Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027010 (Slc25a12)
Chromosomal location
Chr 2: 71112803 - 71205640 (-)
Description
solute carrier family 25 (mitochondrial carrier, Aralar), member 12 Gene [Source:MGI (curated);Acc:Slc25a12-001]
RefSeq_dna
NM_172436 
RefSeq_peptide
NP_766024.1 
UniGene
Mm.409254 
MGI
MGI:1926080 
Uniprot/SWISSPROT
Q8BH59 
Uniprot/SPTREMBL
A2BFG0 
Human Ortholog
ENSG00000115840 (SLC25A12)
Omim not available
UniTrap UNI14439
Vector Insertion
Chr 2: 71204583 - 71205641
Public Clones FHCRC-GT-S12-8F1 (fhcrc)
Private Clones OST378503 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14364
Vector Insertion
Chr 2: 71181946 - 71204638
Public Clones (sanger) FHCRC-GT-S16-7A1 (fhcrc) PST24854-NR (escells) IST10012B11 (tigm)
IST12029F11 (tigm) IST10042G5 (tigm) IST13228E2 (tigm) IST10260D7 (tigm)
IST12450G1 (tigm) IST12843G11 (tigm) IST10396A11 (tigm) IST14954B7 (tigm)
IST14485A3 (tigm) IST12467E10 (tigm) IST13810B7 (tigm) IST10878G3 (tigm)
IST12795C1 (tigm) IST14215E11 (tigm) IST12412C11 (tigm) IST13619D11 (tigm)
IST13432H3 (tigm) IST12085E10 (tigm) IST14482G8 (tigm) IST10542E8 (tigm)
IST14684F10 (tigm) IST13835F8 (tigm) IST12024H9 (tigm) IST10212A6 (tigm)
IST15044A5 (tigm) IST15103G7 (tigm) IST15045B12 (tigm) IST13402H7 (tigm)
IST12593D11 (tigm) IST14966G10 (tigm) IST13077E11 (tigm) IST14394D11 (tigm)
IST13684E2 (tigm) IST14588C2 (tigm) IST11835G8 (tigm) IST14426H3 (tigm)
IST13539G7 (tigm) IST11329D9 (tigm) IST14465H12 (tigm) IST13558C11 (tigm)
IST13964H7 (tigm) IST14215F11 (tigm) IST13407C11 (tigm) IST10931C7 (tigm)
IST13173B1 (tigm) IST13945D1 (tigm) IST13102F8 (tigm) IST13249H11 (tigm)
IST14497A4 (tigm) IST10821A7 (tigm) IST14464D8 (tigm) IST14524B3 (tigm)
IST14457H11 (tigm) IST14308A5 (tigm) IST13923H4 (tigm) IST13447H11 (tigm)
IST13549C1 (tigm) IST11835F8 (tigm) IST14478A10 (tigm) IST10373D9 (tigm)
IST13251D11 (tigm) IST13688D2 (tigm) IST11500H3 (tigm) IST14343A5 (tigm)
IST10586D10 (tigm) IST10050F8 (tigm) IST14466B3 (tigm) IST14394G8 (tigm)
IST13711H1 (tigm) IST11781F8 (tigm) IST13666D9 (tigm) IST14209H8 (tigm)
IST11766E12 (tigm) IST13779B5 (tigm) IST11922B4 (tigm) IST13888D3 (tigm)
IST12965E6 (tigm) IST10975H2 (tigm) IST14791E2 (tigm) IST14444H3 (tigm)
IST10434B4 (tigm) IST12314H4 (tigm) IST14446A4 (tigm) IST13512E2 (tigm)
IST10482G8 (tigm) IST14143F12 (tigm) IST13520H12 (tigm) IST15058E1 (tigm)
IST12789C11 (tigm) IST14177A8 (tigm) IST12757D3 (tigm) IST12055A3 (tigm)
IST14168E1 (tigm) IST15045H8 (tigm) IST13980E3 (tigm) IST10806C3 (tigm)
IST14420E12 (tigm) IST14771A4 (tigm) IST14433A8 (tigm) IST10973E1 (tigm)
IST14073E1 (tigm) IST10578A5 (tigm) IST14615B11 (tigm) IST10222E12 (tigm)
IST14467B9 (tigm) IST10246A10 (tigm)
Private Clones OST439515 (lexicon) OST358635 (lexicon) OST338573 (lexicon) OST329211 (lexicon)
OST313248 (lexicon) OST296343 (lexicon) OST242521 (lexicon) OST213674 (lexicon)
OST209087 (lexicon) OST171038 (lexicon) OST104597 (lexicon) OST92670 (lexicon)
OST92348 (lexicon) OST90458 (lexicon) OST67546 (lexicon) OST57656 (lexicon)
OST55771 (lexicon) OST54773 (lexicon) OST34459 (lexicon) OST33770 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4925
Vector Insertion
Chr 2: 71171778 - 71181946
Public Clones AJ0651 (sanger) IST11295D4 (tigm) IST14699C11 (tigm) IST13692B4 (tigm)
IST10652B3 (tigm) IST11343D7 (tigm) IST11977G5 (tigm) IST10954C11 (tigm)
IST14901C2 (tigm) IST14593C12 (tigm) IST14593B12 (tigm) IST13655G11 (tigm)
IST10586C10 (tigm) IST14349A9 (tigm) IST10975G2 (tigm) IST12586C9 (tigm)
IST10217A10 (tigm) IST12910C11 (tigm) IST12263A2 (tigm) IST14261F11 (tigm)
IST12020D11 (tigm) IST14230D2 (tigm) IST14726D8 (tigm) IST10550A2 (tigm)
IST10783B3 (tigm) IST14388H8 (tigm) IST12150F11 (tigm) IST14441H6 (tigm)
IST12375G1 (tigm) IST13360F1 (tigm) IST14030F4 (tigm)
Private Clones OST447471 (lexicon) OST371049 (lexicon) OST329602 (lexicon) OST320525 (lexicon)
OST312291 (lexicon) OST255521 (lexicon) OST185658 (lexicon) OST103199 (lexicon)
OST57550 (lexicon) OST34492 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25576
Vector Insertion
Chr 2: 71162173 - 71171661
Public Clones E050H05 (ggtc) IST15052D11 (tigm)
Private Clones OST176009 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17258
Vector Insertion
Chr 2: 71153187 - 71162032
Public Clones not available
Private Clones OST446535 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25659
Vector Insertion
Chr 2: 71150621 - 71153039
Public Clones not available
Private Clones OST171256 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26348
Vector Insertion
Chr 2: 71120668 - 71131416
Public Clones IST10323B6 (tigm) IST12528F9 (tigm) IST10233F4 (tigm) IST12677A7 (tigm)
Private Clones OST123999 (lexicon) OST7421 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028396
Sequence
GCGCCCTGACAGCTCGGCCCAGCTCGCTCACTCGCTCGTTCCCGGCTTCCGAGCACAGCATGGCGGTCAAG - UNI14364 - - UNI14439 - GT

GCATACAACCAAACGAGGTGATCCTCATGAGCTGAGAAACATATTCCTCCAG - UNI14364 - - UNI14439 - TATGCCAGCACTGAGGTGGAC

GGGGAGCATTACATGACTCCAGAAGACTTCGTTCAACGCTATCTTGGCCTGTACAACGATCCAAACAGCAACCCAAAGATTGTGCAGCTCTTGGCAGGAG

TAGCTGATCAAACCAAGGATGG - UNI4925 - - UNI14364 - GTTGATCTCCTATCAAGAGTTTTTGGCATTTGAATCTGTTCTATGTGCTCCA

GATTCCATGTTCATAGTGGCTTTCCAACTGTTTGACAAGAGCGGAAATGGAGAGGTGACATTTG - UNI25576 - AAAATGTCAAGGAGATTTTTGG

GCAGACTATTATCCATCACCACATCCCTTTTAACTGGGACTGCGAGTTCATCCGGCTGCACTTTGGGCACAACCGCAAGAAGCACCTGAACTATGTGGAA

TTCACTCAGTTCCTCCAG - UNI17258 - GAATTGCAATTGGAACACGCAAGGCAAGCCTTTGCACTGAAAGACAAGAGCAAAAGCGGCATGATCTC

GGGTCTGGATTTCAGTGACGTCATGGTCACCATCCGGTCCCACATGCTCACTCCTTTTGTGGAGGAGAACCTGGTCTCA - UNI25659 - GCTGCCG

GAGGGGGTACCTCACACCAAGTTAGCTTCTCCTACTTCAACGCATTTAACTCCTTACTCAACAACATGGAGCTTGTTCGAAAGATCTATAGCACTTTAGC

AGGCACGAGGAAAGATATTGAAGTCACCAAGG AGGAATTTGCCCAGAGCGCCATACGCTATGGACAGGTCACTCCACTAGAAATTGATATCTTGTACCA

GCTTGCAGACCTATATAATGCCTCAGG GCGCTTGACTCTGGCAGACATCGAGAGAATAGCTCCGCTGGCCGAGGGGGCCTTACCTTACAACCTGGCAGA

GCTTCAGAGGCAG CAATCTCCTGGCTTGGGCAGACCTATCTGGCTCCAGATTGCCGAGTCTGCATACAGGTTCACTCTGGGCTCAGTTGCTGGAG CTG

TGGGGGCCACTGCGGTGTACCCCATAGACCTGGTGAAGACCCGGATGCAAAACCAGCGTGGTACGGGCTCTGTGGTCGGGGAGCTGATGTATAAAAACAG

CTTCGACTGTTTTAAGAAAGTGTTGCGCTACGAGGGTTTCTTTGGACTGTACCGAG GTCTGATCCCACAGCTGATAGGGGTTGCACCAGAAAAAGCCAT

TAAGCTAACA GTTAATGATTTTGTCCGGGACAAATTTACCAAAAGAGATGGCTCTATCCCACTGCCGGCGGAAATCCTTGCTGGAGGTTGC - UNI26

348 - GCTGGAGGCTCGCAGGTCATCTTTACCAACCCTCTGGAGATAGTGAAGATCCGCCTGCAGGTAGCCGGAGAGATCACCACAGGACCGAGAGTCA

GTGCTCTGAATGTGCTTCAGGACCTGGGACTTTTCGGGCTGTACAAG GGTGCCAAAGCCTGTTTCCTCCGAGACATTCCCTTCTCCGCAATCTATTTTC

CCGTGTACGCTCACTGCAAACTCCTCCTGGCTGATGAGAACGGACGCGTGGGAGGCATCAATCTCCTGACAGCGGGAGCCTTGGCAG GCGTACCTGCTG

CTTCTCTGGTGACCCCTGCTGATGTCATCAAGACAAGACTGCAAGTGGCCGCCAGGGCCGGCCAGACAACATACAGCGGGGTCGTCGACTGTTTCCGAAA

GATTCTCCGGGAAGAAGGGCCCTCGGCATTTTGGAAAGGGACTGCAG CTCGGGTGTTTCGATCCTCACCTCAGTTTGGTGTCACTCTGGTTACCTACGA

GCTTCTGCAGCGGTGGTTTTACATAGATTTTGGAGGCCT CAAACCTTCTGGCTCAGAACCAACGCCAAAGTCCCGCATCGCAGACCTCCCTCCTGCCAA

CCCCGATCACATCGGTGGCTACAGACTTGCCACGGCCACTTTCGCTGGCATTGAAAACAAGTTTGGCCTTTACCTCCCCAAGTTTAAGTCTCCTAGCGTA

GCTGTGGCTCAGCCCAAGGCGGCAGCAGCAGCCCAATGACATAGCAAGTACAGACCGAGGCCCAGGAGAACGGGCGGTACCGTGTCCAGTCAGCTGCATG

GTACTGTCAGCGCTGGGGTCAACCACTTTCTATACGACCTATACATGTATTGTTTATAAAGTGATCATACGCCCAGGGAGAGCCGCAGTGCAGTTTCAAG

CTTTAGTCTTTACGTGTTGAAATGTTTTCTGAGCCTTGGCATGAATTACGTGTTCTAGACTCTGCTTCGCACAGCTTGTACCTACAGTGACTGTACATAT

TGTACATCTTTGTACAGAGACACCTCGGCACCTCATCCCAACAAATCACGTTTATAAACATGAAACGCTGTTCTGAGTGGCTTGAACTGTACAGAAGGTT

TTGAAAGTGTTTTATTATGAATCATGTAAGAATAAATGTACTAAAGTT
Translation
MAVK - UNI14364 - - UNI14439 - VHTTKRGDPHELRNIFLQ - UNI14364 - - UNI14439 - YASTEVDGEHYMTPEDFVQRYLGL

YNDPNSNPKIVQLLAGVADQTKDG - UNI4925 - - UNI14364 - GLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFE - UNI2557

6 - ENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYVEFTQFLQ - UNI17258 - ELQLEHARQAFALKDKSKSGMISGLDFSDVMVTIR

SHMLTPFVEENLVS - UNI25659 - AAGGGTSHQVSFSYFNAFNSLLNNMELVRKIYSTLAGTRKDIEVTKE EEFAQSAIRYGQVTPLEIDILYQL

ADLYNASG GRLTLADIERIAPLAEGALPYNLAELQRQ QSPGLGRPIWLQIAESAYRFTLGSVAGA AVGATAVYPIDLVKTRMQNQRGTGSVVGELMY

KNSFDCFKKVLRYEGFFGLYRG GLIPQLIGVAPEKAIKLT VNDFVRDKFTKRDGSIPLPAEILAGGC - UNI26348 - AGGSQVIFTNPLEIVKI

RLQVAGEITTGPRVSALNVLQDLGLFGLYK GAKACFLRDIPFSAIYFPVYAHCKLLLADENGRVGGINLLTAGALAG GVPAASLVTPADVIKTRLQVA

ARAGQTTYSGVVDCFRKILREEGPSAFWKGTAA ARVFRSSPQFGVTLVTYELLQRWFYIDFGGL LKPSGSEPTPKSRIADLPPANPDHIGGYRLATAT

FAGIENKFGLYLPKFKSPSVAVAQPKAAAAAQ

For any suggestions or comments, please send an email to unitrap@crg.es