Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026972 (Arrdc1)
Chromosomal location
Chr 2: 24780875 - 24790685 (-)
Description
arrestin domain containing 1 Gene [Source:MGI (curated);Acc:Arrdc1-001]
RefSeq_dna
NM_178408 
RefSeq_peptide
NP_848495.1 
UniGene
Mm.45275 
MGI
MGI:2446136 
Uniprot/SWISSPROT
Q99KN1 
Uniprot/SPTREMBL
A2AIT0 A2AIS9 A2AIS7 A2AIS8 
Human Ortholog
ENSG00000197070 (ARRDC1)
Omim not available
UniTrap UNI22535
Vector Insertion
Chr 2: 24783360 - 24790547
Public Clones (ggtc)
Private Clones OST292943 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26087
Vector Insertion
Chr 2: 24782248 - 24782433
Public Clones not available
Private Clones OST139184 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114413
Sequence
GCGGCGCGGGAGACCGCGGTATGGGGAGGGTGCAGCTCTTCGAGATCCGCCTGAGTCAGGGCCGCGTCGTCTACGGTCCTGGGGAGCCGCTGGCTGGGAC

CGTGCACTTGCGCCTGGGAGCGCCACTGCCCTTCCGAG - UNI22535 - CTATCCGGGTGACCTGCATGGGTTCCTGTGGGGTCTCCACCAAGGCCA

ACGATGGGGCATGGGTGGTGGAGGAGAGCTACTTCAACAGCTCCCTGTCACTGGCTGACAAGG CACCCACATCTTTTGAGGGACCCTTTGGGAAGATTG

TACACCAGGTGAGGGCGTCCATCGACACTCCACGTTTTTCCAAGGATCACAAATGTAGCCTCGTGTTCTACATCCTG
Translation
MGRVQLFEIRLSQGRVVYGPGEPLAGTVHLRLGAPLPFRA - UNI22535 - AIRVTCMGSCGVSTKANDGAWVVEESYFNSSLSLADKA APTSFEG

PFGKIVHQVRASIDTPRFSKDHKCSLVFYIL
Transcript ENSMUST00000114414
Sequence
GCGGCGCGGGAGACCGCGGTATGGGGAGGGTGCAGCTCTTCGAGATCCGCCTGAGTCAGGGCCGCGTCGTCTACGGTCCTGGGGAGCCGCTGGCTGGGAC

CGTGCACTTGCGCCTGGGAGCGCCACTGCCCTTCCGAG - UNI22535 - GAAGTCTGCCGGCTGGAGAGCACAACTTCCCTTTTCAGTTCCTGCTTC

CTG CCACAGCACCCACATCTTTTGAGGGACCCTTTGGGAAGATTGTACACCAGGTGAGGGCGTCCATCGACACTCCACGTTTTTCCAAGGATCACAAAT

GTAGCCTCGTGTTCTACATCCTGAGCCCCTTGAACCTGAACAGCATCCCAGATATTGAG - UNI26087 - CAACCCAATGTGGCCTCCACTACCAAG

AAGTTCTCCTATAAGCTGGTGAAGACTGGCAATGTGGTTCTCACAGCTAGCACTGACCTTCGTGGCTATGTGGTGGGACAGGTGCTGCGGCTGCAGGCTG

ACATTGAGAACCAGTCAGGCAAGGACACCAGCCCTGTGGTGGCCAGCTTGCTACAG AAGGTATCCTATAAGGCCAAGCGCTGGATCTATGATGTGCGGA

CCATTGCAGAGGTGGAGGGTACAGGTGTCAAGGCCTGGAGGCGTGCTCAGTGGCAAGAACAGATCCTGGTGCCTGCCCTGCCCCAGTCAGCCCTGCCTGG

CTGCAGCCTTATCCATATCGACTATTACCTTCAG GTCTCCATGAAGGCACCTGAGGCCACCGTGACTCTCCCACTATTTGTTGGCAATATTGCTGTGAA

CCAAACTCCACTGAGTCCCTGTCCAGGCCGAGAGTCTTCTCCTGGGACCCTATCCCTAGTGGTGCCCTCTGCACCACCCCAGGAAGAGGCTGAGGCAGTG

GCTAGTGGCCCTCACTTCTCAGACCCAGTTTCTCTCTCCACCAAGAGCCACTCTCAGCAGCAGCCACTGTCGGCTCCCTTGGGTTCTGTGTCTGTCACCA

CCACTGAGCCCTGGGTTCAGGTTGGAAGCCCTGCTAGACATTCTCTGCACCCTCCCTTGTGCATCTCTATAGGTGCCACTGTCCCCTACTTTGCAGAAGG

CTCTGCGGGCCCAGTACCCACCACCAGCGCCTTGATCCTCCCTCCAGAGTACAGTTCATGGGGCTACCCCTATG AGGCCCCGCCGTCCTATGAGCAGAG

CTGTGGTGCTGCTGGTACAGACCTTGGCCTGATCCCAGGAAGCTGACCCTGGTGTGCTAACCCATACCACCTTGTTCGGTGGTTCTGGCCTTTGCCTTGG

CATGGAATGTCCAGGGCCTCGTGCCTTTGCTCTCTACCTGGCTCAGCTACTCAGGACCTGCAGCTGTCGGGATGACCCCTTGTGGACCAGCCACTCCTGG

CTCCTCTGGAATTACTCAGTCCTCCTCTTAAGAGGTTGGGGTAGGGCGGCAGAGATCTGGGCCTGGAGAGACTGTATAAATAAAGCGCTTTATTTGT
Translation
MGRVQLFEIRLSQGRVVYGPGEPLAGTVHLRLGAPLPFRG - UNI22535 - GSLPAGEHNFPFQFLLPA ATAPTSFEGPFGKIVHQVRASIDTPRF

SKDHKCSLVFYILSPLNLNSIPDIE - UNI26087 - QPNVASTTKKFSYKLVKTGNVVLTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQ

 KVSYKAKRWIYDVRTIAEVEGTGVKAWRRAQWQEQILVPALP  
Transcript ENSMUST00000102935
Sequence
GCGGCGCGGGAGACCGCGGTATGGGGAGGGTGCAGCTCTTCGAGATCCGCCTGAGTCAGGGCCGCGTCGTCTACGGTCCTGGGGAGCCGCTGGCTGGGAC

CGTGCACTTGCGCCTGGGAGCGCCACTGCCCTTCCGAG - UNI22535 - CTATCCGGGTGACCTGCATGGGTTCCTGTGGGGTCTCCACCAAGGCCA

ACGATGGGGCATGGGTGGTGGAGGAGAGCTACTTCAACAGCTCCCTGTCACTGGCTGACAAGG GAAGTCTGCCGGCTGGAGAGCACAACTTCCCTTTTC

AGTTCCTGCTTCCTG CCACAGCACCCACATCTTTTGAGGGACCCTTTGGGAAGATTGTACACCAGGTGAGGGCGTCCATCGACACTCCACGTTTTTCCA

AGGATCACAAATGTAGCCTCGTGTTCTACATCCTGAGCCCCTTGAACCTGAACAGCATCCCAGATATTGAG - UNI26087 - CAACCCAATGTGGCC

TCCACTACCAAGAAGTTCTCCTATAAGCTGGTGAAGACTGGCAATGTGGTTCTCACAGCTAGCACTGACCTTCGTGGCTATGTGGTGGGACAGGTGCTGC

GGCTGCAGGCTGACATTGAGAACCAGTCAGGCAAGGACACCAGCCCTGTGGTGGCCAGCTTGCTACAG GTATCCTATAAGGCCAAGCGCTGGATCTATG

ATGTGCGGACCATTGCAGAGGTGGAGGGTACAGGTGTCAAGGCCTGGAGGCGTGCTCAGTGGCAAGAACAGATCCTGGTGCCTGCCCTGCCCCAGTCAGC

CCTGCCTGGCTGCAGCCTTATCCATATCGACTATTACCTTCAG GTCTCCATGAAGGCACCTGAGGCCACCGTGACTCTCCCACTATTTGTTGGCAATAT

TGCTGTGAACCAAACTCCACTGAGTCCCTGTCCAGGCCGAGAGTCTTCTCCTGGGACCCTATCCCTAGTGGTGCCCTCTGCACCACCCCAGGAAGAGGCT

GAGGCAGTGGCTAGTGGCCCTCACTTCTCAGACCCAGTTTCTCTCTCCACCAAGAGCCACTCTCAGCAGCAGCCACTGTCGGCTCCCTTGGGTTCTGTGT

CTGTCACCACCACTGAGCCCTGGGTTCAGGTTGGAAGCCCTGCTAGACATTCTCTGCACCCTCCCTTGTGCATCTCTATAGGTGCCACTGTCCCCTACTT

TGCAGAAGGCTCTGCGGGCCCAGTACCCACCACCAGCGCCTTGATCCTCCCTCCAGAGTACAGTTCATGGGGCTACCCCTATG AGGCCCCGCCGTCCTA

TGAGCAGAGCTGTGGTGCTGCTGGTACAGACCTTGGCCTGATCCCAGGAAGCTGACCCTGGTGTGCTAACCCATACCACCTTGTTCGGTGGTTCTGGCCT

TTGCCTTGGCATGGAATGTCCAGGGCCTCGTGCCTTTGCTCTCTACCTGGCTCAGCTACTCAGGACCTGCAGCTGTCGGGATGACCCCTTGTGGACCAGC

CACTCCTGGCTCCTCTGGAATTACTCAGTCCTCCTCTTAAGAGGTTGGGGTAGGGCGGCAGAGATCTGGGCCTGGAGAGACTGTATAAATAAAGCGCTTT

ATTTGT
Translation
MGRVQLFEIRLSQGRVVYGPGEPLAGTVHLRLGAPLPFRA - UNI22535 - AIRVTCMGSCGVSTKANDGAWVVEESYFNSSLSLADKG GSLPAGE

HNFPFQFLLPA ATAPTSFEGPFGKIVHQVRASIDTPRFSKDHKCSLVFYILSPLNLNSIPDIE - UNI26087 - QPNVASTTKKFSYKLVKTGNVV

LTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQ VSYKAKRWIYDVRTIAEVEGTGVKAWRRAQWQEQILVPALPQSALPGCSLIHIDYYLQ V

SMKAPEATVTLPLFVGNIAVNQTPLSPCPGRESSPGTLSLVVPSAPPQEEAEAVASGPHFSDPVSLSTKSHSQQQPLSAPLGSVSVTTTEPWVQVGSPAR

HSLHPPLCISIGATVPYFAEGSAGPVPTTSALILPPEYSSWGYPYE EAPPSYEQSCGAAGTDLGLIPGS
Transcript ENSMUST00000028349
Sequence
GCGGCGCGGGAGACCGCGGTATGGGGAGGGTGCAGCTCTTCGAGATCCGCCTGAGTCAGGGCCGCGTCGTCTACGGTCCTGGGGAGCCGCTGGCTGGGAC

CGTGCACTTGCGCCTGGGAGCGCCACTGCCCTTCCGAG - UNI22535 - CTATCCGGGTGACCTGCATGGGTTCCTGTGGGGTCTCCACCAAGGCCA

ACGATGGGGCATGGGTGGTGGAGGAGAGCTACTTCAACAGCTCCCTGTCACTGGCTGACAAGG GAAGTCTGCCGGCTGGAGAGCACAACTTCCCTTTTC

AGTTCCTGCTTCCTG CCACAGCACCCACATCTTTTGAGGGACCCTTTGGGAAGATTGTACACCAGGTGAGGGCGTCCATCGACACTCCACGTTTTTCCA

AGGATCACAAATGTAGCCTCGTGTTCTACATCCTGAGCCCCTTGAACCTGAACAGCATCCCAGATATTGAG - UNI26087 - CAACCCAATGTGGCC

TCCACTACCAAGAAGTTCTCCTATAAGCTGGTGAAGACTGGCAATGTGGTTCTCACAGCTAGCACTGACCTTCGTGGCTATGTGGTGGGACAGGTGCTGC

GGCTGCAGGCTGACATTGAGAACCAGTCAGGCAAGGACACCAGCCCTGTGGTGGCCAGCTTGCTACAG AAGGTATCCTATAAGGCCAAGCGCTGGATCT

ATGATGTGCGGACCATTGCAGAGGTGGAGGGTACAGGTGTCAAGGCCTGGAGGCGTGCTCAGTGGCAAGAACAGATCCTGGTGCCTGCCCTGCCCCAGTC

AGCCCTGCCTGGCTGCAGCCTTATCCATATCGACTATTACCTTCAG GTCTCCATGAAGGCACCTGAGGCCACCGTGACTCTCCCACTATTTGTTGGCAA

TATTGCTGTGAACCAAACTCCACTGAGTCCCTGTCCAGGCCGAGAGTCTTCTCCTGGGACCCTATCCCTAGTGGTGCCCTCTGCACCACCCCAGGAAGAG

GCTGAGGCAGTGGCTAGTGGCCCTCACTTCTCAGACCCAGTTTCTCTCTCCACCAAGAGCCACTCTCAGCAGCAGCCACTGTCGGCTCCCTTGGGTTCTG

TGTCTGTCACCACCACTGAGCCCTGGGTTCAGGTTGGAAGCCCTGCTAGACATTCTCTGCACCCTCCCTTGTGCATCTCTATAGGTGCCACTGTCCCCTA

CTTTGCAGAAGGCTCTGCGGGCCCAGTACCCACCACCAGCGCCTTGATCCTCCCTCCAGAGTACAGTTCATGGGGCTACCCCTATG AGGCCCCGCCGTC

CTATGAGCAGAGCTGTGGTGCTGCTGGTACAGACCTTGGCCTGATCCCAGGAAGCTGACCCTGGTGTGCTAACCCATACCACCTTGTTCGGTGGTTCTGG

CCTTTGCCTTGGCATGGAATGTCCAGGGCCTCGTGCCTTTGCTCTCTACCTGGCTCAGCTACTCAGGACCTGCAGCTGTCGGGATGACCCCTTGTGGACC

AGCCACTCCTGGCTCCTCTGGAATTACTCAGTCCTCCTCTTAAGAGGTTGGGGTAGGGCGGCAGAGATCTGGGCCTGGAGAGACTGTATAAATAAAGCGC

TTTATTTGT
Translation
MGRVQLFEIRLSQGRVVYGPGEPLAGTVHLRLGAPLPFRA - UNI22535 - AIRVTCMGSCGVSTKANDGAWVVEESYFNSSLSLADKG GSLPAGE

HNFPFQFLLPA ATAPTSFEGPFGKIVHQVRASIDTPRFSKDHKCSLVFYILSPLNLNSIPDIE - UNI26087 - QPNVASTTKKFSYKLVKTGNVV

LTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQ KVSYKAKRWIYDVRTIAEVEGTGVKAWRRAQWQEQILVPALPQSALPGCSLIHIDYYLQ 

VSMKAPEATVTLPLFVGNIAVNQTPLSPCPGRESSPGTLSLVVPSAPPQEEAEAVASGPHFSDPVSLSTKSHSQQQPLSAPLGSVSVTTTEPWVQVGSPA

RHSLHPPLCISIGATVPYFAEGSAGPVPTTSALILPPEYSSWGYPYE EAPPSYEQSCGAAGTDLGLIPGS

For any suggestions or comments, please send an email to unitrap@crg.es