Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027078 (Ube2l6)
Chromosomal location
Chr 2: 84638996 - 84650333 (+)
Description
ubiquitin-conjugating enzyme E2L 6 Gene [Source:MGI (curated);Acc:Ube2l6-001]
RefSeq_dna
NM_019949 
RefSeq_peptide
NP_064333.1 
UniGene
Mm.38261 
MGI
MGI:1914500 
Uniprot/SWISSPROT
Q9QZU9 
Uniprot/SPTREMBL
A2ATS0 Q3U8R0 Q4FJY2 A2ATR9 
Human Ortholog
ENSG00000156587 (UBE2L6)
Omim not available
UniTrap UNI23175
Vector Insertion
Chr 2: 84639090 - 84642935
Public Clones not available
Private Clones OST273861 (lexicon) OST178763 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28930
Vector Insertion
Chr 2: 84643678 - 84646493
Public Clones IST11893H4 (tigm) IST11696H4 (tigm) IST10107G8 (tigm) IST11826B11 (tigm)
Private Clones OST15763 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22780
Vector Insertion
Chr 2: 84646681 - 84649161
Public Clones IST12527B2 (tigm) IST12663A5 (tigm) IST10227F10 (tigm) IST10792D3 (tigm)
IST12038D2 (tigm) IST11298C6 (tigm) IST12759B5 (tigm) IST11959B4 (tigm)
IST11677F11 (tigm) IST10750A7 (tigm) IST10791G1 (tigm)
Private Clones OST285099 (lexicon) OST282790 (lexicon) OST245271 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028473
Sequence
TCGGGAGCTGCAGTTCAGAGAGCGGTGTCCTGCTGGAATCTGCTGGTGCCCCACGCTCCAACCCGAGATGATGGCCAGCAAGCGAGTGGCGAAA - UNI

23175 - GAGCTGGAGAGTCTTTCGAAGGAGCTGCCGCCATACCTTCGCCAACTGTCTAGTGACGATGCCAATGTGCTTGTGTGGCACATGCTCCTGCT

GCCA - UNI28930 - GACCAGCTTCCCTATGGCCTCAAAGCCTTCCAAGTGCGGATTGATTTCCCCAGGGAGTATCCATTCAAGCCTCCCACTTTGA

GATTCACCACCAAGATCTACCACCCCAACGTCAGGGAGGATGGTCTGGTGTGCCTGCCCCTCATCAGCAATGAGAACTGGAAGCCTTACACCAAGCCTTA

TCAAG - UNI22780 - TCTTGGAGGCCCTCAATGTGCTGGTGAGTAAACCGAATCTGGAAGAGCCTGTGCGTCTGGAACTTGCTGACCTCCTGACTC

AGAACCCGGAGATGTTCAGGAAGAAGGCAGAAGAGTTCACCCTTAAATTCGGAGTGGACCGGCCCTCTTAATTCTGTTCTGAAGCCTGGATCGTCTGCTT

AGCAGATGGATATCACCGACTGGTGCCCGAGGCCTTGGGAAGCTCACCCTGTGCCTAAGTTTTCCTTTGTAGTTGCTAATTATGAATCTTGTACCTGGTG

TGTATGTATGTGATGGAGGTGGGGGGGCCTGTGTGATGTGTGCTCCTTCCCTGAGCTGTCTGGCTGTAGATGTACCATCCCCACATCCTCCTTGGCTTCA

GAGCCAGTGGGAGTTAGGTACACACAGTTTCAGGCCTGCTTTCCAGCTCTCTCTGTCTTAGGCCACCTTTCAGGCCAATTGGCAGAAAATTGAATGCCCC

AGGGCCCAGGCACCAAGGGGTGAGAAAGGCAGGACTCTGCTCAGAAGGCAGAGCCTACAGAAGGTACCAAATTTACTGTTGAGTGATTGAGATTGAAAGA

GTAGTAAACTCAGTGCTCCAAGGTATGCTAATCATAAAACAGATAGTGACATTCCTCCACCCACCCACTTCCTGAGTTCAAGGAGTATTCATTCAAAGAA

AGTCACCTTGACTTTCTTTGAATGAATACTGCAATGCAAATGTGCTATTGTTAGAGGCTCTTAGAAACTGTCTTGAGAGTTAACAATTACCAGGTATTCC

TTGTGACACCTGTGACTTTGTACTTCCTTGTGACTCTTATCTGGTATTTTTGGTATTTTCCAACAACGCCCTTCCCACCTCCTTGAGTTGTGTTTTTTTT

CCTTTAAATACCCCCTTACTCAGCTACTCGGGGCGCCACGGTCCTCTACCCCTGCGTGGTGTATGACCGTGGGCCCGAGAGCGCTCTTGAATAAAAATCC

TCTTGCAATTTGCAGCAAGACCGTTTCTCGTGGGTGATTTTGGGGTGTCGCCCCTCCTGAGTCAGAACGTGGGGGAGTCCTCACGTTGTGGGTCTTTCAA

GATCAACGGCGCTTGTCATAGGCATGTCCAGATTTAAGTGTTAAACATCTTATTTTCCACTGATGAATCTCAAGATAAAGAGTCTAACCTC
Translation
MMASKRVAK - UNI23175 - ELESLSKELPPYLRQLSSDDANVLVWHMLLLP - UNI28930 - DQLPYGLKAFQVRIDFPREYPFKPPTLRFTT

KIYHPNVREDGLVCLPLISNENWKPYTKPYQV - UNI22780 - VLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAEEFTLKFGVDRPS
Transcript ENSMUST00000111637
Sequence
TCGGGAGCTGCAGTTCAGAGAGCGGTGTCCTGCTGGAATCTGCTGGTGCCCCACGCTCCAACCCGAGATGATGGCCAGCAAGCGAGTGGCGAAA - UNI

23175 - GAGCTGGAGAGTCTTTCGAAGGAGCTGCCGCCATACCTTCGCCAACTGTCTAGTGACGATGCCAATGTGCTTGTGTGGCACATGCTCCTGCT

GCCA ACTTTAGTCTGGACTTTTCTAAGTAGTCTAGACAGGCTAACCAGCCAGCCCCAGGGATCTGCCTGTTTGTCCTCCGGCATGGGGATTACAAAG -

 UNI28930 - GACCAGCTTCCCTATGGCCTCAAAGCCTTCCAAGTGCGGATTGATTTCCCCAGGGAGTATCCATTCAAGCCTCCCACTTTGAGATTCA

CCACCAAGATCTACCACCCCAACGTCAGGGAGGATGGTCTGGTGTGCCTGCCCCTCATCAGCAATGAGAACTGGAAGCCTTACACCAAGCCTTATCAAG 

- UNI22780 - TCTTGGAGGCCCTCAATGTGCTGGTGAGTAAACCGAATCTGGAAGAGCCTGTGCGTCTGGAACTTGCTGACCTCCTGACTCAGAACC

CGGAGATGTTCAGGAAGAAGGCAGAAGAGTTCACCCTTAAATTCGGAGTGGACCGGCCCTCTTAATTCTGTTCTGAAGCCTGGATCGTCTGCTTAGCAGA

TGGATATCACCGACTGGTGCCCGAGGCCTTGGGAAGCTCACCCTGTGCCTAAGTTTTCCTTTGTAGTTGCTAATTATGAATCTTGTACCTGGTGTGTATG

TATGTGATGGAGGTGGGGGGGCCTGTGTGATGTGTGCTCCTTCCCTGAGCTGTCTGGCTGTAGATGTACCATCCCCACATCCTCCTTGGCTTCAGAGCCA

GTGGGAGTTAGGTACACACAGTTTCAGGCCTGCTTTCCAGCTCTCTCTGTCTTAGGCCACCTTTCAGGCCAATTGGCAGAAAATTGAATGCCCCAGGGCC

CAGGCACCAAGGGGTGAGAAAGGCAGGACTCTGCTCAGAAGGCAGAGCCTACAGAAGGTACCAAATTTACTGTTGAGTGATTGAGATTGAAAGAGTAGTA

AACTCAGTGCTCCAAGGTATGCTAATCATAAAACAGATAGTGACATTCCTCCACCCACCCACTTCCTGAGTTCAAGGAGTATTCATTCAAAGAAAGTCAC

CTTGACTTTCTTTGAATGAATACTGCAATGCAAATGTGCTATTGTTAGAGGCTCTTAGAAACTGTCTTGAGAGTTAACAATTACCAGGTATTCCTTGTGA

CACCTGTGACTTTGTACTTCCTTGTGACTCTTATCTGGTATTTTTGGTATTTTCCAACAACGCCCTTCCCACCTCCTTGAGTTGTGTTTTTTTTCCTTTA

AATACCCCCTTACTCAGCTACTCGGGGCGCCACGGTCCTCTACCCCTGCGTGGTGTATGACCGTGGGCCCGAGAGCGCTCTTGAATAAAAATCCTCTTGC

AATTTGCAGCAAGACCGTTTCTCGTGGGTGATTTTGGGGTGTCGCCCCTCCTGAGTCAGAACGTGGGGGAGTCCTCACGTTGTGGGTCTTTCAAGATCAA

CGGCGCTTGTCATAGGCATGTCCAGATTTAAGTGTTAAACATCTTATTTTCCACTGATGAATCTCAAGATAAAGAGTCTAACCTC
Translation
MASKRVAK - UNI23175 - ELESLSKELPPYLRQLSSDDANVLVWHMLLLP TLVWTFLSSLDRLTSQPQGSACLSSGMGITK - UNI28930 - 

DQLPYGLKAFQVRIDFPREYPFKPPTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQV - UNI22780 - VLEALNVLVSKPNLEEPVRLELA

DLLTQNPEMFRKKAEEFTLKFGVDRPS
Transcript ENSMUST00000102642
Sequence
TCGGGAGCTGCAGTTCAGAGAGCGGTGTCCTGCTGGAATCTGCTGGTGCCCCACGCTCCAACCCGAGATGATGGCCAGCAAGCGAGTGGCGAAA - UNI

23175 - GAGCTGGAGAGTCTTTCGAAGGAGCTGCCGCCATACCTTCGCCAACTGTCTAGTGACGATGCCAATGTGCTTGTGTGGCACATGCTCCTGCT

GCCA - UNI28930 - GACCAGCTTCCCTATGGCCTCAAAGCCTTCCAAGTGCGGATTGATTTCCCCAGGGAGTATCCATTCAAGCCTCCCACTTTGA

GATTCACCACCAAGATCTACCACCCCAACGTCAGGGAGGATGGTCTGGTGTGCCTGCCCCTCATCAGCAATGAGAACTGGAAGCCTTACACCAAGCCTTA

TCAAG - UNI22780 - TCTTGGAGGCCCTCAATGTGCTGGTGAGTAAACCGAATCTGGAAGAGCCTGTGCGTCTGGAACTTGCTGACCTCCTGACTC

AGAACCCGGAGATGTTCAGGAAGAAGGCAGAAGAGTTCACCCTTAAATTCGGAGTGGACCGGCCCTCTTAATTCTGTTCTGAAGCCTGGATCGTCTGCTT

AGCAGATGGATATCACCGACTGGTGCCCGAGGCCTTGGGAAGCTCACCCTGTGCCTAAGTTTTCCTTTGTAGTTGCTAATTATGAATCTTGTACCTGGTG

TGTATGTATGTGATGGAGGTGGGGGGGCCTGTGTGATGTGTGCTCCTTCCCTGAGCTGTCTGGCTGTAGATGTACCATCCCCACATCCTCCTTGGCTTCA

GAGCCAGTGGGAGTTAGGTACACACAGTTTCAGGCCTGCTTTCCAGCTCTCTCTGTCTTAGGCCACCTTTCAGGCCAATTGGCAGAAAATTGAATGCCCC

AGGGCCCAGGCACCAAGGGGTGAGAAAGGCAGGACTCTGCTCAGAAGGCAGAGCCTACAGAAGGTACCAAATTTACTGTTGAGTGATTGAGATTGAAAGA

GTAGTAAACTCAGTGCTCCAAGGTATGCTAATCATAAAACAGATAGTGACATTCCTCCACCCACCCACTTCCTGAGTTCAAGGAGTATTCATTCAAAGAA

AGTCACCTTGACTTTCTTTGAATGAATACTGCAATGCAAATGTGCTATTGTTAGAGGCTCTTAGAAACTGTCTTGAGAGTTAACAATTACCAGGTATTCC

TTGTGACACCTGTGACTTTGTACTTCCTTGTGACTCTTATCTGGTATTTTTGGTATTTTCCAACAACGCCCTTCCCACCTCCTTGAGTTGTGTTTTTTTT

CCTTTAAATACCCCCTTACTCAGCTACTCGGGGCGCCACGGTCCTCTACCCCTGCGTGGTGTATGACCGTGGGCCCGAGAGCGCTCTTGAATAAAAATCC

TCTTGCAATTTGCAGCAAGACCGTTTCTCGTGGGTGATTTTGGGGTGTCGCCCCTCCTGAGTCAGAACGTGGGGGAGTCCTCACGTTGTGGGTCTTTCAA

GATCAACGGCGCTTGTCATAGGCATGTCCAGATTTAAGTGTTAAACATCTTATTTTCCACTGATGAATCTCAAGATAAAGAGTCTAACCTC
Translation
MASKRVAK - UNI23175 - ELESLSKELPPYLRQLSSDDANVLVWHMLLLP - UNI28930 - DQLPYGLKAFQVRIDFPREYPFKPPTLRFTTK

IYHPNVREDGLVCLPLISNENWKPYTKPYQV - UNI22780 - VLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAEEFTLKFGVDRPS

For any suggestions or comments, please send an email to unitrap@crg.es