Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027082 (Tfpi)
Chromosomal location
Chr 2: 84273012 - 84316932 (-)
Description
tissue factor pathway inhibitor Gene [Source:MGI (curated);Acc:Tfpi-001]
RefSeq_dna
NM_011576 
RefSeq_peptide
NP_035706.1 
UniGene
Mm.395995 
MGI
MGI:1095418 
Uniprot/SWISSPROT
O54819 
Uniprot/SPTREMBL
A2ARA1 A2ARA0 Q8BSB7 Q8CI80 A2ARA4 A2ARA3 
Human Ortholog
ENSG00000003436 (TFPI)
Omim not available
UniTrap UNI22437
Vector Insertion
Chr 2: 84316897 - 84316921
Public Clones not available
Private Clones OST297028 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34093
Vector Insertion
Chr 2: 84314918 - 84316906
Public Clones IST14829B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27580
Vector Insertion
Chr 2: 84313957 - 84314099
Public Clones not available
Private Clones OST56161 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12603
Vector Insertion
Chr 2: 84313855 - 84313942
Public Clones F034E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12892
Vector Insertion
Chr 2: 84298291 - 84313855
Public Clones E026C01 (ggtc) E062F12 (ggtc) CMHD-GT_353A7-3 (cmhd) FHCRC-GT-S11-7E1 (fhcrc)
IST14791B3 (tigm) IST14205G11 (tigm)
Private Clones OST420330 (lexicon) OST418349 (lexicon) OST408557 (lexicon) OST403345 (lexicon)
OST393703 (lexicon) OST379797 (lexicon) OST378247 (lexicon) OST339419 (lexicon)
OST319295 (lexicon) OST302179 (lexicon) OST292401 (lexicon) OST288368 (lexicon)
OST281436 (lexicon) OST263126 (lexicon) OST252910 (lexicon) OST251287 (lexicon)
OST250752 (lexicon) OST224005 (lexicon) OST219337 (lexicon) OST195902 (lexicon)
OST186176 (lexicon) OST184784 (lexicon) OST175041 (lexicon) OST168252 (lexicon)
OST128157 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22513
Vector Insertion
Chr 2: 84294155 - 84298179
Public Clones not available
Private Clones OST294712 (lexicon) OST244215 (lexicon) OST206509 (lexicon) OST67045 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028487
Sequence
GCTTTAAAACCTCAGGACTCGAGAGAAGAGACTGGGGTTTTCGGCTTCCCGAGCAACCTTTACAGAGAATCTTTTTCTCCGTGTGTCTGACGC - UNI2

7580 - ACTGTATCACTTTCGGGACCTGTCTCCGGATTTCTTCTGAAGACGGTATAATTTTGGGACCTCATCTCCAGATCTCATTTAAGGACTACTGAC

TCATCAAG - UNI12603 - - UNI12892 - AAATGACTTACAAAATGAAGAAAGAATATGCCTTTTGGGCCACTGTGTGTCTGTTGCTTAGCCTT

GTTCCCGAGTTTCTTAATGCTCTGTCTGAGGAAGCTGATGACACAG - UNI22513 - ATTCTGAGCTGGGGTCAATGAAACCGCTACATACATTTTG

TGCAATGAAGGCAGATGATGGTCCATGCAAAGCAATGATAAGGAGTTATTTTTTCAATATGTATACTCATCAATGTGAAGAATTTATATACGGGGGATGT

GAAGGGAACGAGAACCGATTTGATACCCTGGAAGAGTGTAAGAAAACATGCATACCAG GTTATGAGAAGACAGCTGTGAAGGCAGCATCTGGAGCAG A

AAGGCCAGATTTCTGCTTCTTGGAAGAGGACCCTGGACTCTGCCGAGGTTACATGAAGAGGTATCTTTATAACAACCAGACAAAGCAGTGTGAACGATTC

GTGTACGGTGGCTGCCTGGGCAACCGCAACAACTTTGAAACTTTGGATGAGTGCAAGAAGATCTGTGAGAATCCAG TCCACTCCCCTTCCCCAGTGAAT

GAGGTACAGATGAGTGACTACGTAACTGATGGAAATACTGTAACTGATCGCAGTACTGTAAATAACATCGTGGTTCCCCAGTCTCCCAAAGTGCCCAGGC

GTCGGG ATTATCGTGGCCGTCCCTGGTGTCTTCAACCAGCAGACAGTGGATTATGTAAAGCCAGTGAGAGAAGATTCTACTACAATTCAGCCACTGGGA

AATGCCACCGATTTAACTACACTGGATGTGGGGGAAATAATAATAATTTTACTACCAGAAGGAGATGTCTGAGATCATGTAAAACAG GTCTCATCAAAA

ACAAGTCAAAAGGAGTAGTTAAGATTCAGAGAAGAAAGGCGCCCTTCGTGAAAGTTGTATATGAAAGCATTAATTAGTGCTAAGATATAAGCACATTAAA

TTTTTACATTAGTTTCACTAAATATTCCTATACGGTGCTTCTACTGTGATTTTTATTCTTCTACAAACCAGTGTCTTGTTTCCATTGGTGACCATCTATT

AGAAGATATATTTTCGCCAGTTATGATCACAAACATTACATACCCTTGACAGTCTAAACCTTTTCGAATGATTTTAATTTTTAACAATGTGAGAAATAAA

ATCTTTCATCCTGAGC
Translation
 - UNI27580 -  - UNI12603 - - UNI12892 - MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTD - UNI22513 - DSELGSMK

PLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPG GYEKTAVKAASGAE ERPDFCFLEEDPGLCRGYMKRYLYN

NQTKQCERFVYGGCLGNRNNFETLDECKKICENPV VHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRD DYRGRPWCLQPADSGLCKA

SERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTG GLIKNKSKGVVKIQRRKAPFVKVVYESIN
Transcript ENSMUST00000111718
Sequence
AGTGTTTTACCAGGGCTAGATTCATCAGAACTCCACTGAGTGAACCCTGAAGTCTTCACATCGTATACCATCTTGAAAGTCTCATTTTTCACGCACCTTA

AATCATTTTCACATACTTTGAATCCCTTCCTCAGACCTTGGCAAGTTGCATAAACTTTAAACTTTTTTTTTTTTTTTAAAATCTGGAAAACTCTAATACT

TTGAGGCATAGGTGTTTGATTAGTGAACAAAGTCACAAAAAAGTAAGCTCTTTTGAATAAAGGAACAGCAGAGAGCAAGTTTTGAGTAACAACACGATGG

CTTGAGTTTGCTCTCACACTGAAATCTGTTTTTGTGAGTTTATCTTTCTCAGCAGGAAGCCTGTCAGCGAGGCAAACGTGTCTGTGAGCTTGCCTGTCTC

AGCTGGAGACCTGAGCTCTGGAAAAGGCAAGGCCTTAGGAAACGGTCTGACTAAGCAGCTGTGTCCCTGAGAAGGCAAGGCCTTAGGAAACGGTCTGACT

AAGCAGCTGTGTCCCTGAG - UNI34093 - CTTCCAGGGGAGAATCCTTACTGAGGGACTGGCTCAACAAGGTCAAGACCTGATGAGGACATGTCAC

ACATAGTTTCACAGTTTCATAGTTTCGGACCAATCAACGGCAAACTGACCAACCCTGAAGTGGGGGAGGAAGACTCTTCGAATGCTTTAAAACCTCAGGA

CTCGAGAGAAGAGACTGGGGTTTTCGGCTTCCCGAGCAACCTTTACAGAGAATCTTTTTCTCCGTGTGTCTGACGC - UNI27580 - ACTGTATCAC

TTTCGGGACCTGTCTCCGGATTTCTTCTGAAGACGGTATAATTTTGGGACCTCATCTCCAGATCTCATTTAAGGACTACTGACTCATCAAG - UNI126

03 - - UNI12892 - AAATGACTTACAAAATGAAGAAAGAATATGCCTTTTGGGCCACTGTGTGTCTGTTGCTTAGCCTTGTTCCCGAGTTTCTTAA

TGCTCTGTCTGAGGAAGCTGATGACACAG - UNI22513 - ATTCTGAGCTGGGGTCAATGAAACCGCTACATACATTTTGTGCAATGAAGGCAGATG

ATGGTCCATGCAAAGCAATGATAAGGAGTTATTTTTTCAATATGTATACTCATCAATGTGAAGAATTTATATACGGGGGATGTGAAGGGAACGAGAACCG

ATTTGATACCCTGGAAGAGTGTAAGAAAACATGCATACCAG GTTATGAGAAGACAGCTGTGAAGGCAGCATCTGGAGCAG AAAGGCCAGATTTCTGCT

TCTTGGAAGAGGACCCTGGACTCTGCCGAGGTTACATGAAGAGGTATCTTTATAACAACCAGACAAAGCAGTGTGAACGATTCGTGTACGGTGGCTGCCT

GGGCAACCGCAACAACTTTGAAACTTTGGATGAGTGCAAGAAGATCTGTGAGAATCCAG TCCACTCCCCTTCCCCAGTGAATGAGGTACAGATGAGTGA

CTACGTAACTGATGGAAATACTGTAACTGATCGCAGTACTGTAAATAACATCGTGGTTCCCCAGTCTCCCAAAGTGCCCAGGCGTCGGG ATTATCGTGG

CCGTCCCTGGTGTCTTCAACCAGCAGACAGTGGATTATGTAAAGCCAGTGAGAGAAGATTCTACTACAATTCAGCCACTGGGAAATGCCACCGATTTAAC

TACACTGGATGTGGGGGAAATAATAATAATTTTACTACCAGAAGGAGATGTCTGAGATCATGTAAAACAG GTCTCATCAAAAACAAGTCAAAAGGAGTA

GTTAAGATTCAGAGAAGAAAGGCGCCCTTCGTGAAAGTTGTATATGAAAGCATTAATTAGTGCTAAGATATAAGCACATTAAATTTTTACATTAGTTTCA

CTAAATATTCCTATACGGTGCTTCTACTGTGATTTTTATTCTTCTACAAACCAGTGTCTTGTTTCCATTGGTGACCATCTATTAGAAGATATATTTTCGC

CAGTTATGATCACAAACATTACATACCCTTGACAGTCTAAACCTTTTCGAATGATTTTAATTTTTAACAATGTGAGAAATAAAATCTTTCATCCTGAGCA

A
Translation
 - UNI34093 -  - UNI27580 -  - UNI12603 - - UNI12892 - MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTD - UNI22

513 - DSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPG GYEKTAVKAASGAE ERPDFCFLEED

PGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPV VHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRD DYRGR

PWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTG GLIKNKSKGVVKIQRRKAPFVKVVYESIN
Transcript ENSMUST00000111722
Sequence
GGACCTGTCTCCGGATTTCTTCTGAAGACGGTATAATTTTGGGACCTCATCTCCAGATCTCATTTAAGGACTACTGACTCATCAAG - UNI12603 - 

- UNI12892 - AAATGACTTACAAAATGAAGAAAGAATATGCCTTTTGGGCCACTGTGTGTCTGTTGCTTAGCCTTGTTCCCGAGTTTCTTAATGCTC

TGTCTGAGGAAGCTGATGACACAG - UNI22513 - ATTCTGAGCTGGGGTCAATGAAACCGCTACATACATTTTGTGCAATGAAGGCAGATGATGGT

CCATGCAAAGCAATGATAAGGAGTTATTTTTTCAATATGTATACTCATCAATGTGAAGAATTTATATACGGGGGATGTGAAGGGAACGAGAACCGATTTG

ATACCCTGGAAGAGTGTAAGAAAACATGCATACCAG GTTATGAGAAGACAGCTGTGAAGGCAGCATCTGGAGCAG AAAGGCCAGATTTCTGCTTCTTG

GAAGAGGACCCTGGACTCTGCCGAGGTTACATGAAGAGGTATCTTTATAACAACCAGACAAAGCAGTGTGAACGATTCGTGTACGGTGGCTGCCTGGGCA

ACCGCAACAACTTTGAAACTTTGGATGAGTGCAAGAAGATCTGTGAGAATCCAG TGAATGAGGTACAGATGAGTGACTACGTAACTGATGGAAATACTG

TAACTGATCGCAGTACTGTAAATAACATCGTGGTTCCCCAGTCTCCCAAAGTGCCCAGGCGTCGGG ATTATCGTGGCCGTCCCTGGTGTCTTCAACCAG

CAGACAGTGGATTATGTAAAGCCAGTGAGAGAAGATTCTACTACAATTCAGCCACTGGGAAATGCCACCGATTTAACTACACTGGATGTGGGGGAAATAA

TAATAATTTTACTACCAGAAGGAGATGTCTGAGATCATGTAAAACAG GTCTCATCAAAAACAAGTCAAAAGGAGTAGTTAAGATTCAGAGAAGAAAGGC

GCCCTTCGTGAAAGTTGTATATGAAAGCATTAATTAGTGCTAAGATATAAGCACATTAAATTTTTACATTAGTTTCACTAAATATTCCTATACGGTGCTT

CTACTGTGATTTTTATTCTTCTACAAACCAGTGTCTTGTTTCCATTGGTGACCATCTATTAGAAGATATATTTTCGCCAGTTATGATCACAAACATTACA

TACCCTTGACAGTCTAAACCTTTTCGAATGATTTTAATTTTTAACAATGTGAGAAATAAAATCTTTCATCCTGAGCAA
Translation
 - UNI12603 - - UNI12892 - MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTD - UNI22513 - DSELGSMKPLHTFCAMKADDGP

CKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPG GYEKTAVKAASGAE ERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGC

LGNRNNFETLDECKKICENPV VNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRD DYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYT

GCGGNNNNFTTRRRCLRSCKTG GLIKNKSKGVVKIQRRKAPFVKVVYESIN
Transcript ENSMUST00000111717
Sequence
GCTTTAAAACCTCAGGACTCGAGAGAAGAGACTGGGGTTTTCGGCTTCCCGAGCAACCTTTACAGAGAATCTTTTTCTCCGTGTGTCTGACGC - UNI2

7580 - ACTGTATCACTTTCGGGACCTGTCTCCGGATTTCTTCTGAAGACGGTATAATTTTGGGACCTCATCTCCAGATCTCATTTAAGGACTACTGAC

TCATCAAG - UNI12603 - - UNI12892 - AAATGACTTACAAAATGAAGAAAGAATATGCCTTTTGGGCCACTGTGTGTCTGTTGCTTAGCCTT

GTTCCCGAGTTTCTTAATGCTCTGTCTGAGGAAGCTGATGACACAG - UNI22513 - ATTCTGAGCTGGGGTCAATGAAACCGCTACATACATTTTG

TGCAATGAAGGCAGATGATGGTCCATGCAAAGCAATGATAAGGAGTTATTTTTTCAATATGTATACTCATCAATGTGAAGAATTTATATACGGGGGATGT

GAAGGGAACGAGAACCGATTTGATACCCTGGAAGAGTGTAAGAAAACATGCATACCAG GTTATGAGAAGACAGCTGTGAAGGCAGCATCTGGAGCAG A

AAGGCCAGATTTCTGCTTCTTGGAAGAGGACCCTGGACTCTGCCGAGGTTACATGAAGAGGTATCTTTATAACAACCAGACAAAGCAGTGTGAACGATTC

GTGTACGGTGGCTGCCTGGGCAACCGCAACAACTTTGAAACTTTGGATGAGTGCAAGAAGATCTGTGAGAATCCAG TCCACTCCCCTTCCCCAGTGAAT

GAGGTACAGATGAGTGACTACGTAACTGATGGAAATACTGTAACTGATCGCAGTACTGTAAATAACATCGTGGTTCCCCAGTCTCCCAAAGTGCCCAGGC

GTCGGG CTGCCTTGGTACTGTATCACCTTTATGATATTTTGAAAAAACTCATCTTTGGTTAG
Translation
 - UNI27580 -  - UNI12603 - - UNI12892 - MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTD - UNI22513 - DSELGSMK

PLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPG GYEKTAVKAASGAE ERPDFCFLEEDPGLCRGYMKRYLYN

NQTKQCERFVYGGCLGNRNNFETLDECKKICENPV VHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRA AALVLYHLYDILKKLIFG
Transcript ENSMUST00000090732
Sequence
ATCTTCTTCTGAAGGCATTTTGGCCATCTGCACAC - UNI22437 - - UNI27580 - - UNI34093 - ACTGTATCACTTTCGGGACCTGTCT

CCGGATTTCTTCTGAAGACGGTATAATTTTGGGACCTCATCTCCAGATCTCATTTAAGGACTACTGACTCATCAAG - UNI12603 - - UNI12892

 - AAATGACTTACAAAATGAAGAAAGAATATGCCTTTTGGGCCACTGTGTGTCTGTTGCTTAGCCTTGTTCCCGAGTTTCTTAATGCTCTGTCTGAGGA

AGCTGATGACACAG - UNI22513 - ATTCTGAGCTGGGGTCAATGAAACCGCTACATACATTTTGTGCAATGAAGGCAGATGATGGTCCATGCAAAG

CAATGATAAGGAGTTATTTTTTCAATATGTATACTCATCAATGTGAAGAATTTATATACGGGGGATGTGAAGGGAACGAGAACCGATTTGATACCCTGGA

AGAGTGTAAGAAAACATGCATACCAG GTTATGAGAAGACAGCTGTGAAGGCAGCATCTGGAGCAG AAAGGCCAGATTTCTGCTTCTTGGAAGAGGACC

CTGGACTCTGCCGAGGTTACATGAAGAGGTATCTTTATAACAACCAGACAAAGCAGTGTGAACGATTCGTGTACGGTGGCTGCCTGGGCAACCGCAACAA

CTTTGAAACTTTGGATGAGTGCAAGAAGATCTGTGAGAATCCAG TCCACTCCCCTTCCCCAGTGAATGAGGTACAGATGAGTGACTACGTAACTGATGG

AAATACTGTAACTGATCGCAGTACTGTAAATAACATCGTGGTTCCCCAGTCTCCCAAAGTGCCCAGGCGTCGGG CTGCCTTGGTACTGTATCACCTTTA

TGATATTTTGAAAAAACTCATCTTTGGTTAGACTTCAACAGCCTACTGCTAACTCAGTCTCCAGCACTTGGTCTTTGATTGAGAAAGGAGCGCCTAAGCA

CTGAGCCAGGGCCGTCCTGCTTCATGCCAGCCTCCAGGGCCAGGGAGAATGACTAGATGTAATAAAGAAGACCCTGTGGCCACTTGAAACTCTTTCCTGA

CTCTATCTAACAGCTAACCCAGGGCCAAACTCTACACTCACAGAAAACGGTGAGAAAGAAGTAAACACCTGTAATTATACACATAATCATTGGCCTTCTG

GAAGAGGAGTGATGTTGGCAGAGGAACTATTCAATAATCAAATGTCATCACCGATGGGTTCATGTTAGAGATCTGCAATAGAATGCTTTCACCTATACGT

TCTCTTGGAAGATATTGATTACATGCAGAGGAACTTCGCAATCATTTAAGTTTTCTGGGAAGAAAATATACCCCACCAACTAAGGAATTGCACATTTAAA

TGCATACCCCAAGAAGTCACGAGTGCAGTGGGCACTCATTTCATCAACAAGCACATACAGTTTGAAACAAATATGGTGGCCTTCAAATGTATTCTCACTG

AGAAGCATAGGATCTATCTCACAATCTACGTATTCCTGCATCGTAAATCTGGTAGCTTCTGCTGACATTCTGGCAAGTTGGGTTTCCATAAATAGACAGC

TTTAGCAGAGCTCATACCAGGCCTTCTACTTCCTGTCAAGAATGCTGGCAAGAAACAAGAATGTGGCACTTCCTTTGCCAAAATCACAGACAGCACCCTA

CCTACCTAGTAAATCTCGTCACAGACTATCTTGAGTCTAGTCAAAGACAATCGTTGTCCCAGACGGCAGAGCCCTCCAGAGAAACACTCCTCAGACATCA

ACAGATCCTTTTACAAGAGATGAAATGGACAACTTCACTCTGTCAGCCAATTCTTTTAAATAACATATGTACTGAATAAAATAATAGAAATTTAAGTTTT

TGACAATTATAAAGCTACAACCAAAACTTATTTGCATATTAATACAGTACTAATTTATACTATTAGTTTTTTTTTTAAGATTTCTGTTTCTTAAGAGAGC

AGGAAAATCCATATTGGAATATGAATTTTGTATTGACAACAAGAAGACAGACGAGGGATAAGACTCAGTTTAGGAAAATCTATGATACTCTAAGTCATAA

TTCCCTGAGGGTCGCTTTTCTCTTTGAAGATCAGATGAGCTCTCAGAACTGAGGTGAGAATTACTCAGTAAGGAGCCCCCAACTCTAACCCTCTCAGCAC

CACAGGGCTGTGTTCTGACTTTCCAACTGTTTGAATGCCAGGAGTGTGCTCACTGCTGTGCATCTGATCCCAGAAACAAAGGTCCAGGTTTGTGATTTCT

AGAATGAGGCCAGGTTGAACGTGCCAATCAAATGATCTGGCTTTAGAGGTTGGGAAGCTATCTGGCTCACCACTATTGCCCCCACGGCTGGTTTCCAGCC

TCCTTATTAGGTTGTCTGTTTCATTGAAGTCTCTCCTCTTGTTCAGACTTGATGAGCATCAGTCCTTGTGTGTGACAGTGCATGAGGCACATTCAGGTCG

TTTTGATTGGAGATTAAGAGAAGAAGGGATTTGGAGATGAGAAATAAGGAAGTTTCACAAACTTGATCTGATCAGCTCTTTGCCCAGTCAGTCTAGCAGG

ATTTCTTATTTAGCTTTGGAGAGATGTCTCATACTGGTCAAGAACATCAGCTTTATGAATGGAGTTTGAGCTAATTCCAGTTCTTTGGTTTCCTGACTGG

TTTTGTACCCTTGGGAAAAAAAAAGCATGCAGTTTCCTTTAGCTTCTAGTTCTTTCTTTGCTACACGTGGAATACACTATGTCATAAAGTATTTAAAACA

CTACAGTAGCATGTAACATTACCCTCTGGGTTGCCATTAACAAGATTATTGATTTTAATATTTTTGGTGGTGATGATGGTAACCCTAACTCACTTTAGGT

TTATAGGCATAAAAGCTATTGTGACTGAAAGATCTTGTTAATGCATATTTGATTATAGTCTTAGTACAACTAATGTTGTAACCTTAGATTGAGGAAGCTT

GATTCATTATAGCTAACATGCAGTGCTTGCAAAATTCAAGCATAATTAACTAAATAAAATTTCATCTTTTGTGTCTTTTGATTTTATTTATGATTATTTG

GAGGCCTAAAACACTTATCTATCCGCCTTTAGGACCTGAGGTATAAATTTATATTCTAACTTTAGGGAGATTTATCAAAAATTGATGATCTGGCTGAAGG

GATTGTAATAGAACCCGGAAATGGAAGAATGAAAATAGGAGATTTTTTTTTGCCAGATAGGTGAAGGATTCAGGTAAGTAACTGGCTTGAGACCTTACAG

ACAGTATGGCAGGACAGAGTCAGAGTCAAATAAGTTGTAATTTCAAATGTGAGTACCGGTGTCCCAGGTCACAGGGTTAAGGTACTTGCTGCTAAGTCTT

CCTGGGGAAGACCACTCCTCCCACTGACAGCTTTCCTCAATTGCCCATAGGTTTTGTGTGTGTATATTAATCTGTTTTCCCAGATTTGCAGTCTACATCC

TCTTTGTTGTGTTCTGTTCTTTAACTAGTGTAGACTTTCTAAAATACTTCCCCAGATAAACTGGAACTATTTTGTATCCACAGCCTGTTGTTTCTCTGAT

TGTTAGAATCCCATTCTTTGATTAAAACTGACTGACATATTAGATAAACATTAAATTTTCA
Translation
 - UNI22437 - - UNI27580 - - UNI34093 -  - UNI12603 - - UNI12892 - MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEA

DDTD - UNI22513 - DSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPG GYEKTAVKAASGAE

 ERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPV VHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPK

VPRRRA AALVLYHLYDILKKLIFG
Transcript ENSMUST00000111714
Sequence
AGGCATTTTGGCCATCTGCACACGTGAGTGATAAAGTCCTTCCTCGCTGTGAATAAACATGGTCCCTCCTAAG - UNI27580 - - UNI34093 - 

ACTGTATCACTTTCGGGACCTGTCTCCGGATTTCTTCTGAAGACGGTATAATTTTGGGACCTCATCTCCAGATCTCATTTAAGGACTACTGACTCATCAA

G - UNI12603 - - UNI12892 - AAATGACTTACAAAATGAAGAAAGAATATGCCTTTTGGGCCACTGTGTGTCTGTTGCTTAGCCTTGTTCCCG

AGTTTCTTAATGCTCTGTCTGAGGAAGCTGATGACACAG - UNI22513 - ATTCTGAGCTGGGGTCAATGAAACCGCTACATACATTTTGTGCAATG

AAGGCAGATGATGGTCCATGCAAAGCAATGATAAGGAGTTATTTTTTCAATATGTATACTCATCAATGTGAAGAATTTATATACGGGGGATGTGAAGGGA

ACGAGAACCGATTTGATACCCTGGAAGAGTGTAAGAAAACATGCATACCAG GTTATGAGAAGACAGCTGTGAAGGCAGCATCTGGAGCAG AAAGGCCA

GATTTCTGCTTCTTGGAAGAGGACCCTGGACTCTGCCGAGGTTACATGAAGAGGTATCTTTATAACAACCAGACAAAGCAGTGTGAACGATTCGTGTACG

GTGGCTGCCTGGGCAACCGCAACAACTTTGAAACTTTGGATGAGTGCAAGAAGATCTGTGAGAATCCAG TCCACTCCCCTTCCCCAGTGAATGAGGTAC

AGATGAGTGACTACGTAACTGATGGAAATACTGTAACTGATCGCAGTACTGTAAATAACATCGTGGTTCCCCAGTCTCCCAAAGTGCCCAGGCGTCGGG 

CTGCCTTGGTACTGTATCACCTTTATGATATTTTGAAAAAACTCATCTTTGGTTAGACTTCAACAGCCTACTGCTAACTCAGTCTCCAGCACTTGGTCTT

TGATTGAGAAAGGAGCGCCTAAGCACTGAGCCAGGGCCGTCCTGCTTCATGCCAGCCTCCAGGGCCAGGGAGAATGACTAGATGTAATAAAGAAGACCCT

GTGGCCACTTGAAACTCTTTCCTGACTCTATCTAACAGCTAACCCAGGGCCAAACTCTACACTCACAGAAAACGGTGAGAAAGAAGTAAACACCTGTAAT

TATACACATAATCATTGGCCTTCTGGAAGAGGAGTGATGTTGGCAGAGGAACTATTCAATAATCAAATGTCATCACCGATGGGTTCATGTTAGAGATCTG

CAATAGAATGCTTTCACCTATACGTTCTCTTGGAAGATATTGATTACATGCAGAGGAACTTCGCAATCATTTAAGTTTTCTGGGAAGAAAATATACCCCA

CCAACTAAGGAATTGCACATTTAAATGCATACCCCAAGAAGTCACGAGTGCAGTGGGCACTCATTTCATCAACAAGCACATACAGTTTGAAACAAATATG

GTGGCCTTCAAATGTATTCTCACTGAGAAGCATAGGATCTATCTCACAATCTACGTATTCCTGCATCGTAAATCTGGTAGCTTCTGCTGACATTCTGGCA

AGTTGGGTTTCCATAAATAGACAGCTTTAGCAGAGCTCATACCAGGCCTTCTACTTCCTGTCAAGAATGCTGGCAAGAAACAAGAATGTGGCACTTCCTT

TGCCAAAATCACAGACAGCACCCTACCTACCTAGTAAATCTCGTCACAGACTATCTTGAGTCTAGTCAAAGACAATCGTTGTCCCAGACGGCAGAGCCCT

CCAGAGAAACACTCCTCAGACATCAACAGATCCTTTTACAAGAGATGAAATGGACAACTTCACTCTGTCAGCCAATTCTTTTAAATAACATATGTACTGA

ATAAAATAATAGAAATTTAAGTTTTTGACAATTATAAAGCTACAACCAAAACTTATTTGCATATTAATACAGTACTAATTTATACTATTAGTTTTTTTTT

TAAGATTTCTGTTTCTTAAGAGAGCAGGAAAATCCATATTGGAATATGAATTTTGTATTGACAACAAGAAGACAGACGAGGGATAAGACTCAGTTTAGGA

AAATCTATGATACTCTAAGTCATAATTCCCTGAGGGTCGCTTTTCTCTTTGAAGATCAGATGAGCTCTCAGAACTGAGGTGAGAATTACTCAGTAAGGAG

CCCCCAACTCTAACCCTCTCAGCACCACAGGGCTGTGTTCTGACTTTCCAACTGTTTGAATGCCAGGAGTGTGCTCACTGCTGTGCATCTGATCCCAGAA

ACAAAGGTCCAGGTTTGTGATTTCTAGAATGAGGCCAGGTTGAACGTGCCAATCAAATGATCTGGCTTTAGAGGTTGGGAAGCTATCTGGCTCACCACTA

TTGCCCCCACGGCTGGTTTCCAGCCTCCTTATTAGGTTGTCTGTTTCATTGAAGTCTCTCCTCTTGTTCAGACTTGATGAGCATCAGTCCTTGTGTGTGA

CAGTGCATGAGGCACATTCAGGTCGTTTTGATTGGAGATTAAGAGAAGAAGGGATTTGGAGATGAGAAATAAGGAAGTTTCACAAACTTGATCTGATCAG

CTCTTTGCCCAGTCAGTCTAGCAGGATTTCTTATTTAGCTTTGGAGAGATGTCTCATACTGGTCAAGAACATCAGCTTTATGAATGGAGTTTGAGCTAAT

TCCAGTTCTTTGGTTTCCTGACTGGTTTTGTACCCTTGGGAAAAAAAAAGCATGCAGTTTCCTTTAGCTTCTAGTTCTTTCTTTGCTACACGTGGAATAC

ACTATGTCATAAAGTATTTAAAACACTACAGTAGCATGTAACATTACCCTCTGGGTTGCCATTAACAAGATTATTGATTTTAATATTTTTGGTGGTGATG

ATGGTAACCCTAACTCACTTTAGGTTTATAGGCATAAAAGCTATTGTGACTGAAAGATCTTGTTAATGCATATTTGATTATAGTCTTAGTACAACTAATG

TTGTAACCTTAGATTGAGGAAGCTTGATTCATTATAGCTAACATGCAGTGCTTGCAAAATTCAAGCATAATTAACTAAATAAAATTTCATCTTTTGTGTC

TTTTGATTTTATTTATGATTATTTGGAGGCCTAAAACACTTATCTATCCGCCTTTAGGACCTGAGGTATAAATTTATATTCTAACTTTAGGGAGATTTAT

CAAAAATTGATGATCTGGCTGAAGGGATTGTAATAGAACCCGGAAATGGAAGAATGAAAATAGGAGATTTTTTTTTGCCAGATAGGTGAAGGATTCAGGT

AAGTAACTGGCTTGAGACCTTACAGACAGTATGGCAGGACAGAGTCAGAGTCAAATAAGTTGTAATTTCAAATGTGAGTACCGGTGTCCCAGGTCACAGG

GTTAAGGTACTTGCTGCTAAGTCTTCCTGGGGAAGACCACTCCTCCCACTGACAGCTTTCCTCAATTGCCCATAGGTTTTGTGTGTGTATATTAATCTGT

TTTCCCAGATTTGCAGTCTACATCCTCTTTGTTGTGTTCTGTTCTTTAACTAGTGTAGACTTTCTAAAATACTTCCCCAGATAAACTGGAACTATTTTGT

ATCCACAGCCTGTTGTTTCTCTGATTGTTAGAATCCCATTCTTTGATTAAAACTGACTGACATATTAGATAAACATTAAATTTTCA
Translation
 - UNI27580 - - UNI34093 -  - UNI12603 - - UNI12892 - MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTD - UNI225

13 - DSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPG GYEKTAVKAASGAE ERPDFCFLEEDP

GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPV VHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRA AALVLY

HLYDILKKLIFG
Transcript ENSMUST00000111712
Sequence
GCTTTAAAACCTCAGGACTCGAGAGAAGAGACTGGGGTTTTCGGCTTCCCGAGCAACCTTTACAGAGAATCTTTTTCTCCGTGTGTCTGACGC - UNI2

7580 - ACTGTATCACTTTCGGGACCTGTCTCCGGATTTCTTCTGAAGACGGTATAATTTTGGGACCTCATCTCCAGATCTCATTTAAGGACTACTGAC

TCATCAAG - UNI12603 - - UNI12892 - AAATGACTTACAAAATGAAGAAAGAATATGCCTTTTGGGCCACTGTGTGTCTGTTGCTTAGCCTT

GTTCCCGAGTTTCTTAATGCTCTGTCTGAGGAAGCTGATGACACAG - UNI22513 - ATTCTGAGCTGGGGTCAATGAAACCGCTACATACATTTTG

TGCAATGAAGGCAGATGATGGTCCATGCAAAGCAATGATAAGGAGTTATTTTTTCAATATGTATACTCATCAATGTGAAGAATTTATATACGGGGGATGT

GAAGGGAACGAGAACCGATTTGATACCCTGGAAGAGTGTAAGAAAACATGCATACCAG GTTATGAGAAGACAGCTGTGAAGGCAGCATCTGGAGCAG A

AAGGCCAGATTTCTGCTTCTTGGAAGAGGACCCTGGACTCTGCCGAGGTTACATGAAGAGGTATCTTTATAACAACCAGACAAAGCAGTGTGAACGATTC

GTGTACGGTGGCTGCCTGGGCAACCGCAACAACTTTGAAACTTTGGATGAGTGCAAGAAGATCTGTGAGAATCCAG TCCACTCCCCTTCCCCAGTGAAT

GAGGTACAGATGAGTGACTACGTAACTGATGGAAATACTGTAACTGATCGCAGTACTGTAAATAACATCGTGGTTCCCCAGTCTCCCAAAGTGCCCAGGC

GTCGGG TTACAAAAGAAGAAACAAATGGTGGTTGGAAGAATGCTGACTATACTTACCAAGGCTTTCTGAGTTCCGTCTACATTCACGTACTCTATTTTG

TCTTTAGGATTGGATAG
Translation
 - UNI27580 -  - UNI12603 - - UNI12892 - MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTD - UNI22513 - DSELGSMK

PLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPG GYEKTAVKAASGAE ERPDFCFLEEDPGLCRGYMKRYLYN

NQTKQCERFVYGGCLGNRNNFETLDECKKICENPV VHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRV VTKEETNGGWKNADYTYQG

FLSSVYIHVLYFVFRIG
Transcript ENSMUST00000111711
Sequence
CTGCACACGTGAGTGATAAAGTCCTTCCTCGCTGTGAATAAACATGGTCCCTCCTAAG - UNI27580 - - UNI34093 - ACTGTATCACTTTCG

GGACCTGTCTCCGGATTTCTTCTGAAGACGGTATAATTTTGGGACCTCATCTCCAGATCTCATTTAAGGACTACTGACTCATCAAG - UNI12603 - 

- UNI12892 - AAATGACTTACAAAATGAAGAAAGAATATGCCTTTTGGGCCACTGTGTGTCTGTTGCTTAGCCTTGTTCCCGAGTTTCTTAATGCTC

TGTCTGAGGAAGCTGATGACACAG - UNI22513 - ATTCTGAGCTGGGGTCAATGAAACCGCTACATACATTTTGTGCAATGAAGGCAGATGATGGT

CCATGCAAAGCAATGATAAGGAGTTATTTTTTCAATATGTATACTCATCAATGTGAAGAATTTATATACGGGGGATGTGAAGGGAACGAGAACCGATTTG

ATACCCTGGAAGAGTGTAAGAAAACATGCATACCAG GTTATGAGAAGACAGCTGTGAAGGCAGCATCTGGAGCAG AAAGGCCAGATTTCTGCTTCTTG

GAAGAGGACCCTGGACTCTGCCGAGGTTACATGAAGAGGTATCTTTATAACAACCAGACAAAGCAGTGTGAACGATTCGTGTACGGTGGCTGCCTGGGCA

ACCGCAACAACTTTGAAACTTTGGATGAGTGCAAGAAGATCTGTGAGAATCCAG TGAATGAGGTACAGATGAGTGACTACGTAACTGATGGAAATACTG

TAACTGATCGCAGTACTGTAAATAACATCGTGGTTCCCCAGTCTCCCAAAGTGCCCAGGCGTCGGG TTACAAAAGAAGAAACAAATGGTGGTTGGAAGA

ATGCTGACTATACTTACCAAGGCTTTCTGAGTTCCGTCTACATTCACGTACTCTATTTTGTCTTTAGGATTGGATAGTATATTCTGTTACTTGTTGCCGT

TGGGCTTATTTCATAATATTTACATAGCACTTGATGCTTTTATATTTATTATTGATTAAGTTTTAATATTAACATTCATAGTTAACATAATCTTTTACTA

TGTCTAACTGGTAAACTTACAACTAGGAAAGAAAGACCAGTCACATTGGTTCCGGGTTTTTGTGGGTAGACCTACCTGATCATTCTTGGAGAAAAGTTAA

TTATTTTCCAAATTCTCACAGCCCACCTTGCTTCTATACATCATCTCTTAACAGCTGCCTTGGTACTGTATCACCTTTATGATATTTTGAAAAAACTCAT

CTTTGGTTAGACTTCAACAGCCTACTGCTAACTCAGTCTCCAGCACTTGGTCTTTGATTGAGAAAGGAGCGCCTAAGCACTGAGCCAGGGCCGTCCTGCT

TCATGCCAGCCTCCAGGGCCAGGGAGAATGACTAGATGTAATAAAGAAGACCCTGTGGCCACTTGAAACTCTTTCCTGACTCTATCTAACAGCTAACCCA

GGGCCAAACTCTACACTCACAGAAAACGGTGAGAAAGAAGTAAACACCTGTAATTATACACATAATCATTGGCCTTCTGGAAGAGGAGTGATGTTGGCAG

AGGAACTATTCAATAATCAAATGTCATCACCGATGGGTTCATGTTAGAGATCTGCAATAGAATGCTTTCACCTATACGTTCTCTTGGAAGATATTGATTA

CATGCAGAGGAACTTCGCAATCATTTAAGTTTTCTGGGAAGAAAATATACCCCACCAACTAAGGAATTGCACATTTAAATGCATACCCCAAGAAGTCACG

AGTGCAGTGGGCACTCATTTCATCAACAAGCACATACAGTTTGAAACAAATATGGTGGCCTTCAAATGTATTCTCACTGAGAAGCATAGGATCTATCTCA

CAATCTACGTATTCCTGCATCGTAAATCTGGTAGCTTCTGCTGACATTCTGGCAAGTTGGGTTTCCATAAATAGACAGCTTTAGCAGAGCTCATACCAGG

CCTTCTACTTCCTGTCAAGAATGCTGGCAAGAAACAAGAATGTGGCACTTCCTTTGCCAAAATCACAGACAGCACCCTACCTACCTAGTAAATCTCGTCA

CAGACTATCTTGAGTCTAGTCAAAGACAATCGTTGTCCCAGACGGCAGAGCCCTCCAGAGAAACACTCCTCAGACATCAACAGATCCTTTTACAAGAGAT

GAAATGGACAACTTCACTCTGTCAGCCAATTCTTTTAAATAACATATGTACTGAATAAAATAATAGAAATTTAAGTTTTTGACAATTATAAAGCTACAAC

CAAAACTTATTTGCATATTAATACAGTACTAATTTATACTATTAGTTTTTTTTTTAAGATTTCTGTTTCTTAAGAGAGCAGGAAAATCCATATTGGAATA

TGAATTTTGTATTGACAACAAGAAGACAGACGAGGGATAAGACTCAGTTTAGGAAAATCTATGATACTCTAAGTCATAATTCCCTGAGGGTCGCTTTTCT

CTTTGAAGATCAGATGAGCTCTCAGAACTGAGGTGAGAATTACTCAGTAAGGAGCCCCCAACTCTAACCCTCTCAGCACCACAGGGCTGTGTTCTGACTT

TCCAACTGTTTGAATGCCAGGAGTGTGCTCACTGCTGTGCATCTGATCCCAGAAACAAAGGTCCAGGTTTGTGATTTCTAGAATGAGGCCAGGTTGAACG

TGCCAATCAAATGATCTGGCTTTAGAGGTTGGGAAGCTATCTGGCTCACCACTATTGCCCCCACGGCTGGTTTCCAGCCTCCTTATTAGGTTGTCTGTTT

CATTGAAGTCTCTCCTCTTGTTCAGACTTGATGAGCATCAGTCCTTGTGTGTGACAGTGCATGAGGCACATTCAGGTCGTTTTGATTGGAGATTAAGAGA

AGAAGGGATTTGGAGATGAGAAATAAGGAAGTTTCACAAACTTGATCTGATCAGCTCTTTGCCCAGTCAGTCTAGCAGGATTTCTTATTTAGCTTTGGAG

AGATGTCTCATACTGGTCAAGAACATCAGCTTTATGAATGGAGTTTGAGCTAATTCCAGTTCTTTGGTTTCCTGACTGGTTTTGTACCCTTGGGAAAAAA

AAAGCATGCAGTTTCCTTTAGCTTCTAGTTCTTTCTTTGCTACACGTGGAATACACTATGTCATAAAGTATTTAAAACACTACAGTAGCATGTAACATTA

CCCTCTGGGTTGCCATTAACAAGATTATTGATTTTAATATTTTTGGTGGTGATGATGGTAACCCTAACTCACTTTAGGTTTATAGGCATAAAAGCTATTG

TGACTGAAAGATCTTGTTAATGCATATTTGATTATAGTCTTAGTACAACTAATGTTGTAACCTTAGATTGAGGAAGCTTGATTCATTATAGCTAACATGC

AGTGCTTGCAAAATTCAAGCATAATTAACTAAATAAAATTTCATCTTTTGTGTCTTTTGATTTTATTTATGATTATTTGGAGGCCTAAAACACTTATCTA

TCCGCCTTTAGGACCTGAGGTATAAATTTATATTCTAACTTTAGGGAGATTTATCAAAAATTGATGATCTGGCTGAAGGGATTGTAATAGAACCCGGAAA

TGGAAGAATGAAAATAGGAGATTTTTTTTTGCCAGATAGGTGAAGGATTCAGGTAAGTAACTGGCTTGAGACCTTACAGACAGTATGGCAGGACAGAGTC

AGAGTCAAATAAGTTGTAATTTCAAATGTGAGTACCGGTGTCCCAGGTCACAGGGTTAAGGTACTTGCTGCTAAGTCTTCCTGGGGAAGACCACTCCTCC

CACTGACAGCTTTCCTCAATTGCCCATAGGTTTTGTGTGTGTATATTAATCTGTTTTCCCAGATTTGCAGTCTACATCCTCTTTGTTGTGTTCTGTTCTT

TAACTAGTGTAGACTTTCTAAAATACTTCCCCAGATAAACTGGAACTATTTTGTATCCACAGCCTGTTGTTTCTCTGATTGTTAGAATCCCATTCTTTGA

TTAAAACTGACTGACATATTAGATAAACATTAAATTTTCA
Translation
 - UNI27580 - - UNI34093 -  - UNI12603 - - UNI12892 - MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTD - UNI225

13 - DSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPG GYEKTAVKAASGAE ERPDFCFLEEDP

GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPV VNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRV VTKEETNGGWKN

ADYTYQGFLSSVYIHVLYFVFRIG

For any suggestions or comments, please send an email to unitrap@crg.es