Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027030 (Stk39)
Chromosomal location
Chr 2: 68048503 - 68310325 (-)
Description
serine/threonine kinase 39, STE20/SPS1 homolog (yeast) Gene [Source:MGI (curated);Acc:Stk39-001]
RefSeq_dna
NM_016866 
RefSeq_peptide
NP_058562.1 
UniGene
Mm.198414 
MGI
MGI:1858416 
Uniprot/SWISSPROT
Q9Z1W9 
Uniprot/SPTREMBL
A2AQL0 Q3TR01 
Human Ortholog
ENSG00000198648 (STK39)
Omim not available
UniTrap UNI33120
Vector Insertion
Chr 2: 68105095 - 68145166
Public Clones IST11049G8 (tigm) IST12537H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102715
Sequence
CAGGAAGGGAGCGGGGCAAGCCCCGAAATCACCCCCCGAAGCCGCCCGGCTCCCAGCGCGTGGAAACTTCCCTGGCGGCGAGCAGGGCGGGAGGGGGCGG

CGGTTCCCCTCGGCGCTGAGAGCACCGTGCGCGCGAGGATCGGGGCGCGCGGCGGGCGCGGCGGCCGCCGCCTCCTCCCGTCCCCGCCTCCGCGGCGCAG

CCTCCTCCCTCCGCCCCGCTCGGCCTCCGGCTGGCTCCCTCCCCTCGTGGCAGGCTCCGGCGGCGGCGGCGGCTGCGGCGGACGGGGAGGGCGTGCGCCG

GCCGAGAGGTGTGGGCGACGAGGCTAGGGAAGTTTCAAGTGGAAGGTCGTCCGCCGGCCGGCGCGTCCCCTCACTCTCCTCCCGCAGCATCATGGCGGAG

CCGAGCGGCTCGCCTGTGCACGTCCAGCTTTCCCAGCAGGCGGCCCCGGTGACAGCGGCGGCGGCGACGGCCCCGGCGGCCGCGACATCAGCACCAGCCC

CGGCCCCGGCCCCGGCTCCGGCGGCGTCCGCAGCCCCGGCCCCGGCTCCAGCTGCTGCTCCAGCCCCGGCCCCGGCAGCTCAGGCGGTCGGCTGGCCCAT

CTGCAGGGACGCGTACGAGCTCCAGGAGGTTATCG GCAGCGGAGCAACTGCGGTGGTTCAGGCAGCCCTATGCAAACCCAGGCAAGAACGCGTAGCCAT

AAAGCGGATCAACTTGGAAAAATGCCAGACGAGTATGGATGAACTCCTG AAAGAAATTCAAGCCATGAGCCAATGCAGCCATCCCAACGTAGTGACTTA

TTACACCTCCTTTGTGGTCAAAGATGAGCTGTGGCTGGTCATGAAATTACTAAGTGGAG GTTCCATGTTGGATATCATCAAATACATCGTTAATCGAGG

AGAACATAAAAATGGTGTCCTAGAAGAGGCGATAATTGCAACAATTCTTAAGGAGGTTTTGGAAGGTTTAGACTATCTGCACAGAAACGGTCAGATCCAT

AG GGATTTGAAAGCTGGAAATATTCTTCTGGGTGAGGATGGCTCAGTACAAATAGCAG ATTTTGGAGTAAGCGCATTCTTAGCCACAGGGGGTGATGT

TACACGGAATAAAGTCAGAAAAACATTTGTTGGTACCCCATGTTGGATGGCCCCTGAAGTCATGGAACAG GTGAGAGGCTATGACTTCAAGGCTGATAT

GTGGAGTTTTGGAATAACTGCCATTGAATTAGCAACCGGAGCAGCGCCTTACCACAAATACCCTCCAATGAAA GTGCTAATGCTGACTTTGCAAAATGA

CCCGCCCACTTTAGAAACTGGTGTAGAGGATAAAGAAATGATGAAAAAATACGGCAAGTCCTTCAGAAAGTTACTGTCACTGTGTCTTCAGAAAGATCCT

TCCAAAAG GCCCACAGCAGCAGAACTTTTAAAATGCAAGTTCTTCCAGAAAGCCAAG AACAGAGAGTACCTGATCGAGAAGCTGCTGACAAGAACCCC

AGACATAGCCCAAAGAGCCAAGAAG GTAAGGCGAGTTCCTGGGTCGAGCGGTCACCTTCATAAGACTGAAGACGGCGACTGGGAGTGGAGCGATGACGA

GATGGATGAGAAGAGCGAGGAGGGGAAGGCAGCCGCCTCCCAAGAGAAG TCACGAAGAGTAAAAGAAGAGAACTCAGAG ATCTCGGTGAATGCTGGTG

GCATCCCTGAGCAAATACAGTCTCTCTCTGTGCACGACTCTCAG - UNI33120 - GCCCAACCAAACGCTAATGAAGACTACAGAGAAGGTCCTTGT

GCAGTCAACCTTGTTTTAAGATTAAG - UNI33120 - AAACTCCAGAAAGGAACTTAATGACATACGATTTGAGTTTACTCCAGGAAGAG - UNI3

3120 - ATACAGCAGACGGTGTGTCTCAGGAGCTCTTCTCTGCTGGCTTGGTTGACGGCCATGATGTAGTTATAG TGGCTGCTAATTTACAGAAGATT

GTAGATGACCCCAAAGCTTTAAAAACGTTGACATTTAAGTTG GCTTCTGGCTGCGATGGGTCGGAGATTCCTGATGAAGTGAAGCTGATCGGGTTCGCC

CAGTTGAGTGTGAGCTGATGTACGCCCCTTGCTGTCACCCTCATCTGTCGTGACCCTTCCCTCTCCCAGCTCCCCCTTTGCCTCCTTCCTCTCACCCCCT

CACTCCCAAATCCCAACAAATAAGAAGATTGTGAAGAGGCTGGCTTCGATGAAGTGCGATCAAAAAAAAATAATAATAATAATTTAAAAAAAAAAAACTG

TGAGCACTCCGAGTTCTGCTTTATTGTCCAGCAACCCACAGTGTGAGCACAGGCAAGCCCTACAGCTGCGCAACTGTTGCTGATTCCTTTCCAGAGAGCT

ATTTACTATTCTTAGCAGTCAATTTGGCTAGCCCGTAAGTGAGGCGTCGGAAACACACTCAGGTGGTCCTATCTCTTGGCAGCAAAAGGAATCTTCTACC

AGAAGCCTTTTCTCCTCTTACTGTTGTATTTCTGTTTAAGACTTTAATTGTACATCTGACAATACTGCCTCTTTTATGTTGTACTTAGAAATTAATATAC

TTATAAAATTAAGATTTATTAGCCAAACTTGAATTCTAGTTTTAAAACTGACTGTGAATTTTATTTTTCATATATTTATGCTTTACACACCGTAGCTCCG

AGGGGGAAAGTTTTGATTACGCGCTTTCTGCAATTGATCTCTTGTTATTTAAACCAACGGTTTCAGGTCAATCTTTGGAGTATTTGTAGCTTCTAATTTT

TGAAATGACTGAATTAAGAATTTGGATGCTTGCTCTTTTGGTTGGTTTGCCTAAAATCCAGCCCACAATCCAGTCGTCTCTTGGGAGAGGGAGGTGCCTT

GCAAACTTTCATATAACGAATGTGCCTGAGGCTGCTTAACTCTGGACTAGTCTCAGATCTCAAACCTGCACTACACGAGGAGGCATACTTTTGCTTCATC

TGGACATTTAGAATACTGTAACCTTGCTGCCGTTCTGTTAGATTGCTAACTACGTCCCCCGTCTCCAATTTGGCTCTCCTTAGGCGATAGGATTTGTTGT

TTTTAAGGCAATAAACTTGACAACACCAGAATCCAAGTTTTACTTGAAAAGCTCGGCAGAATACACAGTGGTGTGAAAAAAACAACAGAAAGGGTTTTTT

TGTGCAATGACAAACGGTAAAAATGCTGTAAACGTTGAAGAATAAATATTTCCAACGCAAGAACCTCCTGCTTGACTGTGTATTATGAACCCAGGAAACC

TTAGAAGTTTCAAATTTGGAGTCAAGACCTTCAAGAAGGTGGGCTCCGGGGATGGTACCATTGCTCTTTCCTAGCTAACCCTAGATACGGCAGCTCTTTA

ATGTACTTTAAAAAGCAAATATATATTACTAAGGAAAGAAGTTATTTATAATTGCCTTGTCATAATCGTTAAGGTGTTCTAGAACCATTTGCATACAATT

TAATGTAATTCCATTCCATTCTGTTGTTTACACAATTACTCAAAGATGACTGCAAAGGTAAACGGAAAAATAAAAGTGTATTGCACAGTGC
Translation
MAEPSGSPVHVQLSQQAAPVTAAAATAPAAATSAPAPAPAPAPAASAAPAPAPAAAPAPAPAAQAVGWPICRDAYELQEVIG GSGATAVVQAALCKPRQ

ERVAIKRINLEKCQTSMDELL KEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGG GSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYL

HRNGQIHR RDLKAGNILLGEDGSVQIAD DFGVSAFLATGGDVTRNKVRKTFVGTPCWMAPEVMEQ VRGYDFKADMWSFGITAIELATGAAPYHKYPP

MK VLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKR RPTAAELLKCKFFQKAK NREYLIEKLLTRTPDIAQRAKK VRRVPGSSGH

LHKTEDGDWEWSDDEMDEKSEEGKAAASQEK SRRVKEENSE ISVNAGGIPEQIQSLSVHDSQ - UNI33120 - AQPNANEDYREGPCAVNLVLRL

R - UNI33120 - RNSRKELNDIRFEFTPGRD - UNI33120 - DTADGVSQELFSAGLVDGHDVVIV VAANLQKIVDDPKALKTLTFKL ASGC

DGSEIPDEVKLIGFAQLSVS

For any suggestions or comments, please send an email to unitrap@crg.es