Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026977 (March7)
Chromosomal location
Chr 2: 60047987 - 60086030 (+)
Description
membrane-associated ring finger (C3HC4) 7 Gene [Source:MGI (curated);Acc:March7-003]
RefSeq_dna
NM_020575 
RefSeq_peptide
NP_065600.1 
MGI
MGI:1931053 
Uniprot/SWISSPROT
Q9WV66 
Uniprot/SPTREMBL
A2AW82 A2AW83 
Human Ortholog
ENSG00000136536 (MARCH7)
Omim not available
UniTrap UNI2331
Vector Insertion
Chr 2: 60048142 - 60062826
Public Clones (sanger) AE0078 (sanger) P067C04 (ggtc) W199E05 (ggtc) D027B02 (ggtc)
P063B06 (ggtc) H003H08 (ggtc) H007C11 (ggtc) W268E05 (ggtc) D156G01 (ggtc)
P067B06 (ggtc) P011F05 (ggtc) E118E02 (ggtc) W199E01 (ggtc) P064D06 (ggtc)
P017E05 (ggtc) D156G02 (ggtc) PST11429-NR (escells) IST14186C3 (tigm)
IST14591B2 (tigm) IST15002D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31239
Vector Insertion
Chr 2: 60062928 - 60066974
Public Clones IST14638B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17611
Vector Insertion
Chr 2: 60066974 - 60067140
Public Clones not available
Private Clones OST439692 (lexicon) OST404158 (lexicon) OST375302 (lexicon) OST352496 (lexicon)
OST297112 (lexicon) OST235486 (lexicon) OST232807 (lexicon) OST222326 (lexicon)
OST195386 (lexicon) OST167543 (lexicon) OST135195 (lexicon) OST131386 (lexicon)
OST101039 (lexicon) OST40180 (lexicon) OST40179 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24441
Vector Insertion
Chr 2: 60067140 - 60067740
Public Clones not available
Private Clones OST220469 (lexicon) OST209056 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5287
Vector Insertion
Chr 2: 60067937 - 60070256
Public Clones YTB014 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36800
Vector Insertion
Chr 2: 60067937 - 60070256
Public Clones (cmhd) IST14880H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37231
Vector Insertion
Chr 2: 60070256 - 60070425
Public Clones CMHD-GT_476F8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24324
Vector Insertion
Chr 2: 60070425 - 60071955
Public Clones not available
Private Clones OST224739 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6570
Vector Insertion
Chr 2: 60071955 - 60073055
Public Clones YHB164 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16532
Vector Insertion
Chr 2: 60079110 - 60081613
Public Clones not available
Private Clones OST459062 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102748
Sequence
CTGCGGCGCATCCGGAGGGGCGGCCGCCATTGTGCTTCGTCGCCGACTTCTCTGCCGGTAGCCCGAGAGCCGAGCCGAGCCCAGCGAGGAAGGCGGCGGC

GGTGTGGCTGCGGCGAGCGCGACACTCCCTGCAGCGGAGTGCTCGGTGGAAGAGG - UNI2331 - - UNI17611 - - UNI31239 - GAAACC

TTAAGAATGGAGTCTAAACCTTCCAGGATTCCAAGAAGAATTTCTGTTCAACCCTCTGGCTCTTTAAGCACTAGGATGGTGTCTGGAAACAGAGGAACCA

GTTTAAATGATTCATATCATTCTAGAGACTCCTCCTTTAGACTGGATTCTGAATATCAG - UNI17611 - - UNI24441 - TCTGCATCAGCATC

AGCGTGTGCATCACCATGTCAGCCTGCCTGGTACAGTGAGTCTGAGATACCTCAGGGAGCGCGGGCACGAGCACAGACCCAGCAGCGGGATCATGACTCA

AAGAGACCCAAGCTTTCCTGTACAAACTGTGCATCTACCTCAGCTGGGAGGAACGGTGGGAGTGGGTTAAATACAGTGTCAG - UNI5287 - - UNI

36800 - ATTCTTCTTGGAGGCATAGTCAAGTTCCCAGATCTTCATCAATGGTACTTGGTTCATTTGGAACAGACTTGATGAGAGAAAGGAGAGATTTG

GACAGGAGAAGAGAGTCCTCCATCAGCAATCTTATGGATTATAATCACCGAAGTGGTGATTTCACAACTTCATCAT - UNI6570 - - UNI24324 

- ATGTTCAAGAAAGAGTTCCTTCTTCATATTCACAGGGAGCAAGACCAAAAGAGAATGCAGTGAGCACTTTACAGTTGAATTCATCATCCACCAATCAC

CAATTGCCTTCTGACCATCAGACAGTACCAAGTTCTAGGGACTCCAGTAGAAGTTCTTTCAGATCACATTTTTCTCCAAGACAATCAGAATCTTTTCGCA

ACAGTTCACATCCTGCATTTTCATATTTTTCAAGTAGAAATGAAACTCCAACTATAAGCAATTCAGAAAGGGGTTCATCTCAGAGACCATATCGAGAATC

TTCTGACAATGAAGGTAGGCGTACAACTAGGAGATTGCTGTCACGGATAGCTTCTAGCATGTCATCTACTTTTTTCTCACGAAGATCTAGTCAAGATTCC

TTGAATACAAGATCTTTGAGTTCTGAAAATTATATTTCTCCGAGAACCCTGACTTCACAGTCTCGGAATAATGGAACCTCCTCGTCCTCTGACGTCAGTG

AGGGCAGGGCAGCTGAAGCATCTCAGGGATTTAGATTTCTTAGGCGAAGATGGGGGTTGTCGTCGCTCAGCCAAAATCATAGCTCTGAACCAGAGGCAGA

AAATTTTAACCAAGAATCAGAAGGTAGAAATTCAGGACCATGGTTGTCTTCTTCACTTAGAAATAGATGCACACCTTTGTTCTCGAGAAGGAGGCGAGAG

GGAAGGGATGAGTCTTCAAGAATGTCTACGTCAGATGTACCACCTAGATCTCATATTTTCAGAAGAGATTCAAATGAAGTAGTTCATCTTGAAGCACAGG

GTGACTCCCTTGGGGCTGCTGCCAACCGACCACAAGCATCTGGAGCGTCAAGCAGTGCTGCTGCAGGTGGCTCCACCCCAGAGTTGCCTCAGGGTGGAAG

AAATCCAGGACTAACAGGGATTCTTCCTGGCTCCTTGTTCCGGTTTGCAGTCCCACCAGCACTCGGCAGTAATCTGGCTGACAATGTCATGATTACTGTA

GATATTATTCCTTCTGGTTGGAATTCAACTGATGGGAAAAATGATAAAGCTAAAAGTGCACCTTCAAGAGACCCAGAAAAACTTCAGAAAATCAAAGAAA

G - UNI6570 - CCTCCTTTTAGAGGACTCTGATGATGAAGAAGAAGGGGACTTATGTAGAATTTGTCAGATGGCAGCAGCGTCATCATCTAATTTAT

TGATAGAGCCGTGCAAATGCACAGGGAGCCTGCAGTACGTCCATCAAGAGTGTATGAAAAAGTGGTTACAAGCCAAAATTAATTCTG GCTCTTCATTAG

AGGCTGTGACTACCTGTGAACTCTGTAAAGAGAAGTTGCAACTTAACCTGGAGGATTTTGATATTCATGAACTACATAGAGCTCATGCAAATGAACAA -

 UNI16532 - GCTGAGTATGAGTTTATCAGCTCTGGTCTCTACCTAGTTGTCTTACTGCACTTGTGTGAACAAAGCTTTTCTGATATGATGGGAAATA

CAATTGAACCAAGCACTCGTGTCCGA TTTATTAACCTTGCAAGAACTCTTCAGGCACATATGGAAGATCTCGAAA CTTCAGAGGATGAATTCTGAAGA

AGATGGAGACCATAAGAGAATGCTTGATATTGCCTAACTTCATTT
Translation
 - UNI2331 - - UNI17611 - - UNI31239 - MESKPSRIPRRISVQPSGSLSTRMVSGNRGTSLNDSYHSRDSSFRLDSEYQ - UNI1761

1 - - UNI24441 - SASASACASPCQPAWYSESEIPQGARARAQTQQRDHDSKRPKLSCTNCASTSAGRNGGSGLNTVSD - UNI5287 - - UN

I36800 - DSSWRHSQVPRSSSMVLGSFGTDLMRERRDLDRRRESSISNLMDYNHRSGDFTTSSY - UNI6570 - - UNI24324 - YVQERVPS

SYSQGARPKENAVSTLQLNSSSTNHQLPSDHQTVPSSRDSSRSSFRSHFSPRQSESFRNSSHPAFSYFSSRNETPTISNSERGSSQRPYRESSDNEGRRT

TRRLLSRIASSMSSTFFSRRSSQDSLNTRSLSSENYISPRTLTSQSRNNGTSSSSDVSEGRAAEASQGFRFLRRRWGLSSLSQNHSSEPEAENFNQESEG

RNSGPWLSSSLRNRCTPLFSRRRREGRDESSRMSTSDVPPRSHIFRRDSNEVVHLEAQGDSLGAAANRPQASGASSSAAAGGSTPELPQGGRNPGLTGIL

PGSLFRFAVPPALGSNLADNVMITVDIIPSGWNSTDGKNDKAKSAPSRDPEKLQKIKES - UNI6570 - SLLLEDSDDEEEGDLCRICQMAAASSSN

LLIEPCKCTGSLQYVHQECMKKWLQAKINSG GSSLEAVTTCELCKEKLQLNLEDFDIHELHRAHANEQ - UNI16532 - AEYEFISSGLYLVVLLH

LCEQSFSDMMGNTIEPSTRVR FINLARTLQAHMEDLET TSEDEF
Transcript ENSMUST00000102747
Sequence
CGGTGGAAGAGG - UNI2331 - GTCAGGGCTGCATCATTTATTGGATTGGTGTTTTTGATAAACCTATATGCTTGGTGTTTCTGATATGATTTGATA

TGTTCATGTATCCCTGATTTATTTTG - UNI17611 - - UNI31239 - GAAACCTTAAGAATGGAGTCTAAACCTTCCAGGATTCCAAGAAGAAT

TTCTGTTCAACCCTCTGGCTCTTTAAGCACTAGGATGGTGTCTGGAAACAGAGGAACCAGTTTAAATGATTCATATCATTCTAGAGACTCCTCCTTTAGA

CTGGATTCTGAATATCAG - UNI17611 - - UNI24441 - TCTGCATCAGCATCAGCGTGTGCATCACCATGTCAGCCTGCCTGGTACAGTGAGT

CTGAGATACCTCAGGGAGCGCGGGCACGAGCACAGACCCAGCAGCGGGATCATGACTCAAAGAGACCCAAGCTTTCCTGTACAAACTGTGCATCTACCTC

AGCTGGGAGGAACGGTGGGAGTGGGTTAAATACAGTGTCAG - UNI5287 - - UNI36800 - ATTCTTCTTGGAGGCATAGTCAAGTTCCCAGAT

CTTCATCAATGGTACTTGGTTCATTTGGAACAGACTTGATGAGAGAAAGGAGAGATTTGGACAGGAGAAGAGAGTCCTCCATCAGCAATCTTATGGATTA

TAATCACCGAAGTGGTGATTTCACAACTTCATCAT - UNI6570 - - UNI24324 - ATGTTCAAGAAAGAGTTCCTTCTTCATATTCACAGGGAG

CAAGACCAAAAGAGAATGCAGTGAGCACTTTACAGTTGAATTCATCATCCACCAATCACCAATTGCCTTCTGACCATCAGACAGTACCAAGTTCTAGGGA

CTCCAGTAGAAGTTCTTTCAGATCACATTTTTCTCCAAGACAATCAGAATCTTTTCGCAACAGTTCACATCCTGCATTTTCATATTTTTCAAGTAGAAAT

GAAACTCCAACTATAAGCAATTCAGAAAGGGGTTCATCTCAGAGACCATATCGAGAATCTTCTGACAATGAAGGTAGGCGTACAACTAGGAGATTGCTGT

CACGGATAGCTTCTAGCATGTCATCTACTTTTTTCTCACGAAGATCTAGTCAAGATTCCTTGAATACAAGATCTTTGAGTTCTGAAAATTATATTTCTCC

GAGAACCCTGACTTCACAGTCTCGGAATAATGGAACCTCCTCGTCCTCTGACGTCAGTGAGGGCAGGGCAGCTGAAGCATCTCAGGGATTTAGATTTCTT

AGGCGAAGATGGGGGTTGTCGTCGCTCAGCCAAAATCATAGCTCTGAACCAGAGGCAGAAAATTTTAACCAAGAATCAGAAGGTAGAAATTCAGGACCAT

GGTTGTCTTCTTCACTTAGAAATAGATGCACACCTTTGTTCTCGAGAAGGAGGCGAGAGGGAAGGGATGAGTCTTCAAGAATGTCTACGTCAGATGTACC

ACCTAGATCTCATATTTTCAGAAGAGATTCAAATGAAGTAGTTCATCTTGAAGCACAGGGTGACTCCCTTGGGGCTGCTGCCAACCGACCACAAGCATCT

GGAGCGTCAAGCAGTGCTGCTGCAGGTGGCTCCACCCCAGAGTTGCCTCAGGGTGGAAGAAATCCAGGACTAACAGGGATTCTTCCTGGCTCCTTGTTCC

GGTTTGCAGTCCCACCAGCACTCGGCAGTAATCTGGCTGACAATGTCATGATTACTGTAGATATTATTCCTTCTGGTTGGAATTCAACTGATGGGAAAAA

TGATAAAGCTAAAAGTGCACCTTCAAGAGACCCAGAAAAACTTCAGAAAATCAAAGAAAG - UNI6570 - CCTCCTTTTAGAGGACTCTGATGATGA

AGAAGAAGGGGACTTATGTAGAATTTGTCAGATGGCAGCAGCGTCATCATCTAATTTATTGATAGAGCCGTGCAAATGCACAGGGAGCCTGCAGTACGTC

CATCAAGAGTGTATGAAAAAGTGGTTACAAGCCAAAATTAATTCTG GCTCTTCATTAGAGGCTGTGACTACCTGTGAACTCTGTAAAGAGAAGTTGCAA

CTTAACCTGGAGGATTTTGATATTCATGAACTACATAGAGCTCATGCAAATGAACAA - UNI16532 - GCTGAGTATGAGTTTATCAGCTCTGGTCT

CTACCTAGTTGTCTTACTGCACTTGTGTGAACAAAGCTTTTCTGATATGATGGGAAATACAATTGAACCAAGCACTCGTGTCCGA TTTATTAACCTTGC

AAGAACTCTTCAGGCACATATGGAAGATCTCGAAA CTTCAGAGGATGAATTCTGAAGAAGATGGAGACCATAAGAGAATGCTTGATATTGCCTAACTTC

ATTTAAGAAAAAAAAAAAAA
Translation
 - UNI2331 -  - UNI17611 - - UNI31239 - MESKPSRIPRRISVQPSGSLSTRMVSGNRGTSLNDSYHSRDSSFRLDSEYQ - UNI176

11 - - UNI24441 - SASASACASPCQPAWYSESEIPQGARARAQTQQRDHDSKRPKLSCTNCASTSAGRNGGSGLNTVSD - UNI5287 - - U

NI36800 - DSSWRHSQVPRSSSMVLGSFGTDLMRERRDLDRRRESSISNLMDYNHRSGDFTTSSY - UNI6570 - - UNI24324 - YVQERVP

SSYSQGARPKENAVSTLQLNSSSTNHQLPSDHQTVPSSRDSSRSSFRSHFSPRQSESFRNSSHPAFSYFSSRNETPTISNSERGSSQRPYRESSDNEGRR

TTRRLLSRIASSMSSTFFSRRSSQDSLNTRSLSSENYISPRTLTSQSRNNGTSSSSDVSEGRAAEASQGFRFLRRRWGLSSLSQNHSSEPEAENFNQESE

GRNSGPWLSSSLRNRCTPLFSRRRREGRDESSRMSTSDVPPRSHIFRRDSNEVVHLEAQGDSLGAAANRPQASGASSSAAAGGSTPELPQGGRNPGLTGI

LPGSLFRFAVPPALGSNLADNVMITVDIIPSGWNSTDGKNDKAKSAPSRDPEKLQKIKES - UNI6570 - SLLLEDSDDEEEGDLCRICQMAAASSS

NLLIEPCKCTGSLQYVHQECMKKWLQAKINSG GSSLEAVTTCELCKEKLQLNLEDFDIHELHRAHANEQ - UNI16532 - AEYEFISSGLYLVVLL

HLCEQSFSDMMGNTIEPSTRVR FINLARTLQAHMEDLET TSEDEF
Transcript ENSMUST00000067542
Sequence
CTGCGGCGCATCCGGAGGGGCGGCCGCCATTGTGCTTCGTCGCCGACTTCTCTGCCGGTAGCCCGAGAGCCGAGCCGAGCCCAGCGAGGAAGGCGGCGGC

GGTGTGGCTGCGGCGAGCGCGACACTCCCTGCAGCGGAGTGCTCGGTGGAAGAGG - UNI2331 - - UNI17611 - - UNI31239 - GAAACC

TTAAGAATGGAGTCTAAACCTTCCAGGATTCCAAGAAGAATTTCTGTTCAACCCTCTGGCTCTTTAAGCACTAGGATGGTGTCTGGAAACAGAGGAACCA

GTTTAAATGATTCATATCATTCTAGAGACTCCTCCTTTAGACTGGATTCTGAATATCAG - UNI17611 - - UNI24441 - TCTGCATCAGCATC

AGCGTGTGCATCACCATGTCAGCCTGCCTGGTACAGTGAGTCTGAGATACCTCAGGGAGCGCGGGCACGAGCACAGACCCAGCAGCGGGATCATGACTCA

AAGAGACCCAAGCTTTCCTGTACAAACTGTGCATCTACCTCAGCTGGGAGGAACGGTGGGAGTGGGTTAAATACAGTGTCAG - UNI5287 - - UNI

36800 - ATTCTTCTTGGAGGCATAGTCAAGTTCCCAGATCTTCATCAATGGTACTTGGTTCATTTGGAACAGACTTGATGAGAGAAAGGAGAGATTTG

GACAGGAGAAGAGAGTCCTCCATCAGCAATCTTATGGATTATAATCACCGAAGTGGTGATTTCACAACTTCATCAT - UNI6570 - - UNI24324 

- ATGTTCAAGAAAGAGTTCCTTCTTCATATTCACAGGGAGCAAGACCAAAAGAGAATGCAGTGAGCACTTTACAGTTGAATTCATCATCCACCAATCAC

CAATTGCCTTCTGACCATCAGACAGTACCAAGTTCTAGGGACTCCAGTAGAAGTTCTTTCAGATCACATTTTTCTCCAAGACAATCAGAATCTTTTCGCA

ACAGTTCACATCCTGCATTTTCATATTTTTCAAGTAGAAATGAAACTCCAACTATAAGCAATTCAGAAAGGGGTTCATCTCAGAGACCATATCGAGAATC

TTCTGACAATGAAGGTAGGCGTACAACTAGGAGATTGCTGTCACGGATAGCTTCTAGCATGTCATCTACTTTTTTCTCACGAAGATCTAGTCAAGATTCC

TTGAATACAAGATCTTTGAGTTCTGAAAATTATATTTCTCCGAGAACCCTGACTTCACAGTCTCGGAATAATGGAACCTCCTCGTCCTCTGACGTCAGTG

AGGGCAGGGCAGCTGAAGCATCTCAGGGATTTAGATTTCTTAGGCGAAGATGGGGGTTGTCGTCGCTCAGCCAAAATCATAGCTCTGAACCAGAGGCAGA

AAATTTTAACCAAGAATCAGAAGGTAGAAATTCAGGACCATGGTTGTCTTCTTCACTTAGAAATAGATGCACACCTTTGTTCTCGAGAAGGAGGCGAGAG

GGAAGGGATGAGTCTTCAAGAATGTCTACGTCAGATGTACCACCTAGATCTCATATTTTCAGAAGAGATTCAAATGAAGTAGTTCATCTTGAAGCACAGG

GTGACTCCCTTGGGGCTGCTGCCAACCGACCACAAGCATCTGGAGCGTCAAGCAGTGCTGCTGCAGGTGGCTCCACCCCAGAGTTGCCTCAGGGTGGAAG

AAATCCAGGACTAACAGGGATTCTTCCTGGCTCCTTGTTCCGGTTTGCAGTCCCACCAGCACTCGGCAGTAATCTGGCTGACAATGTCATGATTACTGTA

GATATTATTCCTTCTGGTTGGAATTCAACTGATGGGAAAAATGATAAAGCTAAAAGTGCACCTTCAAGAGACCCAGAAAAACTTCAGAAAATCAAAGAAA

G - UNI6570 - CCTCCTTTTAGAGGACTCTGATGATGAAGAAGAAGGGGACTTATGTAGAATTTGTCAGATGGCAGCAGCGTCATCATCTAATTTAT

TGATAGAGCCGTGCAAATGCACAGGGAGCCTGCAGTACGTCCATCAAGAGTGTATGAAAAAGTGGTTACAAGCCAAAATTAATTCTG GCTCTTCATTAG

AGGCTGTGACTACCTGTGAACTCTGTAAAGAGAAGTTGCAACTTAACCTGGAGGATTTTGATATTCATGAACTACATAGAGCTCATGCAAATGAACAA -

 UNI16532 - GCTGAGTATGAGTTTATCAGCTCTGGTCTCTACCTAGTTGTCTTACTGCACTTGTGTGAACAAAGCTTTTCTGATATGATGGGAAATA

CAATTGAACCAAGCACTCGTGTCCGA TTTATTAACCTTGCAAGAACTCTTCAGGCACATATGGAAGATCTCGAAA CGGTAATAAGCCAGATTCTACTC

AG CTTCAGAGGATGAATTCTGAAGAAGATGGAGACCATAAGAGAATGCTTGATATTGCCTAACTTCATTT
Translation
 - UNI2331 - - UNI17611 - - UNI31239 -  - UNI17611 - - UNI24441 -  - UNI5287 - - UNI36800 -  - UNI65

70 - - UNI24324 - MITVDIIPSGWNSTDGKNDKAKSAPSRDPEKLQKIKES - UNI6570 - SLLLEDSDDEEEGDLCRICQMAAASSSNLLI

EPCKCTGSLQYVHQECMKKWLQAKINSG GSSLEAVTTCELCKEKLQLNLEDFDIHELHRAHANEQ - UNI16532 - AEYEFISSGLYLVVLLHLCE

QSFSDMMGNTIEPSTRVR FINLARTLQAHMEDLET TVISQILLS SFRG

For any suggestions or comments, please send an email to unitrap@crg.es