Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026927 (Sdccag3)
Chromosomal location
Chr 2: 26238323 - 26244806 (-)
Description
serologically defined colon cancer antigen 3 Gene [Source:MGI (curated);Acc:Sdccag3-002]
RefSeq_peptide
NP_001078877.1 NP_001078876.1 NP_080839.2 
UniGene
Mm.253771 
MGI
MGI:1915362 
Uniprot/SWISSPROT
A2AIW0 
Uniprot/SPTREMBL
A2AIW4 A2AIW3 
Human Ortholog
ENSG00000165689 (SDCCAG3)
Omim not available
UniTrap UNI36423
Vector Insertion
Chr 2: 26243075 - 26244081
Public Clones IST10950A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4937
Vector Insertion
Chr 2: 26242832 - 26243075
Public Clones AM0868 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114097
Sequence
TCCAGCCTCAGAAGACAGCTTTCTAGTCCCAGACTCAGTGGGAGTCAGGCGTCTGCGGTCTTCACCTCCCTGGACAAACGCTGCAGTCATAAGGCTTGCT

GTGATCACG - UNI36423 - GTGACAAACTTGAAGACCTTGAAGAAGCCAATCCATTCTCCTTCAAAGAGTTTTTGAAAACCAAGAACCTCAGCCTG

TCAAAAGAAGACACGACCACCAGCCGAATTTACCCAAAG - UNI4937 - - UNI36423 - GAAGCCTCAAGGCACCCACTGGGACTAGAGCACAG

CTCCCCTGCCTCCCAGCTCATGGGATATGGCCTGGAATCTCAGCAGCCATTTTTTGAAGACCCAACAAGAGCCAGCAACCTAGAGGAGGATGAAGATGAT

GGATGGAATATAACCTACTTGCCATCTGCCGTGGATCAGACTCATTCCTCTAGAGACACACAGGACTCACCGCCCTGTGACACCTACCTTTCCTTTTTCT

CCAACTCGTCAGAGCTGGCATGTCCCGAGTCTTTGCCCCCATGGACGCTGAGTGACACCGACTCCAGGATCTCCCCAGCGTCTCCAGCTGGGAGTCCTAA

TGCAGACTTTGCAGCTCATGAAGAATCCCTAGGGGACAGACACCTGCGGACGCTGCAGATAAGTTATGAAGCA CTGAAAGATGAAAACTCTAAGCTCAG

AAGAAAGCTAAATGAGGTTCAGAGCTTCTCTGAAACTCAAACAGAAAT GGTGAGGACACTCGAACGGAAGTTGGAGGCGAAGATGATCAAGGAGGAGAG

TGACTTCCATGACCTCGAGTCAGTAGTCCAGCAAGTCGAACAGAACCTTGAACTGATGACC AAACGGGCTGTAAAAGCAGAAAATCATGTCTTGAAGCT

GAAACAGGAAATAAATTTGCTTCAG GCCCAGCTCTCAAACTTGAGGCGAGAAAATGAAGCCCTGCGGTCAGGCCAGGGTGCCAGCCTTTCTGTAGTGAA

GCAGAACACCGACGTGGCCTTGCAGAACCTCCACCTTGTCATGAACAGTGCACACGCATCCATAAA GCAGCTGGTGTCTGGGGCAGACACACTGAACCT

TGTTGCTGAAATCCTCAAGTCTATCGACAGAATTAGTGAAGTTAAAGATGAGGTGGACTCTTGAGACGCTCTACCTGCCACCGGGTCCCGTCACCTCTGC

ACCGAAGGCACCACACATCTTCCGAATGTGTTCCTGTCTATGCAGTCCTCATCAAAGCATTTCACGGCCTAATCATGTGACTGGCCATCTGCAGTACGGG

GCTCCTTTCCACCAGTTGAACCTAACAGTTTACATGAAGTCCCACTGTTCGATAGACTCACTGATTTACTGGAAGACACTTTTATAAAACCACTAAAGCT

GAAACGACAGTTTTGTAACAAGCTTCTTTCACCACCCTCTCTAGGACGAGGTCGGGCTCAGCCTCAGTGTTGTCAAGTGGAACACGAAGTGAGCCAGTGT

GTAAGTGAGCAGCCTGTACAGAGACGCGTGCCTCACTGAGGCAGCACCGCTTGGTACGTGCTGCCGTCCTCCCACCAGGACCATAGGACCAAGGTCACAC

ACTGTGCACAGTGCAAAGCTTCATACACCCTCTACTGTGTGCTGTCAGCTTTGGAAAGCCATTTGGGGCTGTCGATTTTGATGCACGTTAATGTGTTTGT

GTGCCTTTTGTATAGTGCAATTCAGACTGGAATTAAAGCACACACCCACCTGGGGGGTCAGCACCAGCTCTTTGGGCTGGCTGGCTGGTTTTTGAAGGAC

AGGCAAGACATAAGCAGCTCCCTGTGCTGTGCTGAGGGGTCAAGGTTTGGGGGCCACTTTCCTATAGGTTGTTTTTTTGTTTTTTTTTTTTAATTTATTT

TCCCTTTTCCCCTCCTGTTGAGATCAACAGCTTTCTGATCTAAATAAATCTTAAAGATC
Translation
SSLRRQLSSPRLSGSQASAVFTSLDKRCSHKACCDHG - UNI36423 - GDKLEDLEEANPFSFKEFLKTKNLSLSKEDTTTSRIYPK - UNI4937

 - - UNI36423 - EASRHPLGLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQDSP     
Transcript ENSMUST00000100296
Sequence
GCCGGATGAGGCAGGGGCCGGCGACTGCCTTGCGGGCCATGGGGCCGCGGCCGGGTTAGGGCGCGGCGATGTCGGGCTACGCGCGGCGGCAGGGCGCGCC

CCCTCTATCGCGGACGCGGAGCCTTGTGGTTCCCGACG CTCCTGCGTTCTATGAGCGCCGGTCTTGTCTCCCCCAGCTAGACTGTGAGCGCCCCCATGG

CGGGGACCTGCACCCCCATCTCTTCGGCTTTCGGCCGACGTTTATGTGCTATGTGCCCAGCCCGGTGCTGGCTTCGGTAGGAGACACAG - UNI36423

 - GTTTTGGCTATGGAAAGGGGAAATGTACTAACCAAGGTCCTTCGGGAGCCCCTGAGACGCGCTTTGGAG - UNI36423 - GTGACAAACTTGAA

GACCTTGAAGAAGCCAATCCATTCTCCTTCAAAGAGTTTTTGAAAACCAAGAACCTCAGCCTGTCAAAAGAAGACACGACCACCAGCCGAATTTACCCAA

AG - UNI4937 - - UNI36423 - GAAGCCTCAAGGCACCCACTGGGACTAGAGCACAGCTCCCCTGCCTCCCAGCTCATGGGATATGGCCTGGAA

TCTCAGCAGCCATTTTTTGAAGACCCAACAAGAGCCAGCAACCTAGAGGAGGATGAAGATGATGGATGGAATATAACCTACTTGCCATCTGCCGTGGATC

AGACTCATTCCTCTAGAGACACACAGGACTCACCGCCCTGTGACACCTACCTTTCCTTTTTCTCCAACTCGTCAGAGCTGGCATGTCCCGAGTCTTTGCC

CCCATGGACGCTGAGTGACACCGACTCCAGGATCTCCCCAGCGTCTCCAGCTGGGAGTCCTAATGCAGACTTTGCAGCTCATGAAGAATCCCTAGGGGAC

AGACACCTG GGACGCTGCAGATAA
Translation
MSGYARRQGAPPLSRTRSLVVPDA APAFYERRSCLPQLDCERPHGGDLHPHLFGFRPTFMCYVPSPVLASVGDTG - UNI36423 - GFGYGKGKCT

NQGPSGAPETRFGG - UNI36423 - GDKLEDLEEANPFSFKEFLKTKNLSLSKEDTTTSRIYPK - UNI4937 - - UNI36423 - EASRHPL

GLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFFSNSSELACPESLPPWTLSDTDSRISPASP

AGSPNADFAAHEESLGDRHL GRCR
Transcript ENSMUST00000057204
Sequence
ATGTGCTATGTGCCCAGCCCGGTGCTGGCTTCGGTAGGAGACACAG - UNI36423 - GTTTTGGCTATGGAAAGGGGAAATGTACTAACCAAGGTCC

TTCGGGAGCCCCTGAGACGCGCTTTGGAG - UNI36423 - GTGACAAACTTGAAGACCTTGAAGAAGCCAATCCATTCTCCTTCAAAGAGTTTTTGA

AAACCAAGAACCTCAGCCTGTCAAAAGAAGACACGACCACCAGCCGAATTTACCCAAAG - UNI4937 - - UNI36423 - GAAGCCTCAAGGCAC

CCACTGGGACTAGAGCACAGCTCCCCTGCCTCCCAGCTCATGGGATATGGCCTGGAATCTCAGCAGCCATTTTTTGAAGACCCAACAAGAGCCAGCAACC

TAGAGGAGGATGAAGATGATGGATGGAATATAACCTACTTGCCATCTGCCGTGGATCAGACTCATTCCTCTAGAGACACACAGGACTCACCGCCCTGTGA

CACCTACCTTTCCTTTTTCTCCAACTCGTCAGAGCTGGCATGTCCCGAGTCTTTGCCCCCATGGACGCTGAGTGACACCGACTCCAGGATCTCCCCAGCG

TCTCCAGCTGGGAGTCCTAATGCAGACTTTGCAGCTCATGAAGAATCCCTAGGGGACAGACACCTGCGGACGCTGCAGATAAGTTATGAAGCA CTGAAA

GATGAAAACTCTAAGCTCAGAAGAAAGCTAAATGAGGTTCAGAGCTTCTCTGAAACTCAAACAGAAAT GGTGAGGACACTCGAACGGAAGTTGGAGGCG

AAGATGATCAAGGAGGAGAGTGACTTCCATGACCTCGAGTCAGTAGTCCAGCAAGTCGAACAGAACCTTGAACTGATGACC AAACGGGCTGTAAAAGCA

GAAAATCATGTCTTGAAGCTGAAACAGGAAATAAATTTGCTTCAG GCCCAGCTCTCAAACTTGAGGCGAGAAAATGAAGCCCTGCGGTCAGGCCAGGGT

GCCAGCCTTTCTGTAGTGAAGCAGAACACCGACGTGGCCTTGCAGAACCTCCACCTTGTCATGAACAGTGCACACGCATCCATAAA GCAGCTGGTGTCT

GGGGCAGACACACTGAACCTTGTTGCTGAAATCCTCAAGTCTATCGACAGAATTAGTGAAGTTAAAGATGAGGTGGACTCTTGAGACGCTCTACCTGCCA

CCGGGTCCCGTCACCTCTGCACCGAAGGCACCACACATCTTCCGAATGTGTTCCTGTCTATGCAGTCCTCATCAAAGCATTTCACGGCCTAATCATGTGA

CTGGCCATCTGCAGTACGGGGCTCCTTTCCACCAGTTGAACCTAACAGTTTACATGAAGTCCCACTGTTCGATAGACTCACTGATTTACTGGAAGACACT

TTTATAAAACCACTAAAGCTGAAACGACAGTTTTGTAACAAGCTTCTTTCACCACCCTCTCTAGGACGAGGTCGGGCTCAGCCTCAGTGTTGTCAAGTGG

AACACGAAGTGAGCCAGTGTGTAAGTGAGCAGCCTGTACAGAGACGCGTGCCTCACTGAGGCAGCACCGCTTGGTACGTGCTGCCGTCCTCCCACCAGGA

CCATAGGACCAAGGTCACACACTGTGCACAGTGCAAAGCTTCATACACCCTCTACTGTGTGCTGTCAGCTTTGGAAAGCCATTTGGGGCTGTCGATTTTG

ATGCACGTTAATGTGTTTGTGTGCCTTTTGTATAGTGCAATTCAGACTGGAATTAAAGCACACACCCACCTGGGGGGTCAGCACCAGCTCTTTGGGCTGG

CTGGCTGGTTTTTGAAGGACAGGCAAGACATAAGCAGCTCCCTGTGCTGTGCTGAGGGGTCAAGGTTTGGGGGCCACTTTCCTATAGGTTGTTTTTTTGT

TTTTTTTTTTTAATTTATTTTCCCTTTTCCCCTCCTGTTGAGATCAACAGCTTTCTGATCTAAATAAATCTTAAAGATC
Translation
MCYVPSPVLASVGDTG - UNI36423 - GFGYGKGKCTNQGPSGAPETRFGG - UNI36423 - GDKLEDLEEANPFSFKEFLKTKNLSLSKEDTT

TSRIYPK - UNI4937 - - UNI36423 - EASRHPLGLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQD

SPPCDTYLSFFSNSSELACPESLPPWTLSDTDSRISPASPAGSPNADFAAHEESLGDRHLRTLQISYEA LKDENSKLRRKLNEVQSFSETQTEM MVRT

LERKLEAKMIKEESDFHDLESVVQQVEQNLELMT KRAVKAENHVLKLKQEINLLQ AQLSNLRRENEALRSGQGASLSVVKQNTDVALQNLHLVMNSAH

ASIK KQLVSGADTLNLVAEILKSIDRISEVKDEVDS
Transcript ENSMUST00000077983
Sequence
GCCGGATGAGGCAGGGGCCGGCGACTGCCTTGCGGGCCATGGGGCCGCGGCCGGGTTAGGGCGCGGCGATGTCGGGCTACGCGCGGCGGCAGGGCGCGCC

CCCTCTATCGCGGACGCGGAGCCTTGTGGTTCCCGACG - UNI36423 - GTGACAAACTTGAAGACCTTGAAGAAGCCAATCCATTCTCCTTCAAAG

AGTTTTTGAAAACCAAGAACCTCAGCCTGTCAAAAGAAGACACGACCACCAGCCGAATTTACCCAAAG - UNI4937 - - UNI36423 - GAAGCC

TCAAGGCACCCACTGGGACTAGAGCACAGCTCCCCTGCCTCCCAGCTCATGGGATATGGCCTGGAATCTCAGCAGCCATTTTTTGAAGACCCAACAAGAG

CCAGCAACCTAGAGGAGGATGAAGATGATGGATGGAATATAACCTACTTGCCATCTGCCGTGGATCAGACTCATTCCTCTAGAGACACACAGGACTCACC

GCCCTGTGACACCTACCTTTCCTTTTTCTCCAACTCGTCAGAGCTGGCATGTCCCGAGTCTTTGCCCCCATGGACGCTGAGTGACACCGACTCCAGGATC

TCCCCAGCGTCTCCAGCTGGGAGTCCTAATGCAGACTTTGCAGCTCATGAAGAATCCCTAGGGGACAGACACCTGCGGACGCTGCAGATAAGTTATGAAG

CA CTGAAAGATGAAAACTCTAAGCTCAGAAGAAAGCTAAATGAGGTTCAGAGCTTCTCTGAAACTCAAACAGAAAT GGTGAGGACACTCGAACGGAAG

TTGGAGGCGAAGATGATCAAGGAGGAGAGTGACTTCCATGACCTCGAGTCAGTAGTCCAGCAAGTCGAACAGAACCTTGAACTGATGACC AAACGGGCT

GTAAAAGCAGAAAATCATGTCTTGAAGCTGAAACAGGAAATAAATTTGCTTCAG GCCCAGCTCTCAAACTTGAGGCGAGAAAATGAAGCCCTGCGGTCA

GGCCAGGGTGCCAGCCTTTCTGTAGTGAAGCAGAACACCGACGTGGCCTTGCAGAACCTCCACCTTGTCATGAACAGTGCACACGCATCCATAAA GCAG

CTGGTGTCTGGGGCAGACACACTGAACCTTGTTGCTGAAATCCTCAAGTCTATCGACAGAATTAGTGAAGTTAAAGATGAGGTGGACTCTTGAGACGCTC

TACCTGCCACCGGGTCCCGTCACCTCTGCACCGAAGGCACCACACATCTTCCGAATGTGTTCCTGTCTATGCAGTCCTCATCAAAGCATTTCACGGCCTA

ATCATGTGACTGGCCATCTGCAGTACGGGGCTCCTTTCCACCAGTTGAACCTAACAGTTTACATGAAGTCCCACTGTTCGATAGACTCACTGATTTACTG

GAAGACACTTTTATAAAACCACTAAAGCTGAAACGACAGTTTTGTAACAAGCTTCTTTCACCACCCTCTCTAGGACGAGGTCGGGCTCAGCCTCAGTGTT

GTCAAGTGGAACACGAAGTGAGCCAGTGTGTAAGTGAGCAGCCTGTACAGAGACGCGTGCCTCACTGAGGCAGCACCGCTTGGTACGTGCTGCCGTCCTC

CCACCAGGACCATAGGACCAAGGTCACACACTGTGCACAGTGCAAAGCTTCATACACCCTCTACTGTGTGCTGTCAGCTTTGGAAAGCCATTTGGGGCTG

TCGATTTTGATGCACGTTAATGTGTTTGTGTGCCTTTTGTATAGTGCAATTCAGACTGGAATTAAAGCACACACCCACCTGGGGGGTCAGCACCAGCTCT

TTGGGCTGGCTGGCTGGTTTTTGAAGGACAGGCAAGACATAAGCAGCTCCCTGTGCTGTGCTGAGGGGTCAAGGTTTGGGGGCCACTTTCCTATAGGTTG

TTTTTTTGTTTTTTTTTTTTAATTTATTTTCCCTTTTCCCCTCCTGTTGAGATCAACAGCTTTCTGATCTAAATAAATCTTAAAGATC
Translation
MSGYARRQGAPPLSRTRSLVVPDG - UNI36423 - GDKLEDLEEANPFSFKEFLKTKNLSLSKEDTTTSRIYPK - UNI4937 - - UNI36423

 - EASRHPLGLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFFSNSSELACPESLPPWTLSD

TDSRISPASPAGSPNADFAAHEESLGDRHLRTLQISYEA LKDENSKLRRKLNEVQSFSETQTEM MVRTLERKLEAKMIKEESDFHDLESVVQQVEQNL

ELMT KRAVKAENHVLKLKQEINLLQ AQLSNLRRENEALRSGQGASLSVVKQNTDVALQNLHLVMNSAHASIK KQLVSGADTLNLVAEILKSIDRISE

VKDEVDS
Transcript ENSMUST00000028293
Sequence
GCCGGATGAGGCAGGGGCCGGCGACTGCCTTGCGGGCCATGGGGCCGCGGCCGGGTTAGGGCGCGGCGATGTCGGGCTACGCGCGGCGGCAGGGCGCGCC

CCCTCTATCGCGGACGCGGAGCCTTGTGGTTCCCGACG - UNI36423 - GTTTTGGCTATGGAAAGGGGAAATGTACTAACCAAGGTCCTTCGGGAG

CCCCTGAGACGCGCTTTGGAG - UNI36423 - GTGACAAACTTGAAGACCTTGAAGAAGCCAATCCATTCTCCTTCAAAGAGTTTTTGAAAACCAAG

AACCTCAGCCTGTCAAAAGAAGACACGACCACCAGCCGAATTTACCCAAAG - UNI4937 - - UNI36423 - GAAGCCTCAAGGCACCCACTGGG

ACTAGAGCACAGCTCCCCTGCCTCCCAGCTCATGGGATATGGCCTGGAATCTCAGCAGCCATTTTTTGAAGACCCAACAAGAGCCAGCAACCTAGAGGAG

GATGAAGATGATGGATGGAATATAACCTACTTGCCATCTGCCGTGGATCAGACTCATTCCTCTAGAGACACACAGGACTCACCGCCCTGTGACACCTACC

TTTCCTTTTTCTCCAACTCGTCAGAGCTGGCATGTCCCGAGTCTTTGCCCCCATGGACGCTGAGTGACACCGACTCCAGGATCTCCCCAGCGTCTCCAGC

TGGGAGTCCTAATGCAGACTTTGCAGCTCATGAAGAATCCCTAGGGGACAGACACCTGCGGACGCTGCAGATAAGTTATGAAGCA CTGAAAGATGAAAA

CTCTAAGCTCAGAAGAAAGCTAAATGAGGTTCAGAGCTTCTCTGAAACTCAAACAGAAAT GGTGAGGACACTCGAACGGAAGTTGGAGGCGAAGATGAT

CAAGGAGGAGAGTGACTTCCATGACCTCGAGTCAGTAGTCCAGCAAGTCGAACAGAACCTTGAACTGATGACC AAACGGGCTGTAAAAGCAGAAAATCA

TGTCTTGAAGCTGAAACAGGAAATAAATTTGCTTCAG GCCCAGCTCTCAAACTTGAGGCGAGAAAATGAAGCCCTGCGGTCAGGCCAGGGTGCCAGCCT

TTCTGTAGTGAAGCAGAACACCGACGTGGCCTTGCAGAACCTCCACCTTGTCATGAACAGTGCACACGCATCCATAAA GCAGCTGGTGTCTGGGGCAGA

CACACTGAACCTTGTTGCTGAAATCCTCAAGTCTATCGACAGAATTAGTGAAGTTAAAGATGAGGTGGACTCTTGAGACGCTCTACCTGCCACCGGGTCC

CGTCACCTCTGCACCGAAGGCACCACACATCTTCCGAATGTGTTCCTGTCTATGCAGTCCTCATCAAAGCATTTCACGGCCTAATCATGTGACTGGCCAT

CTGCAGTACGGGGCTCCTTTCCACCAGTTGAACCTAACAGTTTACATGAAGTCCCACTGTTCGATAGACTCACTGATTTACTGGAAGACACTTTTATAAA

ACCACTAAAGCTGAAACGACAGTTTTGTAACAAGCTTCTTTCACCACCCTCTCTAGGACGAGGTCGGGCTCAGCCTCAGTGTTGTCAAGTGGAACACGAA

GTGAGCCAGTGTGTAAGTGAGCAGCCTGTACAGAGACGCGTGCCTCACTGAGGCAGCACCGCTTGGTACGTGCTGCCGTCCTCCCACCAGGACCATAGGA

CCAAGGTCACACACTGTGCACAGTGCAAAGCTTCATACACCCTCTACTGTGTGCTGTCAGCTTTGGAAAGCCATTTGGGGCTGTCGATTTTGATGCACGT

TAATGTGTTTGTGTGCCTTTTGTATAGTGCAATTCAGACTGGAATTAAAGCACACACCCACCTGGGGGGTCAGCACCAGCTCTTTGGGCTGGCTGGCTGG

TTTTTGAAGGACAGGCAAGACATAAGCAGCTCCCTGTGCTGTGCTGAGGGGTCAAGGTTTGGGGGCCACTTTCCTATAGGTTGTTTTTTTGTTTTTTTTT

TTTAATTTATTTTCCCTTTTCCCCTCCTGTTGAGATCAACAGCTTTCTGATCTAAATAAATCTTAAAGATC
Translation
MSGYARRQGAPPLSRTRSLVVPDG - UNI36423 - GFGYGKGKCTNQGPSGAPETRFGG - UNI36423 - GDKLEDLEEANPFSFKEFLKTKNL

SLSKEDTTTSRIYPK - UNI4937 - - UNI36423 - EASRHPLGLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQT

HSSRDTQDSPPCDTYLSFFSNSSELACPESLPPWTLSDTDSRISPASPAGSPNADFAAHEESLGDRHLRTLQISYEA LKDENSKLRRKLNEVQSFSETQ

TEM MVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMT KRAVKAENHVLKLKQEINLLQ AQLSNLRRENEALRSGQGASLSVVKQNTDVALQNL

HLVMNSAHASIK KQLVSGADTLNLVAEILKSIDRISEVKDEVDS
Transcript ENSMUST00000114100
Sequence
GCCGGATGAGGCAGGGGCCGGCGACTGCCTTGCGGGCCATGGGGCCGCGGCCGGGTTAGGGCGCGGCGATGTCGGGCTACGCGCGGCGGCAGGGCGCGCC

CCCTCTATCGCGGACGCGGAGCCTTGTGGTTCCCGACG CTCCTGCGTTCTATGAGCGCCGGTCTTGTCTCCCCCAGCTAGACTGTGAGCGCCCCCATGG

CGGGGACCTGCACCCCCATCTCTTCGGCTTTCGGCCGACGTTTATGTGCTATGTGCCCAGCCCGGTGCTGGCTTCGGTAGGAGACACAG - UNI36423

 - GTGACAAACTTGAAGACCTTGAAGAAGCCAATCCATTCTCCTTCAAAGAGTTTTTGAAAACCAAGAACCTCAGCCTGTCAAAAGAAGACACGACCAC

CAGCCGAATTTACCCAAAG - UNI4937 - - UNI36423 - GAAGCCTCAAGGCACCCACTGGGACTAGAGCACAGCTCCCCTGCCTCCCAGCTCA

TGGGATATGGCCTGGAATCTCAGCAGCCATTTTTTGAAGACCCAACAAGAGCCAGCAACCTAGAGGAGGATGAAGATGATGGATGGAATATAACCTACTT

GCCATCTGCCGTGGATCAGACTCATTCCTCTAGAGACACACAGGACTCACCGCCCTGTGACACCTACCTTTCCTTTTTCTCCAACTCGTCAGAGCTGGCA

TGTCCCGAGTCTTTGCCCCCATGGACGCTGAGTGACACCGACTCCAGGATCTCCCCAGCGTCTCCAGCTGGGAGTCCTAATGCAGACTTTGCAGCTCATG

AAGAATCCCTAGGGGACAGACACCTGCGGACGCTGCAGATAAGTTATGAAGCA CTGAAAGATGAAAACTCTAAGCTCAGAAGAAAGCTAAATGAGGTTC

AGAGCTTCTCTGAAACTCAAACAGAAAT GGTGAGGACACTCGAACGGAAGTTGGAGGCGAAGATGATCAAGGAGGAGAGTGACTTCCATGACCTCGAGT

CAGTAGTCCAGCAAGTCGAACAGAACCTTGAACTGATGACC AAACGGGCTGTAAAAGCAGAAAATCATGTCTTGAAGCTGAAACAGGAAATAAATTTGC

TTCAG GCCCAGCTCTCAAACTTGAGGCGAGAAAATGAAGCCCTGCGGTCAGGCCAGGGTGCCAGCCTTTCTGTAGTGAAGCAGAACACCGACGTGGCCT

TGCAGAACCTCCACCTTGTCATGAACAGTGCACACGCATCCATAAA GCAGCTGGTGTCTGGGGCAGACACACTGAACCTTGTTGCTGAAATCCTCAAGT

CTATCGACAGAATTAGTGAAGTTAAAGATGAGGTGGACTCTTGAGACGCTCTACCTGCCACCGGGTCCCGTCACCTCTGCACCGAAGGCACCACACATCT

TCCGAATGTGTTCCTGTCTATGCAGTCCTCATCAAAGCATTTCACGGCCTAATCATGTGACTGGCCATCTGCAGTACGGGGCTCCTTTCCACCAGTTGAA

CCTAACAGTTTACATGAAGTCCCACTGTTCGATAGACTCACTGATTTACTGGAAGACACTTTTATAAAACCACTAAAGCTGAAACGACAGTTTTGTAACA

AGCTTCTTTCACCACCCTCTCTAGGACGAGGTCGGGCTCAGCCTCAGTGTTGTCAAGTGGAACACGAAGTGAGCCAGTGTGTAAGTGAGCAGCCTGTACA

GAGACGCGTGCCTCACTGAGGCAGCACCGCTTGGTACGTGCTGCCGTCCTCCCACCAGGACCATAGGACCAAGGTCACACACTGTGCACAGTGCAAAGCT

TCATACACCCTCTACTGTGTGCTGTCAGCTTTGGAAAGCCATTTGGGGCTGTCGATTTTGATGCACGTTAATGTGTTTGTGTGCCTTTTGTATAGTGCAA

TTCAGACTGGAATTAAAGCACACACCCACCTGGGGGGTCAGCACCAGCTCTTTGGGCTGGCTGGCTGGTTTTTGAAGGACAGGCAAGACATAAGCAGCTC

CCTGTGCTGTGCTGAGGGGTCAAGGTTTGGGGGCCACTTTCCTATAGGTTGTTTTTTTGTTTTTTTTTTTTAATTTATTTTCCCTTTTCCCCTCCTGTTG

AGATCAACAGCTTTCTGATCTAAATAAATCTTAAAGATC
Translation
MSGYARRQGAPPLSRTRSLVVPDA APAFYERRSCLPQLDCERPHGGDLHPHLFGFRPTFMCYVPSPVLASVGDTG - UNI36423 - GDKLEDLEEA

NPFSFKEFLKTKNLSLSKEDTTTSRIYPK - UNI4937 - - UNI36423 - EASRHPLGLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDD

GWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFFSNSSELACPESLPPWTLSDTDSRISPASPAGSPNADFAAHEESLGDRHLRTLQISYEA LKDENSKL

RRKLNEVQSFSETQTEM MVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMT KRAVKAENHVLKLKQEINLLQ AQLSNLRRENEALRSGQGASL

SVVKQNTDVALQNLHLVMNSAHASIK KQLVSGADTLNLVAEILKSIDRISEVKDEVDS
Transcript ENSMUST00000114102
Sequence
GCCGGATGAGGCAGGGGCCGGCGACTGCCTTGCGGGCCATGGGGCCGCGGCCGGGTTAGGGCGCGGCGATGTCGGGCTACGCGCGGCGGCAGGGCGCGCC

CCCTCTATCGCGGACGCGGAGCCTTGTGGTTCCCGACG CTCCTGCGTTCTATGAGCGCCGGTCTTGTCTCCCCCAGCTAGACTGTGAGCGCCCCCATGG

CGGGGACCTGCACCCCCATCTCTTCGGCTTTCGGCCGACGTTTATGTGCTATGTGCCCAGCCCGGTGCTGGCTTCGGTAGGAGACACAG - UNI36423

 - GTTTTGGCTATGGAAAGGGGAAATGTACTAACCAAGGTCCTTCGGGAGCCCCTGAGACGCGCTTTGGAG - UNI36423 - GTGACAAACTTGAA

GACCTTGAAGAAGCCAATCCATTCTCCTTCAAAGAGTTTTTGAAAACCAAGAACCTCAGCCTGTCAAAAGAAGACACGACCACCAGCCGAATTTACCCAA

AG - UNI4937 - - UNI36423 - GAAGCCTCAAGGCACCCACTGGGACTAGAGCACAGCTCCCCTGCCTCCCAGCTCATGGGATATGGCCTGGAA

TCTCAGCAGCCATTTTTTGAAGACCCAACAAGAGCCAGCAACCTAGAGGAGGATGAAGATGATGGATGGAATATAACCTACTTGCCATCTGCCGTGGATC

AGACTCATTCCTCTAGAGACACACAGGACTCACCGCCCTGTGACACCTACCTTTCCTTTTTCTCCAACTCGTCAGAGCTGGCATGTCCCGAGTCTTTGCC

CCCATGGACGCTGAGTGACACCGACTCCAGGATCTCCCCAGCGTCTCCAGCTGGGAGTCCTAATGCAGACTTTGCAGCTCATGAAGAATCCCTAGGGGAC

AGACACCTGCGGACGCTGCAGATAAGTTATGAAGCA CTGAAAGATGAAAACTCTAAGCTCAGAAGAAAGCTAAATGAGGTTCAGAGCTTCTCTGAAACT

CAAACAGAAAT GGTGAGGACACTCGAACGGAAGTTGGAGGCGAAGATGATCAAGGAGGAGAGTGACTTCCATGACCTCGAGTCAGTAGTCCAGCAAGTC

GAACAGAACCTTGAACTGATGACC AAACGGGCTGTAAAAGCAGAAAATCATGTCTTGAAGCTGAAACAGGAAATAAATTTGCTTCAG GCCCAGCTCTC

AAACTTGAGGCGAGAAAATGAAGCCCTGCGGTCAGGCCAGGGTGCCAGCCTTTCTGTAGTGAAGCAGAACACCGACGTGGCCTTGCAGAACCTCCACCTT

GTCATGAACAGTGCACACGCATCCATAAA GCAGCTGGTGTCTGGGGCAGACACACTGAACCTTGTTGCTGAAATCCTCAAGTCTATCGACAGAATTAGT

GAAGTTAAAGATGAGGTGGACTCTTGAGACGCTCTACCTGCCACCGGGTCCCGTCACCTCTGCACCGAAGGCACCACACATCTTCCGAATGTGTTCCTGT

CTATGCAGTCCTCATCAAAGCATTTCACGGCCTAATCATGTGACTGGCCATCTGCAGTACGGGGCTCCTTTCCACCAGTTGAACCTAACAGTTTACATGA

AGTCCCACTGTTCGATAGACTCACTGATTTACTGGAAGACACTTTTATAAAACCACTAAAGCTGAAACGACAGTTTTGTAACAAGCTTCTTTCACCACCC

TCTCTAGGACGAGGTCGGGCTCAGCCTCAGTGTTGTCAAGTGGAACACGAAGTGAGCCAGTGTGTAAGTGAGCAGCCTGTACAGAGACGCGTGCCTCACT

GAGGCAGCACCGCTTGGTACGTGCTGCCGTCCTCCCACCAGGACCATAGGACCAAGGTCACACACTGTGCACAGTGCAAAGCTTCATACACCCTCTACTG

TGTGCTGTCAGCTTTGGAAAGCCATTTGGGGCTGTCGATTTTGATGCACGTTAATGTGTTTGTGTGCCTTTTGTATAGTGCAATTCAGACTGGAATTAAA

GCACACACCCACCTGGGGGGTCAGCACCAGCTCTTTGGGCTGGCTGGCTGGTTTTTGAAGGACAGGCAAGACATAAGCAGCTCCCTGTGCTGTGCTGAGG

GGTCAAGGTTTGGGGGCCACTTTCCTATAGGTTGTTTTTTTGTTTTTTTTTTTTAATTTATTTTCCCTTTTCCCCTCCTGTTGAGATCAACAGCTTTCTG

ATCTAAATAAATCTTAAAGATC
Translation
MSGYARRQGAPPLSRTRSLVVPDA APAFYERRSCLPQLDCERPHGGDLHPHLFGFRPTFMCYVPSPVLASVGDTG - UNI36423 - GFGYGKGKCT

NQGPSGAPETRFGG - UNI36423 - GDKLEDLEEANPFSFKEFLKTKNLSLSKEDTTTSRIYPK - UNI4937 - - UNI36423 - EASRHPL

GLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFFSNSSELACPESLPPWTLSDTDSRISPASP

AGSPNADFAAHEESLGDRHLRTLQISYEA LKDENSKLRRKLNEVQSFSETQTEM MVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMT KRAVK

AENHVLKLKQEINLLQ AQLSNLRRENEALRSGQGASLSVVKQNTDVALQNLHLVMNSAHASIK KQLVSGADTLNLVAEILKSIDRISEVKDEVDS

For any suggestions or comments, please send an email to unitrap@crg.es