Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027206 (Cops2)
Chromosomal location
Chr 2: 125656040 - 125684875 (-)
Description
COP9 (constitutive photomorphogenic) homolog, subunit 2 (Arabidopsis thaliana) Gene [Source:MGI (curated);Acc:Cops2-001]
RefSeq_dna
NM_009939 
RefSeq_peptide
NP_034069.2 
UniGene
Mm.394881 Mm.470135 Mm.3596 
MGI
MGI:1330276 
Uniprot/SWISSPROT
P61202 
Uniprot/SPTREMBL
Q3V3N6 A2AQE3 Q3UK65 A2AQE4 
Human Ortholog
ENSG00000166200 (COPS2)
Omim not available
UniTrap UNI16679
Vector Insertion
Chr 2: 125675590 - 125684671
Public Clones IST14556F5 (tigm)
Private Clones OST455963 (lexicon) OST240382 (lexicon) OST92389 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1210
Vector Insertion
Chr 2: 125670672 - 125673942
Public Clones CE0085 (sanger) AW0874 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7293
Vector Insertion
Chr 2: 125659519 - 125660489
Public Clones RRT582 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110466
Sequence
CCTCCGGCCAAGATGTCTGACATGGAGGATGATTTCATGTGCGATGATGAGGAGGACTACGACCTG - UNI16679 - GAGTACTCTGAAGACAGTAA

CTCTGAGCCCAATGTGGATTTGGAAAATCAGTACTATAATTCCAAAGCACTGAAAGAAGATGACCCAAAAGCAGCATTAAGCAGCTTCCAAAAG GTTTT

GGAGCTTGAAGGTGAGAAGGGAGAATGGGGATTCAAAGCGCTAAAACAGATGATCAAGATTAACTTCAAGTTG - UNI1210 - ACAAACTTTCCAGA

AATGATGAACAGATATAAGCAACTATTGACCTATATTCGGAGTGCAGTCACCAGGAACTATTCTGAAAAGTCCATTAATTCTATCCTTGATTATATCTCC

ACTTCTAAACAG AATTCTGATTTTTTATGTCAGATGGATTTACTGCAGGAATTTTATGAAACAACACTGGAAGCTTTGAAAGATGCTAAGAATGATAGA

CTGTGGTTTAAGACAAACACAAAG CTTGGAAAATTATATTTAGAACGAGAAGAATATGGAAAGCTTCAAAAAATTTTACGACAGTTACATCAGTCTTGT

CAG ACTGATGATGGAGAAGATGACCTGAAAAAAGGTACCCAGTTATTAGAAATCTATGCTTTGGAAATTCAAATGTACACTGCACAGAAGAACAACAAA

AAGCTTAAAGCACTCTATGAGCAATCACTTCACATCAAGTCTGCCATCCCTCACCCACTAATCATGGGTGTCATCAGAG AATGCGGTGGTAAGATGCAC

TTGAGAGAAGGTGAATTTGAAAAGGCACACACTGATTTTTTTGAAGCCTTCAAGAATTATGATGAATCAGGAAGCCCAAGACGAACCACTTGTTTAAAAT

ATTTGGTTTTAGCAAATATGCTAATGAAATCAGGAATAAATCCGTTTGACTCACAAGAG GCCAAGCCGTATAAAAATGATCCAGAAATTCTAGCAATGA

CAAATTTA GTTAGTGCCTATCAGAATAATGACATCACTGAATTTGAAAAGATTCTGAAAACAAATCACAGCAACATCATGGATGATCCTTTCATAAGAG

AGCACATTGAAG AACTTTTACGAAACATCAGAACACAAGTCCTCATAAAGTTAATTAAGCCTTACACAAGAATACATATTCCTTTTATTTCTAAG - U

NI7293 - GAGCTAAACATAGACGTAGCTGATGTGGAGAGCTTGCTGGTGCAGTGCATACTGGATAA CACTATTCATGGCCGAATTGATCAAGTCAAC

CAGCTCCTTGAACTGGATCATCAGAAGAGGGGTGGTGCCCGATACACTGCGCTAGATAAATGGACCAACCAACTAAATTCTCTGAACCAGGCTGTGGTCA

GTAAACTGGCTTAACGGAGACCGAGCTTTGCGGACATGCTTAAGGCAACAGTGCAGAGATGTGACCCTTGAGGACTGGAAAGACAAAGCTCCAGTGGGTT

GGTGTGTCCTGAAAGGGATGGAGTTATGGCAGAAGTGCTTTTGTGATCAACTGGTTTGTGGTTTGCTGCTGCATTTATCCCAAGAAAACAGCTTTAATCT

CCAGAAGAAAACCAAAACACCATGGGATTTATGCTGTGTTGACATCTTGCCCTAAACATACAACACCATAGTAATTTGTCATGGGCGACATGATCAGAGA

GAAGATTTTTGTCATGATTTTAAAAACACTGACACGCTACTGTTGGTTAAATTTAAACATGTTGTACCTGCAGAAATTCTCTCACAAATAACCTGCAATA

ACTTGAAATTCATACCCTTTTGAACACTTCCTTTTCTCATGTATAAATGAAAATGTTTGCTGCATTTTGCAAAATGTCAATTCTCCAAAACTGTGTCCGT

CTATTTCTGTTCTTGCAGCTAGTAAAGGTTAGACAACCCGAATTCTCAGTGGCACGCTGTCACCTAGGGCTCAAGCAGCAAAATAAACAGTGCAGCTCAG

AAATTATAGCTTGGTTCTTGATGTGTTTTTATTACATTCGGGGTTGCTCTTTTGTTTTTAGTATCTTAAAGATTTCAGGTTATTTTGTCTTCAGTTAAGA

TTTAAAAGCCTGAGAGCAAATAGTTAAAGCTAGTTATTTGCTTCCAGGTTTTTAAAATTAAAGTTCATTGATAGAGTAAGAACTCCTTTCTAACAGAGCC

CTTACATAGAACTTGTTTTGACAGTGATACTTTAAAGGATTATGATGCTTTTTTTTTTAAAGACTGGTAATTTCTTTTTAAAAGAATACGTGTTAACTCT

CAGAATGTCACTTTAGACAAATATGCCAGAATCTAGACAGCGAAGTGAATGTTACCTGCATAGTGACCATGCTGAAAGGTTATTTTCTAATGCCAGCAAC

AACCATTGCCCGAAGCCTCTTGGGTTTGCTCTTGGAGAATTACAGTCAAAGTTAATTTAGGTAACTCACTACTAACTTCATGTTTACACCTTGTTTGAAA

AGATTATTAACAAGCTTGTCTGTCTTTACCCTAATTTGGCCCCAAATACCAGTTTCAAAGAAATACCTAAATTTAGATAATGTAGAAAGTATGCATCTGG

CTTTGAAAGCAATCCCCAAATAATTTTCAAGTATTTTGTGCAGTGGCAGAATAGTTAGGAATGAACTATGGCCTTCGATGGTGGCAGAACTCAGCCCATT

TGAATGTATTGAGTTTTGGATGTATTTGTTTCTTTTTTTAAGTTCACATTATCATATAGTGTCAAAAGAAGGAACTAAGATTAACATAATGTGCTTGGTT

TTCTATTGCTCATTATTATGTAAACAGTTGAGTGGCAGTGCAGAAGGAAGACTGTGTGACTGAAGAGTGGCAACCAAGAATTTTGATCATTAAATCAGAT

TTTATAAACAGTAGAAAGAGCATGGACTTAAAACAAGGCATGCTTATTTGGTTTTGTCAAAATTTTACGAAAATATGTGATATATATTTATACTAAAACT

ATATAATCCTTAGATTTAGGAAAGCAGTCAGTTAATGTCTAGCAGAATAAAGCAGTATTAAATACAGATATACGTTGAAAATTGTAGAAAACCGAAAGAA

GACGAAAGACAAAATGTCAATGGTAGGGAATAAAAAGTTTAAGATATTATAAAAGTATGTGTATTTTCTTCTATTCTACATAAATCATTTGTGAAAAGTG

TGTTCACGTTTTTTACAGGAGTGATATCAATTAGGATTTATTTTTCCAATACAATTTGGAGACCCTTTGTTACCCAAATAAAAATGACAAGTTTCTGTGC

CTG
Translation
MSDMEDDFMCDDEEDYDL - UNI16679 - EYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQK VLELEGEKGEWGFKALKQMIKINFKL - 

UNI1210 - TNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQ NSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTK LGKLYLERE

EYGKLQKILRQLHQSCQ TDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRE ECGGKMHLREGEFEKAHTDFFE

AFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQE AKPYKNDPEILAMTNL VSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEE ELLRNIRT

QVLIKLIKPYTRIHIPFISK - UNI7293 - ELNIDVADVESLLVQCILDN NTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSK

LA
Transcript ENSMUST00000028635
Sequence
CCTCCGGCCAAGATGTCTGACATGGAGGATGATTTCATGTGCGATGATGAGGAGGACTACGACCTG - UNI16679 - GAGTACTCTGAAGACAGTAA

CTCTGAGCCCAATGTGGATTTGGAAAATCAGTACTATAATTCCAAAGCACTGAAAGAAGATGACCCAAAAGCAGCATTAAGCAGCTTCCAAAAG GTTTT

GGAGCTTGAAGGTGAGAAGGGAGAATGGGGATTCAAAGCGCTAAAACAGATGATCAAGATTAACTTCAAGTTG - UNI1210 - ACAAACTTTCCAGA

AATGATGAACAGATATAAGCAACTATTGACCTATATTCGGAGTGCAGTCACCAGGAACTATTCTGAAAAGTCCATTAATTCTATCCTTGATTATATCTCC

ACTTCTAAACAG ATGGATTTACTGCAGGAATTTTATGAAACAACACTGGAAGCTTTGAAAGATGCTAAGAATGATAGACTGTGGTTTAAGACAAACACA

AAG CTTGGAAAATTATATTTAGAACGAGAAGAATATGGAAAGCTTCAAAAAATTTTACGACAGTTACATCAGTCTTGTCAG ACTGATGATGGAGAAGA

TGACCTGAAAAAAGGTACCCAGTTATTAGAAATCTATGCTTTGGAAATTCAAATGTACACTGCACAGAAGAACAACAAAAAGCTTAAAGCACTCTATGAG

CAATCACTTCACATCAAGTCTGCCATCCCTCACCCACTAATCATGGGTGTCATCAGAG AATGCGGTGGTAAGATGCACTTGAGAGAAGGTGAATTTGAA

AAGGCACACACTGATTTTTTTGAAGCCTTCAAGAATTATGATGAATCAGGAAGCCCAAGACGAACCACTTGTTTAAAATATTTGGTTTTAGCAAATATGC

TAATGAAATCAGGAATAAATCCGTTTGACTCACAAGAG GCCAAGCCGTATAAAAATGATCCAGAAATTCTAGCAATGACAAATTTAGTAAG TGCCTAT

CAGAATAATGACATCACTGAATTTGAAAAGATTCTGAAAACAAATCACAGCAACATCATGGATGATCCTTTCATAAGAGAGCACATTGAAG AACTTTTA

CGAAACATCAGAACACAAGTCCTCATAAAGTTAATTAAGCCTTACACAAGAATACATATTCCTTTTATTTCTAAG - UNI7293 - GAGCTAAACATA

GACGTAGCTGATGTGGAGAGCTTGCTGGTGCAGTGCATACTGGATAA CACTATTCATGGCCGAATTGATCAAGTCAACCAGCTCCTTGAACTGGATCAT

CAGAAGAGGGGTGGTGCCCGATACACTGCGCTAGATAAATGGACCAACCAACTAAATTCTCTGAACCAGGCTGTGGTCAGTAAACTGGCTTAACGGAGAC

CGAGCTTTGCGGACATGCTTAAGGCAACAGTGCAGAGATGTGACCCTTGAGGACTGGAAAGACAAAGCTCCAGTGGGTTGGTGTGTCCTGAAAGGGATGG

AGTTATGGCAGAAGTGCTTTTGTGATCAACTGGTTTGTGGTTTGCTGCTGCATTTATCCCAAGAAAACAGCTTTAATCTCCAGAAGAAAACCAAAACACC

ATGGGATTTATGCTGTGTTGACATCTTGCCCTAAACATACAACACCATAGTAATTTGTCATGGGCGACATGATCAGAGAGAAGATTTTTGTCATGATTTT

AAAAACACTGACACGCTACTGTTGGTTAAATTTAAACATGTTGTACCTGCAGAAATTCTCTCACAAATAACCTGCAATAACTTGAAATTCATACCCTTTT

GAACACTTCCTTTTCTCATGTATAAATGAAAATGTTTGCTGCATTTTGCAAAATGTCAATTCTCCAAAACTGTGTCCGTCTATTTCTGTTCTTGCAGCTA

GTAAAGGTTAGACAACCCGAATTCTCAGTGGCACGCTGTCACCTAGGGCTCAAGCAGCAAAATAAACAGTGCAGCTCAGAAATTATAGCTTGGTTCTTGA

TGTGTTTTTATTACATTCGGGGTTGCTCTTTTGTTTTTAGTATCTTAAAGATTTCAGGTTATTTTGTCTTCAGTTAAGATTTAAAAGCCTGAGAGCAAAT

AGTTAAAGCTAGTTATTTGCTTCCAGGTTTTTAAAATTAAAGTTCATTGATAGAGTAAGAACTCCTTTCTAACAGAGCCCTTACATAGAACTTGTTTTGA

CAGTGATACTTTAAAGGATTATGATGCTTTTTTTTTTAAAGACTGGTAATTTCTTTTTAAAAGAATACGTGTTAACTCTCAGAATGTCACTTTAGACAAA

TATGCCAGAATCTAGACAGCGAAGTGAATGTTACCTGCATAGTGACCATGCTGAAAGGTTATTTTCTAATGCCAGCAACAACCATTGCCCGAAGCCTCTT

GGGTTTGCTCTTGGAGAATTACAGTCAAAGTTAATTTAGGTAACTCACTACTAACTTCATGTTTACACCTTGTTTGAAAAGATTATTAACAAGCTTGTCT

GTCTTTACCCTAATTTGGCCCCAAATACCAGTTTCAAAGAAATACCTAAATTTAGATAATGTAGAAAGTATGCATCTGGCTTTGAAAGCAATCCCCAAAT

AATTTTCAAGTATTTTGTGCAGTGGCAGAATAGTTAGGAATGAACTATGGCCTTCGATGGTGGCAGAACTCAGCCCATTTGAATGTATTGAGTTTTGGAT

GTATTTGTTTCTTTTTTTAAGTTCACATTATCATATAGTGTCAAAAGAAGGAACTAAGATTAACATAATGTGCTTGGTTTTCTATTGCTCATTATTATGT

AAACAGTTGAGTGGCAGTGCAGAAGGAAGACTGTGTGACTGAAGAGTGGCAACCAAGAATTTTGATCATTAAATCAGATTTTATAAACAGTAGAAAGAGC

ATGGACTTAAAACAAGGCATGCTTATTTGGTTTTGTCAAAATTTTACGAAAATATGTGATATATATTTATACTAAAACTATATAATCCTTAGATTTAGGA

AAGCAGTCAGTTAATGTCTAGCAGAATAAAGCAGTATTAAATACAGATATACGTTGAAAATTGTAGAAAACCGAAAGAAGACGAAAGACAAAATGTCAAT

GGTAGGGAATAAAAAGTTTAAGATATTATAAAAGTATGTGTATTTTCTTCTATTCTACATAAATCATTTGTGAAAAGTGTGTTCACGTTTTTTACAGGAG

TGATATCAATTAGGATTTATTTTTCCAATACAATTTGGAGACCCTTTGTTACCCAAATAAAAATGACAAGTTTCTGTGCCTG
Translation
MSDMEDDFMCDDEEDYDL - UNI16679 - EYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQK VLELEGEKGEWGFKALKQMIKINFKL - 

UNI1210 - TNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQ MDLLQEFYETTLEALKDAKNDRLWFKTNTK LGKLYLEREEYGKLQK

ILRQLHQSCQ TDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRE ECGGKMHLREGEFEKAHTDFFEAFKNYDE

SGSPRRTTCLKYLVLANMLMKSGINPFDSQE AKPYKNDPEILAMTNLVS SAYQNNDITEFEKILKTNHSNIMDDPFIREHIEE ELLRNIRTQVLIKL

IKPYTRIHIPFISK - UNI7293 - ELNIDVADVESLLVQCILDN NTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Transcript ENSMUST00000110463
Sequence
GGTCGAGCGCTTTAGTTCCGGAATGAGCTTTATCTTCTCCTGGAGAGACCGGAAGACGAGGAGACTCGGGAGTGACGCTTCTGGGCCGCGGAGCACTGTG

GGAGGAGGCTGTCTCTAATTTCTCCTCTCCCCCTCCCCCCTCCGGCCAAGATGTCTGACATGGAGGATGATTTCATGTGCGATGATGAGGAGGACTACGA

CCTG - UNI16679 - GAGTACTCTGAAGACAGTAACTCTGAGCCCAATGTGGATTTGGAAAATCAGTACTATAATTCCAAAGCACTGAAAGAAGATG

ACCCAAAAGCAGCATTAAGCAGCTTCCAAAAG GTTTTGGAGCTTGAAGGTGAGAAGGGAGAATGGGGATTCAAAGCGCTAAAACAGATGATCAAGATTA

ACTTCAAGTTG - UNI1210 - ACAAACTTTCCAGAAATGATGAACAGATATAAGCAACTATTGACCTATATTCGGAGTGCAGTCACCAGGAACTATT

CTGAAAAGTCCATTAATTCTATCCTTGATTATATCTCCACTTCTAAACAG AATTCTGATTTTTTATGTCAGATGGATTTACTGCAGGAATTTTATGAAA

CAACACTGGAAGCTTTGAAAGATGCTAAGAATGATAGACTGTGGTTTAAGACAAACACAAAG CTTGGAAAATTATATTTAGAACGAGAAGAATATGGAA

AGCTTCAAAAAATTTTACGACAGTTACATCAGTCTTGTCAG ACTGATGATGGAGAAGATGACCTGAAAAAAGGTACCCAGTTATTAGAAATCTATGCTT

TGGAAATTCAAATGTACACTGCACAGAAGAACAACAAAAAGCTTAAAGCACTCTATGAGCAATCACTTCACATCAAGTCTGCCATCCCTCACCCACTAAT

CATGGGTGTCATCAGAG AATGCGGTGGTAAGATGCACTTGAGAGAAGGTGAATTTGAAAAGGCACACACTGATTTTTTTGAAGCCTTCAAGAATTATGA

TGAATCAGGAAGCCCAAGACGAACCACTTGTTTAAAATATTTGGTTTTAGCAAATATGCTAATGAAATCAGGAATAAATCCGTTTGACTCACAAGAG GC

CAAGCCGTATAAAAATGATCCAGAAATTCTAGCAATGACAAATTTAGTAAG TGCCTATCAGAATAATGACATCACTGAATTTGAAAAGATTCTGAAAAC

AAATCACAGCAACATCATGGATGATCCTTTCATAAGAGAGCACATTGAAG AACTTTTACGAAACATCAGAACACAAGTCCTCATAAAGTTAATTAAGCC

TTACACAAGAATACATATTCCTTTTATTTCTAAG - UNI7293 - GAGCTAAACATAGACGTAGCTGATGTGGAGAGCTTGCTGGTGCAGTGCATACT

GGATAA CACTATTCATGGCCGAATTGATCAAGTCAACCAGCTCCTTGAACTGGATCATCAGAAGAGGGGTGGTGCCCGATACACTGCGCTAGATAAATG

GACCAACCAACTAAATTCTCTGAACCAGGCTGTGGTCAGTAAACTGGCTTAACGGAGACCGAGCTTTGCGGACATGCTTAAGGCAACAGTGCAGAGATGT

GACCCTTGAGGACTGGAAAGACAAAGCTCCAGTGGGTTGGTGTGTCCTGAAAGGGATGGAGTTATGGCAGAAGTGCTTTTGTGATCAACTGGTTTGTGGT

TTGCTGCTGCATTTATCCCAAGAAAACAGCTTTAATCTCCAGAAGAAAACCAAAACACCATGGGATTTATGCTGTGTTGACATCTTGCCCTAAACATACA

ACACCATAGTAATTTGTCATGGGCGACATGATCAGAGAGAAGATTTTTGTCATGATTTTAAAAACACTGACACGCTACTGTTGGTTAAATTTAAACATGT

TGTACCTGCAGAAATTCTCTCACAAATAACCTGCAATAACTTGAAATTCATACCCTTTTGAACACTTCCTTTTCTCATGTATAAATGAAAATGTTTGCTG

CATTTTGCAAAATGTCAATTCTCCAAAACTGTGTCCGTCTATTTCTGTTCTTGCAGCTAGTAAAGGTTAGACAACCCGAATTCTCAGTGGCACGCTGTCA

CCTAGGGCTCAAGCAGCAAAATAAACAGTGCAGCTCAGAAATTATAGCTTGGTTCTTGATGTGTTTTTATTACATTCGGGGTTGCTCTTTTGTTTTTAGT

ATCTTAAAGATTTCAGGTTATTTTGTCTTCAGTTAAGATTTAAAAGCCTGAGAGCAAATAGTTAAAGCTAGTTATTTGCTTCCAGGTTTTTAAAATTAAA

GTTCATTGATAGAGTAAGAACTCCTTTCTAACAGAGCCCTTACATAGAACTTGTTTTGACAGTGATACTTTAAAGGATTATGATGCTTTTTTTTTTAAAG

ACTGGTAATTTCTTTTTAAAAGAATACGTGTTAACTCTCAGAATGTCACTTTAGACAAATATGCCAGAATCTAGACAGCGAAGTGAATGTTACCTGCATA

GTGACCATGCTGAAAGGTTATTTTCTAATGCCAGCAACAACCATTGCCCGAAGCCTCTTGGGTTTGCTCTTGGAGAATTACAGTCAAAGTTAATTTAGGT

AACTCACTACTAACTTCATGTTTACACCTTGTTTGAAAAGATTATTAACAAGCTTGTCTGTCTTTACCCTAATTTGGCCCCAAATACCAGTTTCAAAGAA

ATACCTAAATTTAGATAATGTAGAAAGTATGCATCTGGCTTTGAAAGCAATCCCCAAATAATTTTCAAGTATTTTGTGCAGTGGCAGAATAGTTAGGAAT

GAACTATGGCCTTCGATGGTGGCAGAACTCAGCCCATTTGAATGTATTGAGTTTTGGATGTATTTGTTTCTTTTTTTAAGTTCACATTATCATATAGTGT

CAAAAGAAGGAACTAAGATTAACATAATGTGCTTGGTTTTCTATTGCTCATTATTATGTAAACAGTTGAGTGGCAGTGCAGAAGGAAGACTGTGTGACTG

AAGAGTGGCAACCAAGAATTTTGATCATTAAATCAGATTTTATAAACAGTAGAAAGAGCATGGACTTAAAACAAGGCATGCTTATTTGGTTTTGTCAAAA

TTTTACGAAAATATGTGATATATATTTATACTAAAACTATATAATCCTTAGATTTAGGAAAGCAGTCAGTTAATGTCTAGCAGAATAAAGCAGTATTAAA

TACAGATATACGTTGAAAATTGTAGAAAACCGAAAGAAGACGAAAGACAAAATGTCAATGGTAGGGAATAAAAAGTTTAAGATATTATAAAAGTATGTGT

ATTTTCTTCTATTCTACATAAATCATTTGTGAAAAGTGTGTTCACGTTTTTTACAGGAGTGATATCAATTAGGATTTATTTTTCCAATACAATTTGGAGA

CCCTTTGTTACCCAAATAAAAATGACAAGTTTCTGTGCCTG
Translation
MSDMEDDFMCDDEEDYDL - UNI16679 - EYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQK VLELEGEKGEWGFKALKQMIKINFKL - 

UNI1210 - TNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQ NSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTK LGKLYLERE

EYGKLQKILRQLHQSCQ TDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRE ECGGKMHLREGEFEKAHTDFFE

AFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQE AKPYKNDPEILAMTNLVS SAYQNNDITEFEKILKTNHSNIMDDPFIREHIEE ELLRNIR

TQVLIKLIKPYTRIHIPFISK - UNI7293 - ELNIDVADVESLLVQCILDN NTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVS

KLA
Transcript ENSMUST00000110462
Sequence
GGAGGAGGCTGTCTCTAATTTCTCCTCTCCCCCTCCCCCCTCCGGCCAAGATGTCTGACATGGAGGATGATTTCATGTGCGATGATGAGGAGGACTACGA

CCTG - UNI16679 - GAGTACTCTGAAGACAGTAACTCTGAGCCCAATGTGGATTTGGAAAATCAGTACTATAATTCCAAAGCACTGAAAGAAGATG

ACCCAAAAGCAGCATTAAGCAGCTTCCAAAAG GTTTTGGAGCTTGAAGGTGAGAAGGGAGAATGGGGATTCAAAGCGCTAAAACAGATGATCAAGATTA

ACTTCAAGTTG - UNI1210 - ACAAACTTTCCAGAAATGATGAACAGATATAAGCAACTATTGACCTATATTCGGAGTGCAGTCACCAGGAACTATT

CTGAAAAGTCCATTAATTCTATCCTTGATTATATCTCCACTTCTAAACAG AATTCTGATTTTTTATGTCAGATGGATTTACTGCAGGAATTTTATGAAA

CAACACTGGAAGCTTTGAAAGATGCTAAGAATGATAGACTGTGGTTTAAGACAAACACAAAG CTTGGAAAATTATATTTAGAACGAGAAGAATATGGAA

AGCTTCAAAAAATTTTACGACAGTTACATCAGTCTTGTCAG ACTGATGATGGAGAAGATGACCTGAAAAAAG AATGCGGTGGTAAGATGCACTTGAGA

GAAGGTGAATTTGAAAAGGCACACACTGATTTTTTTGAAGCCTTCAAGAATTATGATGAATCAGGAAGCCCAAGACGAACCACTTGTTTAAAATATTTGG

TTTTAGCAAATATGCTAATGAAATCAGGAATAAATCCGTTTGACTCACAAGAG GCCAAGCCGTATAAAAATGATCCAGAAATTCTAGCAATGACAAATT

TAGTAAG TGCCTATCAGAATAATGACATCACTGAATTTGAAAAGATTCTGAAAACAAATCACAGCAACATCATGGATGATCCTTTCATAAGAGAGCACA

TTGAAG AACTTTTACGAAACATCAGAACACAAGTCCTCATAAAGTTAATTAAGCCTTACACAAGAATACATATTCCTTTTATTTCTAAG - UNI7293

 - GAGCTAAACATAGACGTAGCTGATGTGGAGAGCTTGCTGGTGCAGTGCATACTGGATAA CACTATTCATGGCCGAATTGATCAAGTCAACCAGCTC

CTTGAACTGGATCATCAGAAGAGGGGTGGTGCCCGATACACTGCGCTAGATAAATGGACCAACCAACTAAATTCTCTGAACCAGGCTGTGGTCAGTAAAC

TGGCTTAACGGAGACCGAGCTTTGCGGACATGCTTAAGGCAACAGTGCAGAGATGTGACCCTTGAGGACTGGAAAGACAAAGCTCCAGTGGGTTGGTGTG

TCCTGAAAGGGATGGAGTTATGGCAGAAGTGCTTTTGTGATCAACTGGTTTGTGGTTTGCTGCTGCATTTATCCCAAGAAAACAGCTTTAATCTCCAGAA

GAAAACCAAAACACCATGGGATTTATGCTGTGTTGACATCTTGCCCTAAACATACAACACCATAGTAATTTGTCATGGGCGACATGATCAGAGAGAAGAT

TTTTGTCATGATTTTAAAAACACTGACACGCTACTGTTGGTTAAATTTAAACATGTTGTACCTGCAGAAATTCTCTCACAAATAACCTGCAATAACTTGA

AATTCATACCCTTTTGAACACTTCCTTTTCTCATGTATAAATGAAAATGTTTGCTGCATTTTGCAAAATGTCAATTCTCCAAAACTGTGTCCGTCTATTT

CTGTTCTTGCAGCTAGTAAAGGTTAGACAACCCGAATTCTCAGTGGCACGCTGTCACCTAGGGCTCAAGCAGCAAAATAAACAGTGCAGCTCAGAAATTA

TA
Translation
MSDMEDDFMCDDEEDYDL - UNI16679 - EYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQK VLELEGEKGEWGFKALKQMIKINFKL - 

UNI1210 - TNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQ NSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTK LGKLYLERE

EYGKLQKILRQLHQSCQ TDDGEDDLKKE ECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQE AKPYKNDPE

ILAMTNLVS SAYQNNDITEFEKILKTNHSNIMDDPFIREHIEE ELLRNIRTQVLIKLIKPYTRIHIPFISK - UNI7293 - ELNIDVADVESLLV

QCILDN NTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

For any suggestions or comments, please send an email to unitrap@crg.es