Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027087 (Itgav)
Chromosomal location
Chr 2: 83564672 - 83643964 (+)
Description
integrin alpha V Gene [Source:MGI (curated);Acc:Itgav-005]
RefSeq_peptide
NP_032428.2 
UniGene
Mm.227 
MGI
MGI:96608 
Uniprot/SWISSPROT
P43406 
Uniprot/SPTREMBL
A2AKI6 A2AKI7 A2AKI8 Q3U4C8 Q80Y67 A2AKI5 
Human Ortholog
ENSG00000138448 (ITGAV)
Omim not available
UniTrap UNI33615
Vector Insertion
Chr 2: 83565077 - 83576666
Public Clones IST13100B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26661
Vector Insertion
Chr 2: 83576798 - 83588009
Public Clones IST12371G7 (tigm)
Private Clones OST105280 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25832
Vector Insertion
Chr 2: 83588102 - 83595962
Public Clones not available
Private Clones OST159950 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34766
Vector Insertion
Chr 2: 83619217 - 83622095
Public Clones IST11047F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028499
Sequence
CGCGCGAGCCAGCGACAGAGCCGGAGTCCCGGGTCGGACACCGCTCCTCCTGGGTGCCGCCCGGCTCAGCTTCGCGCCGCCCGGCCGCCCCGCCGCCCTT

GACCGCAAGCGCACAGCACAGCTCGGCAGTTCGGGGGCGCGCAGGCGGCGGGCCGCGGCCACCGAGCACCGGGACAGGGACTGAAGTCTTTCGGCTCTGC

GCCCCGCGCGCGCCCCGGCGATGGCTGCTCCCGGGCGCCTGCTGCTACGCCCTCGCCCCGGCGGCCTCCTGCTGCTGCTGCCGGGTCTCCTGCTGCCCCT

CGCCGACGCCTTCAACCTGGACGTCGAAAGTCCCGCCGAGTATGCGGGTCCCGAGGGAAGTTACTTCGGATTCGCCGTGGACTTCTTCGAGCCCAGCACG

TCCTC - UNI33615 - CAGGATGTTTCTCCTGGTGGGAGCCCCCAAAGCGAACACGACCCAGCCTGGGATTGTAGAAGGAGGGCAAGTTCTCAAATG

TGAATGCTCATCCAGCCGCCGGTGCCAGCCCATTGAGTTTGATTCAACAG - UNI26661 - GCAATCGAGATTATGCCAAAGATGACCCACTGGAGT

TTAAGTCCCACCAGTGGTTTGGAGCCTCTGTGAGGTCAAAGCAGGATAAAATCTTG - UNI25832 - GCCTGTGCTCCATTGTACCACTGGAGGACT

GAGATGAAGCAGGAGAGAGAGCCAGTTGGAACCTGCTTTCTTCAGGACGGCACAAAGACCGTTGAGTATGCTCCATGCAGGTCAA AAAATATTGATGCT

GATGGCCAGGGATTTTGTCAAGGAGGATTCAGCATTGATTTTACTAAA GCTGACAGAGTACTTCTCGGTGGTCCTGGTAGCTTTTATTGGCAAG GTCA

GCTCATTTCGGACCAAGTGGCAGAAATCATATCTAAATATGACCCAAATGTCTACAGCATCAAATATAATAACCAATTAGCAACACGGACTGCACAAGCA

ATTTTTGATGACAGTTATTTGG GTTACTCTGTGGCCGTGGGAGACTTCAATGGTGACGGCATTGAAG ATTTTGTCTCAGGAGTTCCAAGAGCAGCAAG

GACTTTGGGAATG GTTTATATTTATGATGGGAAAAATATGTCCTCTTTACACAATTTTACTGGTGAACAG ATGGCTGCGTATTTTGGATTTTCTGTAG

CTGCTACTGACATTAATGGGGATGA TTACGCAGATGTGTTTATTGGAGCCCCCCTGTTCATGGACCGAGGTTCCGATGGGAAACTCCAGGAGGTTGGCC

AGGTCTCAGTGTCTCTGCAGAGAGCAGTGGGAGACTTCCAGACTACAAAGCTGAACGGCTTTGAGGTTTTTGCCAGGTTTGGAAGTGCCATAGCTCCATT

GGGAGACCTGGACCAGGATGGCTTCAATG ATATTGCAATTGCTGCTCCCTATGGTGGTGAAGATAAGAAGGGACTTGTTTATATCTTCAATGGAAGGTC

CACAGGCTTGAATTCGGTGCCATCTCAAATCCTCGAGGGGCAGTGGGCTGCTCAGAGCATGCCCCCAAGCTTTGGCTATTCAATGAAGGGAGCTACAGAT

GTAGACAGGAATGGATATCCAG ACTTAGTTGTAGGAGCTTTTGGTGTGGATCGAGCTGTCTTATACAG - UNI34766 - AGCCAGACCCGTTGTCA

CTGTAAATGCTGGCCTTGAAGTGTACCCTAGCATTTTAAATCAAGACAATAAGATCTGCCCGTTGCCTGGGACAGCTCTCAAGGTTTCCTG TTTTAATG

TCAGATTCTGCTTAAAGGCAGATGGCAAGGGAACCCTTCCTCGGAAGCTCC ACTTCCAGGTGGAGCTTCTACTGGATAAACTCAAGCAGAAGGGAGCCA

TCCGACGAGCACTGTTTCTCCATAACAGGTCCCCGGTCCACTCCAAGACCATGACTGTTTTCAGGGGGGGACAGATGCAGTGTGAGGAACTGGTCGCCTA

TCTTCGG GATGAATCTGAATTTAGAGACAAGCTCACTCCCATCACCATTTTCATGGAGTATCGGTTGGACCAGAGAACGGCTGCTGATGCCACAGGCTT

GCAGCCCATCCTGAACCAGTTCACTCCGGCCAACGTCAGTCGGCAG GCTCATATTCTACTTGACTGTGGTGAAGACAATGTCTGTAAACCTAAATTGGA

AGTTTCTGTAAATAG TGATCAAAAGAAGATCTATATTGGGGACGACAACCCTCTGACACTGACTGTGAAGGCGCAGAATCAAGGGGAAGGCGCCTATGA

AGCTGAGCTCATCGTTTCTATCCCACCGCAGGCTGACTTCATCGGGGTTGTCCGGAACAACGAA GCCTTAGCAAGACTGTCCTGTGCATTTAAGACAGA

AAACCAAACTCGGCAGGTGGTGTGCGACCTTGGAAACCCGATGAAGGCTGGAACTCAA CTGCTCGCTGGTCTTCGTTTCAGCGTGCACCAGCAGTCAGA

GATGGATACTTCTGTGAAGTTTGACTTGAAAATCCAGAG CTCTAATTCTTTTGACAATGTAAGTCCAGTTGTGTCTTACAAGGTTGACCTCGCCGTTTT

GGCTGCTGTGGAGATAAGAGG AGTTTCAAGTCCAGATCATATCTTTCTTCCAATTCCAAATTGGGAGTACAAGGAAAACCCTGAGACTGAAGAAGACGT

TGGGCCTATTGTTCAGCACATATATGAG CTGAGAAACAATGGTCCAAGTTCATTCAGCAAGGCAATTCTAAATCTCCAGTGGCCTTACAAATACAACAA

CAACACTCTGTTGTACATTCTTCATTACGACATTGACGGGCCAATGAACTGCACGGCAGATACAGAGATCAACCCTTTGAGAATCAAG ACACCCGAAAA

GAATGACACAGCGGCGGCGGGACAGGGAGAAAGGAATCATCTCATCACCAAGCGGGATCTCACCCTCAGAGAGGGAGATGTTCACACTTTG GGCTGTGG

AATCGCCAAGTGCTTGCAGATCACCTGCCAGGTTGGTCGACTGGATAGAGGCAAGAGCGCAATCCTGTACGTGAAATCCCTGCTGTGGACCGAGACGTTC

ATGAAC AAGGAGAACCAGAACCATTCCTATTCGCTGAAGTCATCTGCTTCCTTTAATATCATAGAATTCCCTTACAAGAACCTGCCGATCGAGGATCTC

TTCAACTCTACACTA GTCACCACTAACATCACCTGGGGCATTCAGCCGGCGCCCATGCCTGTGCCTGTGTGGGTGATCATCTTGGCAGTTCTCGCAGGG

CTGCTGCTACTGGCTGTGTTGGTATTTGTAATGTACAGG ATGGGCTTTTTCAAACGTGTCCGACCACCTCAAGAAGAGCAAGAAAGAGAACAGCTTCAG

CCTCATGAGAATGGCGAAGGAAACTCTGAAACCTAAGGTGCTTCTTAAGTGGCGCCACTTCTGTCCGCTCCAAGTTCACCACCGTGGTGGTGGATTTCAA

CATCTCTCGTGAACAGTGAAATCCCAGGACTGTATTGCTGAGAGCACCCAGCAGTCTCAGTTTATCCACAAAATTGAAATGGATATTTGTCGACTTCTCT

TTATGAATAAGTTCAGATTACATTTACTTCGCCTACACTAACGTGTGTTCTTAGGGACTTAAGTGATGGAATTTCAAGTGATTATCTTTGTTCAGTGTAC

ATAAGACAGACAGCACTGAGTCAGCACGTTACATAGCATAGTACCTCTTCAGTTACTGTTCCTAATTGACTGTGTGGGGTTTCTCTCTTCGACGTTACGT

TAGGGCAATTAGGATTGTAAAGCAGTTCAAATTTAGACCATCAGTAAGTTTGCACAGGCACTTAGAACAGGTACACATTACACTACAGTTGACTTCATAA

GCTACTGA
Translation
MAAPGRLLLRPRPGGLLLLLPGLLLPLADAFNLDVESPAEYAGPEGSYFGFAVDFFEPSTSS - UNI33615 - SRMFLLVGAPKANTTQPGIVEGGQ

VLKCECSSSRRCQPIEFDSTG - UNI26661 - GNRDYAKDDPLEFKSHQWFGASVRSKQDKIL - UNI25832 - ACAPLYHWRTEMKQEREPVG

TCFLQDGTKTVEYAPCRSK KNIDADGQGFCQGGFSIDFTK ADRVLLGGPGSFYWQG GQLISDQVAEIISKYDPNVYSIKYNNQLATRTAQAIFDDSY

LG GYSVAVGDFNGDGIED DFVSGVPRAARTLGM VYIYDGKNMSSLHNFTGEQ MAAYFGFSVAATDINGDD DYADVFIGAPLFMDRGSDGKLQEVG

QVSVSLQRAVGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFND DIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQILEGQWAAQSMPPSFGYSMKGA

TDVDRNGYPD DLVVGAFGVDRAVLYR - UNI34766 - RARPVVTVNAGLEVYPSILNQDNKICPLPGTALKVSC CFNVRFCLKADGKGTLPRKLH

 HFQVELLLDKLKQKGAIRRALFLHNRSPVHSKTMTVFRGGQMQCEELVAYLR DESEFRDKLTPITIFMEYRLDQRTAADATGLQPILNQFTPANVSRQ

 AHILLDCGEDNVCKPKLEVSVNS SDQKKIYIGDDNPLTLTVKAQNQGEGAYEAELIVSIPPQADFIGVVRNNE ALARLSCAFKTENQTRQVVCDLGN

PMKAGTQ LLAGLRFSVHQQSEMDTSVKFDLKIQS SSNSFDNVSPVVSYKVDLAVLAAVEIRG GVSSPDHIFLPIPNWEYKENPETEEDVGPIVQHIY

E LRNNGPSSFSKAILNLQWPYKYNNNTLLYILHYDIDGPMNCTADTEINPLRIK TPEKNDTAAAGQGERNHLITKRDLTLREGDVHTL GCGIAKCLQ

ITCQVGRLDRGKSAILYVKSLLWTETFMN KENQNHSYSLKSSASFNIIEFPYKNLPIEDLFNSTL VTTNITWGIQPAPMPVPVWVIILAVLAGLLLLA

VLVFVMYR MGFFKRVRPPQEEQEREQLQPHENGEGNSET
Transcript ENSMUST00000111740
Sequence
CGCGCGAGCCAGCGACAGAGCCGGAGTCCCGGGTCGGACACCGCTCCTCCTGGGTGCCGCCCGGCTCAGCTTCGCGCCGCCCGGCCGCCCCGCCGCCCTT

GACCGCAAGCGCACAGCACAGCTCGGCAGTTCGGGGGCGCGCAGGCGGCGGGCCGCGGCCACCGAGCACCGGGACAGGGACTGAAGTCTTTCGGCTCTGC

GCCCCGCGCGCGCCCCGGCGATGGCTGCTCCCGGGCGCCTGCTGCTACGCCCTCGCCCCGGCGGCCTCCTGCTGCTGCTGCCGGGTCTCCTGCTGCCCCT

CGCCGACGCCTTCAACCTGGACGTCGAAAGTCCCGCCGAGTATGCGGGTCCCGAGGGAAGTTACTTCGGATTCGCCGTGGACTTCTTCGAGCCCAGCACG

TCCTC - UNI33615 - CAGGATGTTTCTCCTGGTGGGAGCCCCCAAAGCGAACACGACCCAGCCTGGGATTGTAGAAGGAGGGCAAGTTCTCAAATG

TGAATGCTCATCCAGCCGCCGGTGCCAGCCCATTGAGTTTGATTCAACAG - UNI26661 - GCAATCGAGATTATGCCAAAGATGACCCACTGGAGT

TTAAGTCCCACCAGTGGTTTGGAGCCTCTGTGAGGTCAAAGCAGGATAAAATCTTG - UNI25832 - GCCTGTGCTCCATTGTACCACTGGAGGACT

GAGATGAAGCAGGAGAGAGAGCCAGTTGGAACCTGCTTTCTTCAGGACGGCACAAAGACCGTTGAGTATGCTCCATGCAGGTCAA GTCAGCTCATTTCG

GACCAAGTGGCAGAAATCATATCTAAATATGACCCAAATGTCTACAGCATCAAATATAATAACCAATTAGCAACACGGACTGCACAAGCAATTTTTGATG

ACAGTTATTTGG GTTACTCTGTGGCCGTGGGAGACTTCAATGGTGACGGCATTGAAG ATTTTGTCTCAGGAGTTCCAAGAGCAGCAAGGACTTTGGGA

ATG GTTTATATTTATGATGGGAAAAATATGTCCTCTTTACACAATTTTACTGGTGAACAG ATGGCTGCGTATTTTGGATTTTCTGTAGCTGCTACTGA

CATTAATGGGGATGA TTACGCAGATGTGTTTATTGGAGCCCCCCTGTTCATGGACCGAGGTTCCGATGGGAAACTCCAGGAGGTTGGCCAGGTCTCAGT

GTCTCTGCAGAGAGCAGTGGGAGACTTCCAGACTACAAAGCTGAACGGCTTTGAGGTTTTTGCCAGGTTTGGAAGTGCCATAGCTCCATTGGGAGACCTG

GACCAGGATGGCTTCAATG ATATTGCAATTGCTGCTCCCTATGGTGGTGAAGATAAGAAGGGACTTGTTTATATCTTCAATGGAAGGTCCACAGGCTTG

AATTCGGTGCCATCTCAAATCCTCGAGGGGCAGTGGGCTGCTCAGAGCATGCCCCCAAGCTTTGGCTATTCAATGAAGGGAGCTACAGATGTAGACAGGA

ATGGATATCCAG ACTTAGTTGTAGGAGCTTTTGGTGTGGATCGAGCTGTCTTATACAG - UNI34766 - AGCCAGACCCGTTGTCACTGTAAATGC

TGGCCTTGAAGTGTACCCTAGCATTTTAAATCAAGACAATAAGATCTGCCCGTTGCCTGGGACAGCTCTCAAGGTTTCCTG TTTTAATGTCAGATTCTG

CTTAAAGGCAGATGGCAAGGGAACCCTTCCTCGGAAGCTCC ACTTCCAGGTGGAGCTTCTACTGGATAAACTCAAGCAGAAGGGAGCCATCCGACGAGC

ACTGTTTCTCCATAACAGGTCCCCGGTCCACTCCAAGACCATGACTGTTTTCAGGGGGGGACAGATGCAGTGTGAGGAACTGGTCGCCTATCTTCGG GA

TGAATCTGAATTTAGAGACAAGCTCACTCCCATCACCATTTTCATGGAGTATCGGTTGGACCAGAGAACGGCTGCTGATGCCACAGGCTTGCAGCCCATC

CTGAACCAGTTCACTCCGGCCAACGTCAGTCGGCAG GCTCATATTCTACTTGACTGTGGTGAAGACAATGTCTGTAAACCTAAATTGGAAGTTTCTGTA

AATAG TGATCAAAAGAAGATCTATATTGGGGACGACAACCCTCTGACACTGACTGTGAAGGCGCAGAATCAAGGGGAAGGCGCCTATGAAGCTGAGCTC

ATCGTTTCTATCCCACCGCAGGCTGACTTCATCGGGGTTGTCCGGAACAACGAA GCCTTAGCAAGACTGTCCTGTGCATTTAAGACAGAAAACCAAACT

CGGCAGGTGGTGTGCGACCTTGGAAACCCGATGAAGGCTGGAACTCAA CTGCTCGCTGGTCTTCGTTTCAGCGTGCACCAGCAGTCAGAGATGGATACT

TCTGTGAAGTTTGACTTGAAAATCCAGAG CTCTAATTCTTTTGACAATGTAAGTCCAGTTGTGTCTTACAAGGTTGACCTCGCCGTTTTGGCTGCTGTG

GAGATAAGAGG AGTTTCAAGTCCAGATCATATCTTTCTTCCAATTCCAAATTGGGAGTACAAGGAAAACCCTGAGACTGAAGAAGACGTTGGGCCTATT

GTTCAGCACATATATGAG CTGAGAAACAATGGTCCAAGTTCATTCAGCAAGGCAATTCTAAATCTCCAGTGGCCTTACAAATACAACAACAACACTCTG

TTGTACATTCTTCATTACGACATTGACGGGCCAATGAACTGCACGGCAGATACAGAGATCAACCCTTTGAGAATCAAG ACACCCGAAAAGAATGACACA

GCGGCGGCGGGACAGGGAGAAAGGAATCATCTCATCACCAAGCGGGATCTCACCCTCAGAGAGGGAGATGTTCACACTTTG GGCTGTGGAATCGCCAAG

TGCTTGCAGATCACCTGCCAGGTTGGTCGACTGGATAGAGGCAAGAGCGCAATCCTGTACGTGAAATCCCTGCTGTGGACCGAGACGTTCATGAAC AAG

GAGAACCAGAACCATTCCTATTCGCTGAAGTCATCTGCTTCCTTTAATATCATAGAATTCCCTTACAAGAACCTGCCGATCGAGGATCTCTTCAACTCTA

CACTA GTCACCACTAACATCACCTGGGGCATTCAGCCGGCGCCCATGCCTGTGCCTGTGTGGGTGATCATCTTGGCAGTTCTCGCAGGGCTGCTGCTAC

TGGCTGTGTTGGTATTTGTAATGTACAGG ATGGGCTTTTTCAAACGTGTCCGACCACCTCAAGAAGAGCAAGAAAGAGAACAGCTTCAGCCTCATGAGA

ATGGCGAAGGAAACTCTGAAACCTAAGGTGCTTCTTAAGTGGCGCCACTTCTGTCCGCTCCAAGTTCACCACCGTGGTGGTGGATTTCAACATCTCTCGT

GAACAGTGAAATCCCAGGACTGTATTGCTGAGAGCACCCAGCAGTCTCAGTTTATCCACAAAATTGAAATGGATATTTGTCGACTTCTCTTTATGAATAA

GTTCAGATTACATTTACTTCGCCTACACTAACGTGTGTTCTTAGGGACTTAAGTGATGGAATTTCAAGTGATTATCTTTGTTCAGTGTACATAAGACAGA

CAGCACTGAGTCAGCACGTTACATAGCATAGTACCTCTTCAGTTACTGTTCCTAATTGACTGTGTGGGGTTTCTCTCTTCGACGTTACGTTAGGGCAATT

AGGATTGTAAAGCAGTTCAAATTTAGACCATCAGTAAGTTTGCACAGGCACTTAGAACAGGTACACATTACACTACAGTTGACTTCATAAGCTACTGA
Translation
MAAPGRLLLRPRPGGLLLLLPGLLLPLADAFNLDVESPAEYAGPEGSYFGFAVDFFEPSTSS - UNI33615 - SRMFLLVGAPKANTTQPGIVEGGQ

VLKCECSSSRRCQPIEFDSTG - UNI26661 - GNRDYAKDDPLEFKSHQWFGASVRSKQDKIL - UNI25832 - ACAPLYHWRTEMKQEREPVG

TCFLQDGTKTVEYAPCRSS SQLISDQVAEIISKYDPNVYSIKYNNQLATRTAQAIFDDSYLG GYSVAVGDFNGDGIED DFVSGVPRAARTLGM VYI

YDGKNMSSLHNFTGEQ MAAYFGFSVAATDINGDD DYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRAVGDFQTTKLNGFEVFARFGSAIAPLGDLDQ

DGFND DIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQILEGQWAAQSMPPSFGYSMKGATDVDRNGYPD DLVVGAFGVDRAVLYR - UNI34766 

- RARPVVTVNAGLEVYPSILNQDNKICPLPGTALKVSC CFNVRFCLKADGKGTLPRKLH HFQVELLLDKLKQKGAIRRALFLHNRSPVHSKTMTVFR

GGQMQCEELVAYLR DESEFRDKLTPITIFMEYRLDQRTAADATGLQPILNQFTPANVSRQ AHILLDCGEDNVCKPKLEVSVNS SDQKKIYIGDDNPL

TLTVKAQNQGEGAYEAELIVSIPPQADFIGVVRNNE ALARLSCAFKTENQTRQVVCDLGNPMKAGTQ LLAGLRFSVHQQSEMDTSVKFDLKIQS SSN

SFDNVSPVVSYKVDLAVLAAVEIRG GVSSPDHIFLPIPNWEYKENPETEEDVGPIVQHIYE LRNNGPSSFSKAILNLQWPYKYNNNTLLYILHYDIDG

PMNCTADTEINPLRIK TPEKNDTAAAGQGERNHLITKRDLTLREGDVHTL GCGIAKCLQITCQVGRLDRGKSAILYVKSLLWTETFMN KENQNHSYS

LKSSASFNIIEFPYKNLPIEDLFNSTL VTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYR MGFFKRVRPPQEEQEREQLQPHENGEGNSE

T

For any suggestions or comments, please send an email to unitrap@crg.es