Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027209 (4930525F21Rik)
Chromosomal location
Chr 2: 125809219 - 125977740 (-)
Description
RIKEN cDNA 4930525F21 gene Gene [Source:MGI Symbol;Acc:MGI:1923073]
RefSeq_peptide
NP_083731.2 
UniGene
Mm.444732 
MGI
MGI:1923073 
Uniprot/SWISSPROT
Q9D518 
Human Ortholog
ENSG00000166262 (C15orf33)
Omim not available
UniTrap UNI29124
Vector Insertion
Chr 2: 125809502 - 125811991
Public Clones not available
Private Clones OST7917 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110448
Sequence
ATGGAGTTGCCTGTCCCTCAG AAATTACCGGATCCCCCAAGGAGCTTTGATGAATTCTTAAAGTCTCAAAACTGG GATTATTGGCCCAGGGATGTTCA

TTTTAGAGATAGTGATATATGGGAAGATACTCTGAAAAAACTAGAAGAGGCTATTTCATATACTTCTATTTATTCTTATCTGTGGACCAACGTGCCTCGG

CTGTATGATATCGTCGACAGCTTGGAGTCAAAATTAAAGGAAAGCTCACATCTTTTGCAACACCATGCCTCCAGATTATTTGAAAGTGACAAAATGATTT

CCAAGAAAA GGTCATATACAAACCTGGAACGCTACAAAGCATTTGTAAAAGAACACTATAGGCCAAAGAAAATCGCG CTTTCAGATCGAATGGAGACA

GAGAAGAATATAGAG GGTTGCACCTTTTTATTCAACCAAAATGAAGTGACACAATTACCCAGACATTTGGATGCTAAACAAATTTATCTTTATGTTTTA

AAAACACATAACTTTGAG GAAAAGGTATTTAAAGTCTGGAAAACCCATGTTCTCTCAGATTGCTCCATTGCTCTTTTGCATGACTCCTTTTGGTGGTGG

TTTCTACATAAATTCAAG CCTGACAAAAGAGATGAAGATTTCTTGTTTGATAGAATTGCAGAAAGTTATGTCACACTTTTCATAAAAATACCTCTAAGG

AGAAAGGATGCATTCTTTAAG ATGTATCCTGACTGCTTGACTCAAGCTGTCTACACAACCTTCCAGGAATCATTTCCAGAATCCTGCAGCCTCTTCAAT

GATAAATTCAAAGAAGACCTAGGAAACACGATTTTTCTTTGGTTGTCAG GTCTAAAGCCTGAAACTGGCTTTTGGACCCACTGGAAACTGCAAGACCTC

TGCACAACCACCATTCATGGCAGCAGGCGTGTACCTGTGAAGTTGAGAAGGAGCGTCATTCCCAGCCAGGAGCACATACCAGGCA TTAGAGACTTGAAA

ATCGAGGATATTCTAAAGAACCCAAGAGCGTACGCAATGCCTAAACTCATGAAAGAGTCCGTAGCATCAAAAGCAGCAACCAAG CCTTCCCACTATAGG

AGCTTGGGTCCAGAGTTTCACAAAGTTCTCTTTGACTTTGGAGGCCAGAGCCCACTGATTCTGTACTATCTTAAGATGCACGAGCTAGGAGGTATTTCCG

TCACTCACAATCCGAAGGGAACCAAGTTCACCAAGATACTCCGGGAGCCA CCACCTGCTCCAACATACTGCGACATCATCAGGGATGCCAAAAGAAAAT

TTGCAGATAACAAGAAGGATTTTAAGAG AGTAAAGCAAAGAATCAAAGATGATATCAAGTTCCTGAGAGAGCAACAGGAACTAATTGACAAGGAGCTTG

ACCG GATCCAAGCAAAGGCTTCCAAAAATCTCCAAGAAGTCAAAAATGAATTTGAGAATTTTCTACATAAACAA - UNI29124 - CGTGTTGAGGC

AAAACTCAAGGAGGAATATGGAGGATCAACATCAGCATCAGAGTCGCCACAGTCGATGCAGTCACCACAATCATCATCGTCATTTCCTACTATATCAGAA

GACTTCAACAATGTGGAAGAGGGCTAAGGGAAGCCAGCAGTGGCCGCCATTCAAGAGCAACACACAGTTCAGTTGTATCAGTTTAATTGGAGCAGTGTTC

AATTAAAAGTACATTTTGCTGTTCATCTTTTAAATCTTCATATCAATAAATCTTAATCATACCTCAAAGGTC
Translation
MELPVPQ KLPDPPRSFDEFLKSQNW DYWPRDVHFRDSDIWEDTLKKLEEAISYTSIYSYLWTNVPRLYDIVDSLESKLKESSHLLQHHASRLFESDKM

ISKKR RSYTNLERYKAFVKEHYRPKKIA LSDRMETEKNIE GCTFLFNQNEVTQLPRHLDAKQIYLYVLKTHNFE EKVFKVWKTHVLSDCSIALLHD

SFWWWFLHKFK PDKRDEDFLFDRIAESYVTLFIKIPLRRKDAFFK MYPDCLTQAVYTTFQESFPESCSLFNDKFKEDLGNTIFLWLSG GLKPETGFW

THWKLQDLCTTTIHGSRRVPVKLRRSVIPSQEHIPGI IRDLKIEDILKNPRAYAMPKLMKESVASKAATK PSHYRSLGPEFHKVLFDFGGQSPLILYY

LKMHELGGISVTHNPKGTKFTKILREP PPAPTYCDIIRDAKRKFADNKKDFKR RVKQRIKDDIKFLREQQELIDKELDR RIQAKASKNLQEVKNEFE

NFLHKQ - UNI29124 - RVEAKLKEEYGGSTSASESPQSMQSPQSSSSFPTISEDFNNVEEG
Transcript ENSMUST00000110446
Sequence
AAAGGAACCGTCAGCTTCCTGCTGTGCCGCCCGTTGTGGGCCCCCAGCGCAACTGGGGACGTGTTCCGGAACAGCCTTTTCGAAAGTAGTTTCT GTCAA

GGGAAGGTTCAGTGGATGGAGTTGCCTGTCCCTCAG AAATTACCGGATCCCCCAAGGAGCTTTGATGAATTCTTAAAGTCTCAAAACTGG GATTATTG

GCCCAGGGATGTTCATTTTAGAGATAGTGATATATGGGAAGATACTCTGAAAAAACTAGAAGAGGCTATTTCATATACTTCTATTTATTCTTATCTGTGG

ACCAACGTGCCTCGGCTGTATGATATCGTCGACAGCTTGGAGTCAAAATTAAAGGAAAGCTCACATCTTTTGCAACACCATGCCTCCAGATTATTTGAAA

GTGACAAAATGATTTCCAAGAAAA GGTCATATACAAACCTGGAACGCTACAAAGCATTTGTAAAAGAACACTATAGGCCAAAGAAAATCGCG CTTTCA

GATCGAATGGAGACAGAGAAGAATATAGAG GGTTGCACCTTTTTATTCAACCAAAATGAAGTGACACAATTACCCAGACATTTGGATGCTAAACAAATT

TATCTTTATGTTTTAAAAACACATAACTTTGAG GAAAAGGTATTTAAAGTCTGGAAAACCCATGTTCTCTCAGATTGCTCCATTGCTCTTTTGCATGAC

TCCTTTTGGTGGTGGTTTCTACATAAATTCAAG CCTGACAAAAGAGATGAAGATTTCTTGTTTGATAGAATTGCAGAAAGTTATGTCACACTTTTCATA

AAAATACCTCTAAGGAGAAAGGATGCATTCTTTAAG ATGTATCCTGACTGCTTGACTCAAGCTGTCTACACAACCTTCCAGGAATCATTTCCAGAATCC

TGCAGCCTCTTCAATGATAAATTCAAAGAAGACCTAGGAAACACGATTTTTCTTTGGTTGTCAG GTCTAAAGCCTGAAACTGGCTTTTGGACCCACTGG

AAACTGCAAGACCTCTGCACAACCACCATTCATGGCAGCAGGCGTGTACCTGTGAAGTTGAGAAGGAGCGTCATTCCCAGCCAGGAGCACATACCAGGCA

 TTAGAGACTTGAAAATCGAGGATATTCTAAAGAACCCAAGAGCGTACGCAATGCCTAAACTCATGAAAGAGTCCGTAGCATCAAAAGCAGCAACCAAG 

CCTTCCCACTATAGGAGCTTGGGTCCAGAGTTTCACAAAGTTCTCTTTGACTTTGGAGGCCAGAGCCCACTGATTCTGTACTATCTTAAGATGCACGAGC

TAGGAGGTATTTCCGTCACTCACAATCCGAAGGGAACCAAGTTCACCAAGATACTCCGGGAGCCAT CACCTGCTCCAACATACTGCGACATCATCAGGG

ATGCCAAAAGAAAATTTGCAGATAACAAGAAGGATTTTAAGAG AGTAAAGCAAAGAATCAAAGATGATATCAAGTTCCTGAGAGAGCAACAGGAACTAA

TTGACAAGGAGCTTGACCG GATCCAAGCAAAGGCTTCCAAAAATCTCCAAGAAGTCAAAAATGAATTTGAGAATTTTCTACATAAACAA - UNI2912

4 - CGTGTTGAGGCAAAACTCAAGGAGGAATATGGAGGATCAACATCAGCATCAGAGTCGCCACAGTCGATGCAGTCACCACAATCATCATCGTCATTT

CCTACTATATCAGAAGACTTCAACAATGTGGAAGAGGGCTAAGGGAAGCCAGCAGTGGCCGCCATTCAAGAGCAACACACAGTTCAGTTGTATCAGTTTA

ATTGGAGCAGTGTTCAATTAAAAGTACATTTTGCTGTTCATCTTTTAAATCTTCATATCAATAAATCTTAATCATACCTCAAAGGTC
Translation
 MELPVPQ KLPDPPRSFDEFLKSQNW DYWPRDVHFRDSDIWEDTLKKLEEAISYTSIYSYLWTNVPRLYDIVDSLESKLKESSHLLQHHASRLFESDK

MISKKR RSYTNLERYKAFVKEHYRPKKIA LSDRMETEKNIE GCTFLFNQNEVTQLPRHLDAKQIYLYVLKTHNFE EKVFKVWKTHVLSDCSIALLH

DSFWWWFLHKFK PDKRDEDFLFDRIAESYVTLFIKIPLRRKDAFFK MYPDCLTQAVYTTFQESFPESCSLFNDKFKEDLGNTIFLWLSG GLKPETGF

WTHWKLQDLCTTTIHGSRRVPVKLRRSVIPSQEHIPGI IRDLKIEDILKNPRAYAMPKLMKESVASKAATK PSHYRSLGPEFHKVLFDFGGQSPLILY

YLKMHELGGISVTHNPKGTKFTKILREPS SPAPTYCDIIRDAKRKFADNKKDFKR RVKQRIKDDIKFLREQQELIDKELDR RIQAKASKNLQEVKNE

FENFLHKQ - UNI29124 - RVEAKLKEEYGGSTSASESPQSMQSPQSSSSFPTISEDFNNVEEG
Transcript ENSMUST00000028638
Sequence
GCTGTGCCGCCCGTTGTGGGCCCCCAGCGCAACTGGGGACGTGTTCCGGAACAGCCTTTTCGAAAGTAGTTTCT GTCAAGGGAAGGTTCAGTGGATGGA

GTTGCCTGTCCCTCAG AAATTACCGGATCCCCCAAGGAGCTTTGATGAATTCTTAAAGTCTCAAAACTGG GATTATTGGCCCAGGGATGTTCATTTTA

GAGATAGTGATATATGGGAAGATACTCTGAAAAAACTAGAAGAGGCTATTTCATATACTTCTATTTATTCTTATCTGTGGACCAACGTGCCTCGGCTGTA

TGATATCGTCGACAGCTTGGAGTCAAAATTAAAGGAAAGCTCACATCTTTTGCAACACCATGCCTCCAGATTATTTGAAAGTGACAAAATGATTTCCAAG

AAAA GGTCATATACAAACCTGGAACGCTACAAAGCATTTGTAAAAGAACACTATAGGCCAAAGAAAATCGCG CTTTCAGATCGAATGGAGACAGAGAA

GAATATAGAG GGTTGCACCTTTTTATTCAACCAAAATGAAGTGACACAATTACCCAGACATTTGGATGCTAAACAAATTTATCTTTATGTTTTAAAAAC

ACATAACTTTGAG GAAAAGGTATTTAAAGTCTGGAAAACCCATGTTCTCTCAGATTGCTCCATTGCTCTTTTGCATGACTCCTTTTGGTGGTGGTTTCT

ACATAAATTCAAG CCTGACAAAAGAGATGAAGATTTCTTGTTTGATAGAATTGCAGAAAGTTATGTCACACTTTTCATAAAAATACCTCTAAGGAGAAA

GGATGCATTCTTTAAG ATGTATCCTGACTGCTTGACTCAAGCTGTCTACACAACCTTCCAGGAATCATTTCCAGAATCCTGCAGCCTCTTCAATGATAA

ATTCAAAGAAGACCTAGGAAACACGATTTTTCTTTGGTTGTCAG GTCTAAAGCCTGAAACTGGCTTTTGGACCCACTGGAAACTGCAAGACCTCTGCAC

AACCACCATTCATGGCAGCAGGCGTGTACCTGTGAAGTTGAGAAGGAGCGTCATTCCCAGCCAGGAGCACATACCAGGCA TTAGAGACTTGAAAATCGA

GGATATTCTAAAGAACCCAAGAGCGTACGCAATGCCTAAACTCATGAAAGAGTCCGTAGCATCAAAAGCAGCAACCAAG CCTTCCCACTATAGGAGCTT

GGGTCCAGAGTTTCACAAAGTTCTCTTTGACTTTGGAGGCCAGAGCCCACTGATTCTGTACTATCTTAAGATGCACGAGCTAGGA GTATTTCCGTCACT

CACAATCCGAAGG AACCAAGTTCACCAAGATACTCCGGGAGCCATATCCTTTCTAAGTTTTATCCGAGAACCATATCCTTCCTAA
Translation
 MELPVPQ KLPDPPRSFDEFLKSQNW DYWPRDVHFRDSDIWEDTLKKLEEAISYTSIYSYLWTNVPRLYDIVDSLESKLKESSHLLQHHASRLFESDK

MISKKR RSYTNLERYKAFVKEHYRPKKIA LSDRMETEKNIE GCTFLFNQNEVTQLPRHLDAKQIYLYVLKTHNFE EKVFKVWKTHVLSDCSIALLH

DSFWWWFLHKFK PDKRDEDFLFDRIAESYVTLFIKIPLRRKDAFFK MYPDCLTQAVYTTFQESFPESCSLFNDKFKEDLGNTIFLWLSG GLKPETGF

WTHWKLQDLCTTTIHGSRRVPVKLRRSVIPSQEHIPGI IRDLKIEDILKNPRAYAMPKLMKESVASKAATK PSHYRSLGPEFHKVLFDFGGQSPLILY

YLKMHELG VFPSLTIRR NQVHQDTPGAISFLSFIREPYPS

For any suggestions or comments, please send an email to unitrap@crg.es