCTCAGCATCTGCTTAT

GCCGAGAACCACCGCTATTCTGAGCCTGAGCGGCCCAGCTCCCGTGCAAGTCACTATTCCGACCAGCTTGCTCCCAG GCAAGGATATCCTGAAGGATAC

TATAATTCCAAGAGTGGATGGAGCAGTCACAGTGATTACTATGCAAATTATTACTCTGGCCAGTATGATTATGGAG - UNI440 - ACCCCAGCCGCT

GGGATCGTTACTATGGGTCTCGCCTTAGGGATCCTCGCACCTGGGACCGGAGGTACTGGTATGACTCTGAACATGACCCATACAGGAAGGACCACTATGC

TTACAGTGACAG GCCTGAGAAATGTGATGATCACTGGAGGTATGACCCTCGCTTCACTGGGAGCTTCGACGATGACGCTGAGATCCACAGGGACCCCTA

TGGAGAAGAAGCAGACAGACGCAGCATCCACAGTGAGCACTCGGCACGGAGCCTGCGCAGCACTCACAGTCTGCCCAGCCGCCGCAGCAGCCTCAGCTCC

CATTCACACCAG AGTCAGATTTACAGAAGCCACCATGTGACTGGCGGTTCCTTTGAGGCCCCTCATGCCCCAGGCTCATTTCATGGTGATTATGCCTAT

GGCACATATGCCAGCAATTTCAGCGGTGCCCATGGTTTTCCAGAGTACAGCTACCCTGCAGACACCTCCTGGCCTGCTGTGGAGCAAG TTCCATCAAGA

CCGACCTCTCCTGAGAAGTTTACGGTGCCTCATGTCTGTGCCAGGTTTGGTCCTGGTGGTCAGCTCCTTAAAGTGATTCCCAACCTGCCTTCAGAAGGAC

AGCCTGCACTGGTGGAGATCCACAGCTTAGAG ACCTTGCTGCAGCACACACCTGAGCAGGAAGAGATGCGCTCCTTCCCAGGACCTCTCGGCAA AGAT

GATACCCACAAAGTAGATGTTATTAACTTTGCACAGAACAAAGCAACAAAATGTTTGCAGAATGAAAGTTTAATTGATAAAGAGTCTGCAAGTCTTCTTT

GGAAATTCATTATTCTGTTATGCAGACAGAATGGG ACTGTTGTGGGAACAGACATTGCAGAGCTTTTGTTACGGGACCATAGAACTGTATGGCTTCCTG

GGAAGTCACCCAATGAGGCAAACCTGATAGATTTTACCAATGAGGCTGTGGAACAAGTGGAAGAGGAGGAGTCAGGGGAGGCCCAGCTCTCATTTCTCAC

AGACAGTCAGACAGTGACCACCAGCGTGCTGGAGAAGGAGACTGAGCGGTTCCGTGAGCTCTTGCTGTATGGCCGGAAGAAG GATGCTCTGGAGTCTGC

CATGAAAAATGGCTTATGGGGTCATGCTCTTCTGCTTGCAAGTAAGATGGACAGCCGGACACATGCCCGTGTCATGACCAG GTTTGCCAACAGTCTTCC

AATCAATGACCCCCTGCAGACTGTCTACCAGCTCATGTCTGGACGGATGCCTGCTGCATCCACG TGTTGTGGCGATGAGAAGTGGGGAGATTGGAGGCC

ACATCTTGCAATGGTTTTGTCCAACCTGAACAACAACATGGATGTTGAATCTAGGACCATGGCTACGATGGGTGATACTCTAG CATCAAAAGGCCTGTT

GGATGCTGCACACTTCTGCTACCTGATGGCCCAGGTTGGATTTGGGGTTTATACAAAGAAAACTACAAAACTTGTCTTGATAGGCTCAAATCACAG TTT

GCCCTTTTTAAAGTTTGCCACCAATGAAGCCATTCAAAGGACGGAGGCTTATGAGTATGCTCAGTCCCTTGGGGCACATACCTGTTCCTTACCTAACTTC

CAG GTGTTTAAATTCATCTACTTGTGCCGCCTGGCTGAAATGGGACTTGCCACACAGGCCTTCCACTACTGCGAAGTAATAGCCAAGAGTGTCCTGACA

CAGCCTGGTGCATACTCTCCAGTACTGATTAGCCAGTTGACTCAG - UNI2146 - ATGGCTTCCCAGTTACGCCTCTTCGATCCTCAACTGAAGGAG

AAGCCAGAAGAGGAGTCCTTTGTGGAGCCTGCCTGGTTGGTGCAGCTGCAGCACGTGGAGAGGCAGATCCAG GAGGGCACTGTGCTGTGGAGCCAGGAT

GGAACTGAACCCCAGCAGTGTCGCATTACATCGGGCTCTGAGGTGGAGCAGTCAGATGGCCCTGGACTCAACCAGCAGGCAGGGCCACAGGCCGACAACC

CTCTACTGATGCCAAGCACTGAGCCTTTGATGCATGGCGTGCAACTGCTGCCCACAG CTCCTCAGACATTGCCTGATGGCCAGCCTGCTCACCTTTCCA

GGGTGCCGATGTTCCCAGTGCCAATGTCTCGTGGGCCCCTGGAGCTGAGTCCTGCCTATGGACCCCCAGGATCTGCACTTGGCTTCCCAGAATCCTCCAG

ATCTGATCCTGCAGTGCTGCATCCTGGGCAGGCCCTGCCACCCACTACACTAAGTCTCCAGGAAAGTGGGCTTCCACCCCAGGAGGCCAAAAGTCCAGAC

CCAG AAATGGTGCCACGGGGCTCACCTGTCAGACACTCCCCTCCGGAGCTCAGTCAAGAGGAGTTTGGCGAGAGCTTCGCTGACCCG - UNI6038 -

 GGCTCTTCCAGAACAGCACAGGACTTGGAAACCTCCCCAGTGTGGGATCTTGGCAGCTCCAGTTTGACACGTGCACCATCTTTGACATCTGATTCTGAA

GGGAAGAAACCTGCACAGGCTGTCAAAAAGGAGCCCAAGGAGCCCAAGAAG ACTGAGTCCTGGTTCTCTCGTTGGCTGCCTGGAAAAAAAAGGACAGAA

GCTTATCTACCAGATGACAAGAACAAATCA ATTGTTTGGGATGAAAAGAAAAACCAGTGGGTGAATTTGAATGAACCAGAGGAGGAG AAGAAGGCTCC

ACCCCCACCTCCAACATCGTTCCCCAGGGTTCCCCAGGTGGCTCCCACTGGGCCTGCAGGACCACCCACGGCCTCCGTGAATGTGTTTTCTAGAAAAGCA

G GTGGGTCCAGAGCTCGCTATGTGGATGTTCTAAACCCAAGTGGAACACAGCGGAGTGAACCAGCTCTTGCTCCTGCAGATTTCTTTGCTCCTCTCGCC

CCACTGCCAATTCCTTCTAACTTATTTGTACCAAACCCAG ATGCAGAAGAGCCACAACCTGCAGATGGGACTGGCTGTAGGGGACAGGCACCAGCTGGG

ACTCAGTCTAAGGCAGAGTCCACCCTGGAACCCAAG GTGGGAAGTTCTACAGTATCAGCCCCTGGACCTGAGCTCTTACCCTCCAAACCAGATGGCTCC

CAAGGAGGAGAG CTCTCGCGTTGTAGCTCTCTGAGCTCGCTCTCACAGGAAGTGAGCCGGCATTTCCATCAG GCTCCTGGAGACCATTGTCCTACAGG

GGCCCCTCATGGTGGGTCTGTGCCCTTTTACAACCCTGCTCAGTTGGTGCAG GCTTCTGTCACCTCGGGAAATTCAAGGCCAGGGAGGATTGGCCAAAG

AAAATATGCGGCATTGAACTAGGATTGCTGCTGGATTCTTATTTGGAACCCTGAGATGATTAGATAACTGTTCTTCACCAAGAACCAACTAGCTGCCTCA

GGTCTCGTGGATCCCAGATGGACATGGCAGTAACTCAGAGCCGGTCATACTGTGTGTCTCCTTCCTTGCAGCCTATGTATATGAATGATTGAAAAATTGA

TTTCAAGGTTCCTTTCAAATGCTGGATAGAATGAATCTAATTCAAAGTCTTTTATGTAAAAGAACAATGTTTCTTTTTTAGTCACTTTAGACAAATTAAG

GTTTGAGCCACTTGAGAATATCCCCGCAGAGAGGCTAGGCAGGGATTCACTACAGGAGAGCACAGTTACTTGGACACCAAGGCCTTTCTCACCTGAGAAA

TGGTGCAAACCAACCAGGGATCCTTAGGCTACTGAGAAGGCTGTCTGCTTACCTGGAGAGGACTGACTGCTGGGATGTCTGGCCTAAGAGGAGCCTCAAA

CTGCACTGGGCAACTGTGCCTTGTCCTGTGAACTGGGGAGTACATGCCAGCTCCTCAAAGGGTCACCAGATGGCAGCGGCTCCCAGGCTGGGGAGGAAGT

GGTTACAAGGGCATGTCTCTCCAACATTTCCAGCCTCACTCCATTTTCTGTGGCCTCATTAGTGCTGGGTGCGTTTTTTTTTTGCTCCGAGCTTTCCGTC

ATGGCTCAGTCACTGGGGAGAGCCCCAGGGAGCTGATATTCTGAAGCTGCTGATCTGATTAACCAGGTCAAAAACTGGCTGTGTGCTGCAACGTACTGCC

CTCCTAGCCAGGAGTCTGTATGGAGCCCTCTAGCTGACTCAATGTCACCTGCAGACAGCACTTAAAGCCTTGGTGGTATCTTGGAGTGGCTTACGGTGTC

CTAGCGCACACTCTGGAACCTTGCATCTCTACCCCAAAGCCCACCAGGGACCTTCAGCAGCGACTCACTGGCTCACCCATATCACTTCAAGGAGCTGCCA

CCACATAAGAGTCAAAGCTTTAAGGCTTCACTGACTGTTCCTAAAACTATCCTTACACTCTAAAGAGGAAGGGAAAGAGAGTTAAATATTTAAAAATCAG

CAGGTAGAAAACATAAATGGTTTGTTTGGTATTAAATTTAGAAATTGTAGAACATGGAATTAGTACAGCCCTTCCCGGTTTTCTGGTTCCTTGCATCATC

TAGGAAAGACTCACAGAATGGCTTCCAGGACGTTCCATAGATGAGTGTACTTGGACCCTCCTGTTCCTGTCATTAAGAAAGGCCTGTCCCTGTGGGTCAG

TAGCAACTTGTGTCCTTGCTGGGACCAGGCAGGACCCTTGCCTCTGGTTCAACCCTGCCCAGGCTCTGTGTTGACTGCCAACCACTTTGGATTCAAGAAG

CTTCCTCCCTGGGAGCTGCTATTTTTCCAAAATTCACATTGTTAAATAAAATATTTTGGGCTCTCAAGTAACTT
Translation
 - UNI6163 - MQPPPQAVPSGVAGPPPAGNPRSMFWANSPYRKPANNAPVAPITRPLQPVTDPFAFNRQTLQNTPVGSSSKSSLPNLPGPALSVFSQ

WPGLPVTPTNAGDSSTGLHEPLSGTLSQPRADASLFPPASTPSSLPGLEVSRNAEADPSSGHEVQMLPHSAHYIPGVGPEQPLGGQMNDSGSGPDQPMNR

HAPHDGAVTHAASPFLPQPQMPGQWGPAQGGPQPSYQHHSPYLEGPVQNMGLQAASLPHFPPPSSLHQGPGHESHAPQTFTPASLASGEGNEIVHQQSKN

HPLSSFPPKHTFEQNSRIGNMWASPELKQNPGVNKEHLLDPAHVNPFTQGNSPENQAHHPPVAATNHALQEAASGALSMFFQGEETENEENLSSEKAGLD

KRLNLDSFSSTSRLGHPPPPGASGVYQAFPRGPSSEAAQEGDAQPYFSQSVGVRLDKQSTVPPANDAWGDVPGTGTRCASGPQCENVENLEFVQNQEVLP

RETLSVDPFPLSDQIRYGPLPGPAASRPATVGLTRGGGLNLEAPDTPLHPTRPDSVSSSYSSHSHRSPPGSARPQELVGTFIQQEVGKLEDDTSGSFFKQ

IDSSPVGGETDEVTGSQNCCSSLSQPSTPSPPKPTGVFQTSANSSFEPVKSHLVGVKPVEADRANMVVEVRGTQYCPKKRRAAVAPPDATSGNLEQPPDN

METPCAPQACPLPLSTTGEAGQLVSNTAGTPLDTVRPVPDKRPSARAQGPVKCESPATTLWAQNELPDFGGNVLLAPAAPALYVPVKPKPSEVVHHPEKG

MSGQKAWKQGSVPPLQNQDPPGASENLENPPKVGEEEALPVQASSGYASLLSSPPTESLHNQPVLIAQPDQSYNLAQPINFSVSLLNPNEKNQSWGDAVV

GERSIVSNNWALGGDPEERAALSGVPASAVTGASLPSSIPQNCAPQGSGSSEMIASQSASWLVQQLSPQTPQSPHPNAEKGPSEFVSSPAGNTSVMLVPP

ASSTLVPNSNKAKHSSNQEEAVGALDFTLNRTLENPVRMYSPSPSDGPASQQPLPNHPRQSGPGLHNQDHFYQQVTKDAQDQHRLERAQPELVPPRPQNS

PQVPQASCPEPSNPESPPTQGQSESLAQPPASPASVNTGQLLPQPPQASSASVTSTNSSQAAVRSEQLWLHPPPPNTFGPAPQDLASYYYYRPLYDAYQS

QYPSPYPSDPGTASLYYQ DMYGLYEPRYRPYDSSASAYAENHRYSEPERPSSRASHYSDQLAPR RQGYPEGYYNSKSGWSSHSDYYANYYSGQYDYGD

 - UNI440 - DPSRWDRYYGSRLRDPRTWDRRYWYDSEHDPYRKDHYAYSDR RPEKCDDHWRYDPRFTGSFDDDAEIHRDPYGEEADRRSIHSEHSA

RSLRSTHSLPSRRSSLSSHSHQ SQIYRSHHVTGGSFEAPHAPGSFHGDYAYGTYASNFSGAHGFPEYSYPADTSWPAVEQV VPSRPTSPEKFTVPHVC

ARFGPGGQLLKVIPNLPSEGQPALVEIHSLE TLLQHTPEQEEMRSFPGPLGK KDDTHKVDVINFAQNKATKCLQNESLIDKESASLLWKFIILLCRQN

G TVVGTDIAELLLRDHRTVWLPGKSPNEANLIDFTNEAVEQVEEEESGEAQLSFLTDSQTVTTSVLEKETERFRELLLYGRKK DALESAMKNGLWGHA

LLLASKMDSRTHARVMTR RFANSLPINDPLQTVYQLMSGRMPAAST CCGDEKWGDWRPHLAMVLSNLNNNMDVESRTMATMGDTLA ASKGLLDAAHF

CYLMAQVGFGVYTKKTTKLVLIGSNHS SLPFLKFATNEAIQRTEAYEYAQSLGAHTCSLPNFQ VFKFIYLCRLAEMGLATQAFHYCEVIAKSVLTQPG

AYSPVLISQLTQ - UNI2146 - MASQLRLFDPQLKEKPEEESFVEPAWLVQLQHVERQIQ EGTVLWSQDGTEPQQCRITSGSEVEQSDGPGLNQQA

GPQADNPLLMPSTEPLMHGVQLLPTA APQTLPDGQPAHLSRVPMFPVPMSRGPLELSPAYGPPGSALGFPESSRSDPAVLHPGQALPPTTLSLQESGLP

PQEAKSPDPE EMVPRGSPVRHSPPELSQEEFGESFADP - UNI6038 - GSSRTAQDLETSPVWDLGSSSLTRAPSLTSDSEGKKPAQAVKKEPKEP

KK TESWFSRWLPGKKRTEAYLPDDKNKS IVWDEKKNQWVNLNEPEEE KKAPPPPPTSFPRVPQVAPTGPAGPPTASVNVFSRKAG GGSRARYVDVL

NPSGTQRSEPALAPADFFAPLAPLPIPSNLFVPNPD DAEEPQPADGTGCRGQAPAGTQSKAESTLEPK VGSSTVSAPGPELLPSKPDGSQGGE LSRC

SSLSSLSQEVSRHFHQ APGDHCPTGAPHGGSVPFYNPAQLVQ ASVTSGNSRPGRIGQRKYAALN

For any suggestions or comments, please send an email to unitrap@crg.es