Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027207 (Galk2)
Chromosomal location
Chr 2: 125685094 - 125809321 (+)
Description
galactokinase 2 Gene [Source:MGI (curated);Acc:Galk2-001]
RefSeq_dna
NM_175154 
RefSeq_peptide
NP_780363.1 
MGI
MGI:1917226 
Uniprot/SWISSPROT
Q68FH4 
Uniprot/SPTREMBL
Q3U728 Q8BMX0 Q8BUU7 Q3U3H5 Q8BWB2 
Human Ortholog
ENSG00000156958 (GALK2)
Omim not available
UniTrap UNI20265
Vector Insertion
Chr 2: 125692122 - 125704013
Public Clones not available
Private Clones OST368572 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028636
Sequence
ATGCCCGACCTATCTGAAAG - UNI20265 - ATTGCTGAAGCTAAAAGAGATGTTTAACTCTAAATTTGGGTCCACACCCAAGTTTTATGTTCGAGC

CCCAGGAAGAGTCAACATAATAG GTGAGCACATAGATTACTGTGGATATTCCGTTATTCCCATGGCTGTGGAACAAGACATGTTAATAGCTGTGGAACC

TGTGAAAACACACACTCTCCAACTGGCTAATACAGACCCCTTGTATCC AGACTTCAGTACTACAGCTAATAACATCTGTATCGACAAGACCAAACCTCT

ATGGCACAACTACTTCTTGTGTGGCTTTAAGGGAATTCAG GAACACTTTGGCCTTAGTAAGCTGCCTGGAATGAATTGCCTGGTAGATGGAAATATACC

CCCGAGTTCGGGCCTCTCCAGCTCCAGTGCTCTGGTTTGCTGTGCTGGGTTAGTGACTCTCACGGTGCTGGGACTGAGACTTTCCAAG GTGGAACTTGC

AGAAATCTGTGCCAAGAGTGAGCGCTACATAGGCACTGAAGGTGGCGGCATGGACCAGTCCATATCATTCCTTGCAGAAGAAGGAACT GCCAAGTTAAT

AGAATTTAGCCCTCTGAGAGCGACTAATGTGAAGCTCCCCAGTGGGGCAGTCTTTGTGATTGCCAACAGCTGCATGGAAATGAACAAGGCGGCCACTTCA

CATTTCAATGTCAGGGTGATGGAGTGTCGACTGGCGGCAAAG GTCCTTGCTAAACACAAAGGCTTGCAATGGGATAATGTCCTGCGGCTAGAGGAAGTG

CAAAGCAAACTCGGGATTAGTCTGGAAGAGATGCTGTTGGTCACAGAGGATGCCCTTCATCCTGAACCCTACAGCCGGGAGGAGATCTGCAGGTGCCTGG

GAATTAGCCTCGAGAGACTCCGCACCCAAATCCTGACTCCAAATACTCAAGATG AACTCACCTTTAAGCTCTACCAGCGGGCCAAGCACGTGTACAGTG

AGGCTGCACGCGTGCTGCAGTTTAAGCAGGTATGTGAAGATGCGCCAGACAACGCAGTCCAGCTGCTGGGGGAGCTAATGAACCAGAGCCACAGAAGCTG

CCGGGACATGTATGAGTGCAGCTGCCCTGAGCTGGACCAGCTAGTGGACATCTGCCG GAAGTTTGGGGCCAAAGGCTCACGACTTACTGGAGCAGGATG

GGGAGGCTGCACTGTGTCCCTCGTGCCCGCTGACATGCTGTCCAGCTTTCTCGCCAGTGTGCACGAAGCTTATTACCAGGGGAACACATCCCGCCTGGCT

CAGGAGAAGCATAGCTTGTTTGCCACCAAGCCTGGAGGCGGGGCCTTGGTTTTCCGTGAGGTCTAAACAATGTCAAACATCTCAGAGAAACTATTTTGGG

TATTAAGGAGCTGGCGGGGCTTCCTGTGCCACAGTAAATCAGCTCTTTTTCTGTTTTGTGTTGTGAGGTACGTTTGCTATTATCAAGATGCATTTCTAAA

GAAATGGTGAAAGCTAGACTTCATAATGACCACTTTTCTTTCTTACATGTATTTTTATGAATCAGAGACAAGGATATGCTTAGATAGACCTTTGAGGTAT

GATTAAGATTTATTGATATGAAGATTTAAAAGATGAACAGCAAAATGTACTTTTAATTGAACACTGCTCCAATTAAACTGATACAACTG
Translation
MPDLSER - UNI20265 - RLLKLKEMFNSKFGSTPKFYVRAPGRVNIIG GEHIDYCGYSVIPMAVEQDMLIAVEPVKTHTLQLANTDPLYP PDFS

TTANNICIDKTKPLWHNYFLCGFKGIQ EHFGLSKLPGMNCLVDGNIPPSSGLSSSSALVCCAGLVTLTVLGLRLSK VELAEICAKSERYIGTEGGGMD

QSISFLAEEGT AKLIEFSPLRATNVKLPSGAVFVIANSCMEMNKAATSHFNVRVMECRLAAK VLAKHKGLQWDNVLRLEEVQSKLGISLEEMLLVTED

ALHPEPYSREEICRCLGISLERLRTQILTPNTQDE ELTFKLYQRAKHVYSEAARVLQFKQVCEDAPDNAVQLLGELMNQSHRSCRDMYECSCPELDQLV

DICR RKFGAKGSRLTGAGWGGCTVSLVPADMLSSFLASVHEAYYQGNTSRLAQEKHSLFATKPGGGALVFREV
Transcript ENSMUST00000094604
Sequence
GAAAGCCATTCCTGCCACTTTAATCTCGTGATGCTTAGCTGTGCTGCACTTCTGGAAACTGCAGAGGGATCTAGCAAAATATGGCTGCGGAGGACCCTGC

CACTCGACGAGTCCAGGTGGCAGAACATCCCAG - UNI20265 - ATTGCTGAAGCTAAAAGAGATGTTTAACTCTAAATTTGGGTCCACACCCAAGT

TTTATGTTCGAGCCCCAGGAAGAGTCAACATAATAG GTGAGCACATAGATTACTGTGGATATTCCGTTATTCCCATGGCTGTGGAACAAGACATGTTAA

TAGCTGTGGAACCTGTGAAAACACACACTCTCCAACTGGCTAATACAGACCCCTTGTATCC AGACTTCAGTACTACAGCTAATAACATCTGTATCGACA

AGACCAAACCTCTATGGCACAACTACTTCTTGTGTGGCTTTAAGGGAATTCAG GAACACTTTGGCCTTAGTAAGCTGCCTGGAATGAATTGCCTGGTAG

ATGGAAATATACCCCCGAGTTCGGGCCTCTCCAGCTCCAGTGCTCTGGTTTGCTGTGCTGGGTTAGTGACTCTCACGGTGCTGGGACTGAGACTTTCCAA

G GTGGAACTTGCAGAAATCTGTGCCAAGAGTGAGCGCTACATAGGCACTGAAGGTGGCGGCATGGACCAGTCCATATCATTCCTTGCAGAAGAAGGAAC

T GCCAAGTTAATAGAATTTAGCCCTCTGAGAGCGACTAATGTGAAGCTCCCCAGTGGGGCAGTCTTTGTGATTGCCAACAGCTGCATGGAAATGAACAA

GGCGGCCACTTCACATTTCAATGTCAGGGTGATGGAGTGTCGACTGGCGGCAAAG GTCCTTGCTAAACACAAAGGCTTGCAATGGGATAATGTCCTGCG

GCTAGAGGAAGTGCAAAGCAAACTCGGGATTAGTCTGGAAGAGATGCTGTTGGTCACAGAGGATGCCCTTCATCCTGAACCCTACAGCCGGGAGGAGATC

TGCAGGTGCCTGGGAATTAGCCTCGAGAGACTCCGCACCCAAATCCTGACTCCAAATACTCAAGATG AACTCACCTTTAAGCTCTACCAGCGGGCCAAG

CACGTGTACAGTGAGGCTGCACGCGTGCTGCAGTTTAAGCAGGTATGTGAAGATGCGCCAGACAACGCAGTCCAGCTGCTGGGGGAGCTAATGAACCAGA

GCCACAGAAGCTGCCGGGACATGTATGAGTGCAGCTGCCCTGAGCTGGACCAGCTAGTGGACATCTGCCG GAAGTTTGGGGCCAAAGGCTCACGACTTA

CTGGAGCAGGATGGGGAGGCTGCACTGTGTCCCTCGTGCCCGCTGACATGCTGTCCAGCTTTCTCGCCAGTGTGCACGAAGCTTATTACCAGGGGAACAC

ATCCCGCCTGGCTCAGGAGAAGCATAGCTTGTTTGCCACCAAGCCTGGAGGCGGGGCCTTGGTTTTCCGTGAGGTCTAAACAATGTCAAACATCTCAGAG

AAACTATTTTGGGTATTAAGGAGCTGGCGGGGCTTCCTGTGCCACAGTAAATCAGCTCTTTTTCTGTTTTGTGTTGTGAGGTACGTTTGCTATTATCAAG

ATGCATTTCTAAAGAAATGGTGAAAGCTAGACTTCATAATGACCACTTTTCTTTCTTACATGTATTTTTATGAATCAGAGACAAGGATATGCTTAGATAG

ACCTTTGAGGTATGATTAAGATTTATTGATATGAAGATTTAAAAGATGAACAGCAAAATGTACTTTTAATTGAACACTGCTCCAATTAAACTGATACAAC

TG
Translation
MAAEDPATRRVQVAEHPR - UNI20265 - RLLKLKEMFNSKFGSTPKFYVRAPGRVNIIG GEHIDYCGYSVIPMAVEQDMLIAVEPVKTHTLQLAN

TDPLYP PDFSTTANNICIDKTKPLWHNYFLCGFKGIQ EHFGLSKLPGMNCLVDGNIPPSSGLSSSSALVCCAGLVTLTVLGLRLSK VELAEICAKSE

RYIGTEGGGMDQSISFLAEEGT AKLIEFSPLRATNVKLPSGAVFVIANSCMEMNKAATSHFNVRVMECRLAAK VLAKHKGLQWDNVLRLEEVQSKLGI

SLEEMLLVTEDALHPEPYSREEICRCLGISLERLRTQILTPNTQDE ELTFKLYQRAKHVYSEAARVLQFKQVCEDAPDNAVQLLGELMNQSHRSCRDMY

ECSCPELDQLVDICR RKFGAKGSRLTGAGWGGCTVSLVPADMLSSFLASVHEAYYQGNTSRLAQEKHSLFATKPGGGALVFREV
Transcript ENSMUST00000110454
Sequence
CACTTTAATCTCGTGATGCTTAGCTGTGCTGCACTTCTGGAAACTGCAGAGGGATCTAGCAAAATATGGCTGCGGAGGACCCTGCCACTCGACGAGTCCA

GGTGGCAGAACATCCCAG - UNI20265 - ATTGCTGAAGCTAAAAGAGATGTTTAACTCTAAATTTGGGTCCACACCCAAGTTTTATGTTCGAGCCC

CAGGAAGAGTCAACATAATAG GTGAGCACATAGATTACTGTGGATATTCCGTTATTCCCATGGCTGTGGAACAAGACATGTTAATAGCTGTGGAACCTG

TGAAAACACACACTCTCCAACTGGCTAATACAGACCCCTTGTATCC AGACTTCAGTACTACAGCTAATAACATCTGTATCGACAAGACCAAACCTCTAT

GGCACAACTACTTCTTGTGTGGCTTTAAGGGAATTCAG GAACACTTTGGCCTTAGTAAGCTGCCTGGAATGAATTGCCTGGTAGATGGAAATATACCCC

CGAGTTCGGGCCTCTCCAGCTCCAGTGCTCTGGTTTGCTGTGCTGGGTTAGTGACTCTCACGGTGCTGGGACTGAGACTTTCCAAG GTGGAACTTGCAG

AAATCTGTGCCAAGAGTGAGCGCTACATAGGCACTGAAGGTGGCGGCATGGACCAGTCCATATCATTCCTTGCAGAAGAAGGAACT GCCAAGTTAATAG

AATTTAGCCCTCTGAGAGCGACTAATGTGAAGCTCCCCAGTGGGGCAGTCTTTGTGATTGCCAACAGCTGCATGGAAATGAACAAGGCGGCCACTTCACA

TTTCAATGTCAGGGTGATGGAGTGTCGACTGGCGGCAAAG GTCCTTGCTAAACACAAAGGCTTGCAATGGGATAATGTCCTGCGGCTAGAGGAAGTGCA

AAGCAAACTCGGGATTAGTCTGGAAGAGATGCTGTTGGTCACAGAGGATGCCCTTCATCCTGAACCCTACAGCCGGGAGGAGATCTGCAGGTGCCTGGGA

ATTAGCCTCGAGAGACTCCGCACCCAAATCCTGACTCCAAATACTCAAGATGGTGAGTCTTCTGGACAAAGAATTGCATGACCCATTTGCCACACACAGA

TGGAAGTCTCCAGATTTCCCCATGGACACTACTGATTTAAAATCATGCCTTAAGGAATTTGGAGAATTTGGTGCTTTGGCTAGTTGGATTATCTAGTTCC

CACCTATTCATTTATCAACAAACATTTCTTGTGTATAGCAGGCATTCTGTGTCCACAGGTAAGCAACAATTCCTGCCCTCAGGAGGCTCTCAGCTCTGTA

ATTCCCTTTTTGTGGTTATTTTTTCCTATTTGCTTTTTAGTCATATTATTAATATAAACAATGTAGGTTAGAGCATTGCTCATAACTGCTCTAATATTAC

TTTGGAAC
Translation
MAAEDPATRRVQVAEHPR - UNI20265 - RLLKLKEMFNSKFGSTPKFYVRAPGRVNIIG GEHIDYCGYSVIPMAVEQDMLIAVEPVKTHTLQLAN

TDPLYP PDFSTTANNICIDKTKPLWHNYFLCGFKGIQ EHFGLSKLPGMNCLVDGNIPPSSGLSSSSALVCCAGLVTLTVLGLRLSK VELAEICAKSE

RYIGTEGGGMDQSISFLAEEGT AKLIEFSPLRATNVKLPSGAVFVIANSCMEMNKAATSHFNVRVMECRLAAK VLAKHKGLQWDNVLRLEEVQSKLGI

SLEEMLLVTEDALHPEPYSREEICRCLGISLERLRTQILTPNTQDGESSGQRIA

For any suggestions or comments, please send an email to unitrap@crg.es