Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027176 (Cstf3)
Chromosomal location
Chr 2: 104430680 - 104505575 (+)
Description
cleavage stimulation factor, 3' pre-RNA, subunit 3 Gene [Source:MGI (curated);Acc:Cstf3-001]
RefSeq_dna
NM_145529 
RefSeq_peptide
NP_001032403.1 NP_663504.1 
MGI
MGI:1351825 
Uniprot/SWISSPROT
Q99LI7 
Uniprot/SPTREMBL
A2AQH9 Q3TV86 Q3TXN6 
Human Ortholog
ENSG00000176102 (CSTF3)
Omim not available
UniTrap UNI530
Vector Insertion
Chr 2: 104430860 - 104449027
Public Clones CF0713 (sanger) (sanger) XS1001 (sanger) AZ0021 (sanger) AL0354 (sanger)
CA0057 (sanger) XS1003 (sanger) AQ0179 (sanger) RHA082 (baygenomics)
P027E12 (ggtc) D128D10 (ggtc) H011A09 (ggtc) D178E09 (ggtc) M124F11 (ggtc)
D056G12 (ggtc) P126F08 (ggtc) D144G10 (ggtc) 3SE287B10 (ggtc) E047G10 (ggtc)
IST14657G8 (tigm) IST10880F9 (tigm) IST11622E8 (tigm) IST10126B6 (tigm)
IST13566E9 (tigm)
Private Clones OST465727 (lexicon) OST448825 (lexicon) OST440770 (lexicon) OST425553 (lexicon)
OST419291 (lexicon) OST402342 (lexicon) OST391165 (lexicon) OST359043 (lexicon)
OST356979 (lexicon) OST329646 (lexicon) OST328994 (lexicon) OST322968 (lexicon)
OST309033 (lexicon) OST307609 (lexicon) OST307592 (lexicon) OST299345 (lexicon)
OST286068 (lexicon) OST268907 (lexicon) OST266469 (lexicon) OST242334 (lexicon)
OST241427 (lexicon) OST237847 (lexicon) OST237758 (lexicon) OST207606 (lexicon)
OST205894 (lexicon) OST171414 (lexicon) OST170471 (lexicon) OST169063 (lexicon)
OST167258 (lexicon) OST142000 (lexicon) OST141971 (lexicon) OST131687 (lexicon)
OST108240 (lexicon) OST102206 (lexicon) OST89743 (lexicon) OST89058 (lexicon)
OST86605 (lexicon) OST83463 (lexicon) OST83427 (lexicon) OST82332 (lexicon)
OST76521 (lexicon) OST68354 (lexicon) OST67170 (lexicon) OST60899 (lexicon)
OST56570 (lexicon) OST44874 (lexicon) OST43250 (lexicon) OST41132 (lexicon)
OST39960 (lexicon) OST37908 (lexicon) OST31213 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2386
Vector Insertion
Chr 2: 104449130 - 104449247
Public Clones AD0130 (sanger) RRS244 (baygenomics) CMHD-GT_359C12-3 (cmhd)
Private Clones OST379333 (lexicon) OST98508 (lexicon) OST31322 (lexicon) OST26142 (lexicon)
OST20224 (lexicon) OST15824 (lexicon) OST6891 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2588
Vector Insertion
Chr 2: 104449344 - 104484445
Public Clones AC0631 (sanger) (sanger) XS0137 (sanger) XB065A (baygenomics) E044C10 (ggtc)
Private Clones OST38827 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22109
Vector Insertion
Chr 2: 104484479 - 104485135
Public Clones not available
Private Clones OST308170 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6362
Vector Insertion
Chr 2: 104487008 - 104488326
Public Clones YHC182 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9630
Vector Insertion
Chr 2: 104489773 - 104491798
Public Clones XE229 (baygenomics) XE087 (baygenomics) XE228 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9792
Vector Insertion
Chr 2: 104504515 - 104504873
Public Clones RRC014 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028599
Sequence
GCGGCGGCGGCGGCGGCAGCGGATTTGGCGGCGGCTTTGGCTCTGAGGGACAGGGGTAGTGTTCCTGGTTTTGGTGGGGTTTGCCTTTAGTTTAATTTTC

CTTTTCTAGCTTCCCTTTGCCGGCTGGTGCGTACGTTGTAGTCCCCCGAGGCCATGTCAGGAGACGCAGCCGCGGAGCAG - UNI530 - GCAGCGGA

ATATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTAGAAGAAAATCCATATGACCTTGATGCTTGGAGCATTCTCATTCGAGAGGCACAG - UNI

2386 - AATCAACCTATAGACAAAGCACGGAAGACTTACGAACGCCTTGTTGCCCAGTTCCCCAGTTCTGGCAGATTCTGGAAACTGTACATTGAAGCA

GAG - UNI2588 - ATTAAAGCTAAAAATTATGACAAGGTTGAAAAG - UNI22109 - CTATTTCAAAGATGCCTTATGAAGGTTTTGCACATTG

ATTTATGGAAGTGTTATCTTTCATACGTCAGAGAAACCAAGGGTAAACTGCCCAGCTACAA AGAAAAAATGGCTCAAGCTTATGACTTTGCACTAGATA

AAATTGGAATGGAAATTATGTCCTATCAG ATTTGGGTGGATTACATCAATTTCTTAAAAGGAGT GGAAGCTGTAGGATCTTATGCAGAAAATCAGAGA

ATAACTGCTGTCCGAAGAGTTTATCAACGAGGTTGTGTTAATCCAATGATCAACATTGAACAACTCTGGAGAGACTACAACAAGTATGAAGAG - UNI6

362 - GGTATCAATATTCATTTAGCTAAAAAGATGATTGAAGATCGGAGTAGAGACTACATGAATGCTAGACGTGTAGCAAAG GAATACGAGACAGTC

ATGAAAGGTTTGGACCGCAATGCTCCTTCAGTGCCTCCTCAGAATACTCCTCAAGAAGCTCAGCAAGTGGACATGTGGAAGAAGTACATCCAGTGGGAGA

AGAGCAACCCTCTTCGCACAGAGGACCAGACCCTGATAACCAAAAGAG - UNI9630 - TTATGTTTGCCTATGAACAGTGCCTCCTTGTGCTGGGCC

ATCACCCTGATATCTGGTATGAAGCTGCCCAGTATCTGGAACAGTCGAGTAAGCTGCTTGCAGAAAAGGGG GACATGAACAATGCCAAGTTATTTAGTG

ACGAAGCTGCTAATATTTATGAAAGAGCCATAAGCACGTTATTAAAGAAGAACATGCTCCTTTATTTTGCATATGCAGATTATGAAGAG AGTCGCATGA

AGTATGAGAAGGTTCACAGTATATATAACAGACTTCTGGCAATTGAGGACATTGACCCCACCTTA GTATATATTCAGTATATGAAATTTGCAAGGAGAG

CAGAAGGTATCAAATCTGGAAGAATGATATTTAAAAAAGCAAGAGAGGATGCCAGGACCCGCCATCATGTCTATGTAACTGCAGCCCTCATGGAATATTA

CTGTAGCAAG GACAAATCTGTTGCCTTTAAGATTTTTGAATTGGGACTAAAGAAATATGGAGACATTCCAGAATATGTTTTGGCTTATATTGACTATCT

CTCTCACCTCAATG AGGACAATAATACTCGAGTTTTGTTTGAAAGAGTTCTAACGTCTGGAAGCCTTCCTCCTGAGAAGTCTGG AGAAATCTGGGCTC

GATTTCTAGCTTTTGAAAGTAATATTGGTGATTTAGCTAGTATACTCAAAGTGGAAAAAAGACGGTTTACAGCATTCAGAGAAGAGTATGAAGGCAAGGA

AACAGCTTTACTGGTGGACAGATACAAGTTTATGGATTTATACCCTTGTTCTGCAAGTGAACTCAAAGCACTGGGCTATAAG GATGTCTCCCGTGCTAA

GCTAGCTGCTATAATTCCAGACCCAGTTGTAGCTCCTTCCATAGTGCCTGTTCTGAAAGATGAAGTGGATAGAAAACCTGAGTACCCTAAGCCAGACACT

CAGCAGATGATTCCATTTCAGCCACGACATTTAGCAC CTCCAGGCTTGCACCCTGTCCCCGGTGGAGTGTTTCCAGTGCCTCCTGCCGCTGTTGTTTTG

ATGAAACTGCTCCCACCTCCTATCTGCTTCCAG GGTCCTTTTGTACAAGTGGATGAGCTGATGGAAATTTTCCGAAGATGCAAGATACCAAACA - UN

I9792 - CTGTTGAGGAAGCCGTGAGGATCATCACTGGTGGGGCCCCAGAGCTGGCTGTGGAAGGCAACGGCCCAGTGGAAAGTAGTGCTGTACTGACT

AAGGCTGTCAAAAGGCCCAACGAGGATTCAGACGAAGATGAAGAAAAGGGGGCTGTAGTCCCCCCTGTTCATGACATTTACAGAGCACGGCAGCAGAAGC

GAATACGATGAGTCGGCTTAAACCTACCTGCCTCTGAGAGAAAAACTCTTACCCAGGACTCCTGTTTTGCCTCTTAAGTCATATGTTTTAAAGAGACAAC

ACTTTGTTACAAGGTTTTGGAAACAAAGTTGTATTGTCATTGGTGCCTCTGTCATATGGTTCTTGAGAAAAAACCCAAGCCTGTGTGGATTTTGAATTTG

GAGCAGACCTATCCTCTAAGCAAGATTAGGTTTTAAATAACAGTACAAAATGACAACGCCACATCTTGTTCCTTTTCAAGGGTGTCTTGTATGTGCCACT

TGAAGATTTGTAAGTTTTCCACAGTTTTATTTTAAAAACTGGATGGCTTATGATTGTAAAACATTTTCACATTTTCTGAAAAACGTTTGTTCTCAGTTTG

CTTACGTAGTCCTGCCTTACTGTTTGTTTTTATTTATGGCAGAATGTATGGCGACTGTTTTGTAGTTATAAATTTTTAAAAGGGTCCTTTGAAAGGAATA

AAAGGACCTC
Translation
MSGDAAAEQ - UNI530 - AAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQ - UNI2386 - NQPIDKARKTYERLVAQFPSSGRFWKLYIEAE

 - UNI2588 - IKAKNYDKVEK - UNI22109 - LFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYK KEKMAQAYDFALDKIGMEIMSYQ IWVD

YINFLKGV VEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEE - UNI6362 - GINIHLAKKMIEDRSRDYMNARRVAK EYETVMKG

LDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRV - UNI9630 - VMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKG DM

NNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEE SRMKYEKVHSIYNRLLAIEDIDPTL VYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVY

VTAALMEYYCSK DKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNE EDNNTRVLFERVLTSGSLPPEKSG GEIWARFLAFESNIGDLASILKVEKR

RFTAFREEYEGKETALLVDRYKFMDLYPCSASELKALGYK DVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAP PPGLHP

VPGGVFPVPPAAVVLMKLLPPPICFQ GPFVQVDELMEIFRRCKIPNT - UNI9792 - TVEEAVRIITGGAPELAVEGNGPVESSAVLTKAVKRPNE

DSDEDEEKGAVVPPVHDIYRARQQKRIR

For any suggestions or comments, please send an email to unitrap@crg.es