Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027238 (Frmd5)
Chromosomal location
Chr 2: 121371267 - 121632728 (-)
Description
FERM domain containing 5 Gene [Source:MGI (curated);Acc:Frmd5-001]
RefSeq_dna
NM_172673 
RefSeq_peptide
NP_766261.2 
UniGene
Mm.121514 Mm.408492 
MGI
MGI:2442557 
Uniprot/SWISSPROT
Q6P5H6 
Uniprot/SPTREMBL
A2ASR2 A2AR55 B0R0D4 B0R0D5 Q8BW31 Q8BX61 A2AR56 A2ASR3 B0R0I9 Q8BXT6 
Human Ortholog
ENSG00000171877 (FRMD5)
Omim not available
UniTrap UNI4526
Vector Insertion
Chr 2: 121632465 - 121632568
Public Clones CC0663 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32275
Vector Insertion
Chr 2: 121612997 - 121632568
Public Clones IST12688G3 (tigm) IST14608C6 (tigm) IST12688G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17846
Vector Insertion
Chr 2: 121417499 - 121590766
Public Clones (sanger) E048E06 (ggtc) IST11592F9 (tigm) IST14623E9 (tigm) IST12866H1 (tigm)
IST10246C5 (tigm) IST14765H5 (tigm)
Private Clones OST435036 (lexicon) OST431367 (lexicon) OST431213 (lexicon) OST402557 (lexicon)
OST390703 (lexicon) OST319383 (lexicon) OST309055 (lexicon) OST300888 (lexicon)
OST296477 (lexicon) OST257846 (lexicon) OST234501 (lexicon) OST181806 (lexicon)
OST174438 (lexicon) OST116445 (lexicon) OST66995 (lexicon) OST60828 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25478
Vector Insertion
Chr 2: 121412164 - 121412208
Public Clones not available
Private Clones OST182391 (lexicon) OST23305 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19417
Vector Insertion
Chr 2: 121411721 - 121412164
Public Clones not available
Private Clones OST391497 (lexicon) OST98953 (lexicon) OST67018 (lexicon) OST60829 (lexicon)
OST51733 (lexicon) OST5888 (lexicon) OST1173 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16371
Vector Insertion
Chr 2: 121402156 - 121411641
Public Clones not available
Private Clones OST462120 (lexicon) OST15928 (lexicon) OST7348 (lexicon) OST5633 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17138
Vector Insertion
Chr 2: 121399405 - 121402057
Public Clones not available
Private Clones OST448699 (lexicon) OST351680 (lexicon) OST293155 (lexicon) OST252093 (lexicon)
OST141774 (lexicon) OST116734 (lexicon) OST40383 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000077436
Sequence
ACATTCCATGGACGCTTCGGAGGCCTGAAGGAAAGCCATAGACAAAACGCTGAG - UNI17846 - AGAGATGCCAAAGGCCAGTACCTGTTTGACCT

CCTTTGCCACCACCTGAACCTACTTGAGAAAGACTACTTTGGGATTCGTTTTGTGGACCCAGATAAGCAGCGG - UNI25478 - CATTGGTTGGAGT

TTACAAAGTCAGTGGTGAAGCAGCTGAGAT - UNI19417 - - UNI25478 - CCCAGCCTCCGTTCACCATGTGCTTCCGCGTGAAGTTTTACCC

TGCCGACCCCGCTGCCCTGAAAGAGGAAATAACCAG - UNI16371 - GTACTTAGTCTTCCTTCAGATCAAAAGGGATCTCTACCACGGCCGTCTTC

TCTGTAAAACATCGGATGCCGCCTTGTTAGCGGCCTATATCCTTCAAG - UNI17138 - CGGAGATTGGGGATTATGACCCGGGAAAGCACCCTGAA

GGCTACAGCTCCAAGTTCCAATTTTTCCCGAAACATTCAGAGAAACTGGAAAAGAAAATTGCTGAGATTCACAAGACCGAACTCAG TGGTCAAACACCA

GCAACATCAGAGCTGAATTTCTTAAGAAAGGCCCAGACGTTAGAGACCTACGGAGTGGACCCTCACCCATGTAAG GATGTGTCGGGAAATGCTGCGTTT

CTGGCCTTCACTCCTTTCGGGTTTGTTGTTCTTCAAGGAAACAAGAGGGTCCACTTCATTAAATG GAATGAGGTGACCAAGCTGAAATTTGAAGGAAAG

ACTTTCTATTTATATGTAAGTCAGAAAGAG GAAAAAAAGATTATTCTCACATATTTTGCCCCAACTCCAGAAGCCTGCAAGCACCTCTGGAAATGTGGA

ATTGAGAACCAAGCCTTCTACAA GCTGGAAAAGTCAAGCCAAGTCCGCACAGTGTCCAGCAGCAATTTGTTCTTTAAGGGGAGCCGGTTCCGATACAG 

TGGCCGGGTCGCAAAGGAAGTAATGGAGTCCAGTGCCAAGATCAAACGGGAGCCGCCAGAAATACACAG AGCAGGGATGGTCCCTAGCCGCAGCTGTCC

TTCTATAACCCATGGCCCACGACTGAGCAGCGTCCCCAGGACACGAAGAAGAGCTGTGCACATCTCTATCATGGAAG GCCTTGAGTCGCTACGAGACAG

TGCCCATTCCACCCCAGTGCGGTCCTCTTCCCATGGGGACACCTTCCTGCCTCACGTGAGAAGCAGCCGGGCAGACAGCAATGAACGTGTCGCTGTGATA

GCGGATGAGGCCTACAGCCCCGCAGACAGTGTGCTGCCCACCCCTGTAGCCGAGCACAGCCTGGAGCTGATGCTGCTCTCCCGGCAGATCAACGGGGCCA

CGTGCAGCATTGAGGAGGAGAAGGAGTCGGAGGCCAGCACCCCGACTGCGACAGAGGCGGAGGCCCTGGGAGGAGAGCTGAGGGCCCTGTGTCAGGGGCA

CGGCGGGTCAGAGCAAGAACAG AGAGTGCATCTGAAGGGACCACAGCTACAGCAGCAGCAGTGGAAGGGGTGGG AACCTCAAGACTTTTAG
Translation
 - UNI17846 -  - UNI25478 -  - UNI19417 - - UNI25478 - MCFRVKFYPADPAALKEEITR - UNI16371 - RYLVFLQIKR

DLYHGRLLCKTSDAALLAAYILQA - UNI17138 - AEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELS SGQTPATSELNFLRKAQTL

ETYGVDPHPCK DVSGNAAFLAFTPFGFVVLQGNKRVHFIKW WNEVTKLKFEGKTFYLYVSQKE EKKIILTYFAPTPEACKHLWKCGIENQAFYK KL

EKSSQVRTVSSSNLFFKGSRFRYS SGRVAKEVMESSAKIKREPPEIHR RAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEG GLESLRDSAHST

PVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEAEALGGELRALCQGHGGSE

QEQ RVHLKGPQLQQQQWKGWE EPQDF
Transcript ENSMUST00000110593
Sequence
ATGCTGAGCAGGTTGATGAGCGGCAGCAGCAGGAGTCTGGAGCGCGAGTACAGCTGCACCGTGCGGCTGCTGGACGACAGCGAGTACACCTGCACCATCC

AG - UNI4526 - - UNI17846 - - UNI32275 - AGAGATGCCAAAGGCCAGTACCTGTTTGACCTCCTTTGCCACCACCTGAACCTACTTGA

GAAAGACTACTTTGGGATTCGTTTTGTGGACCCAGATAAGCAGCGG - UNI25478 - CATTGGTTGGAGTTTACAAAGTCAGTGGTGAAGCAGCTGA

GAT - UNI19417 - - UNI25478 - CCCAGCCTCCGTTCACCATGTGCTTCCGCGTGAAGTTTTACCCTGCCGACCCCGCTGCCCTGAAAGAGGA

AATAACCAG - UNI16371 - GTACTTAGTCTTCCTTCAGATCAAAAGGGATCTCTACCACGGCCGTCTTCTCTGTAAAACATCGGATGCCGCCTTGT

TAGCGGCCTATATCCTTCAAG - UNI17138 - CGGAGATTGGGGATTATGACCCGGGAAAGCACCCTGAAGGCTACAGCTCCAAGTTCCAATTTTTC

CCGAAACATTCAGAGAAACTGGAAAAGAAAATTGCTGAGATTCACAAGACCGAACTCAG TGGTCAAACACCAGCAACATCAGAGCTGAATTTCTTAAGA

AAGGCCCAGACGTTAGAGACCTACGGAGTGGACCCTCACCCATGTAAG GATGTGTCGGGAAATGCTGCGTTTCTGGCCTTCACTCCTTTCGGGTTTGTT

GTTCTTCAAGGAAACAAGAGGGTCCACTTCATTAAATG GAATGAGGTGACCAAGCTGAAATTTGAAGGAAAGACTTTCTATTTATATGTAAGTCAGAAA

GAG GAAAAAAAGATTATTCTCACATATTTTGCCCCAACTCCAGAAGCCTGCAAGCACCTCTGGAAATGTGGAATTGAGAACCAAGCCTTCTACAA GCT

GGAAAAGTCAAGCCAAGTCCGCACAGTGTCCAGCAGCAATTTGTTCTTTAAGGGGAGCCGGTTCCGATACAG TGGCCGGGTCGCAAAGGAAGTAATGGA

GTCCAGTGCCAAGATCAAACGGGAGCCGCCAGAAATACACAG AGCAGGGATGGTCCCTAGCCGCAGCTGTCCTTCTATAACCCATGGCCCACGACTGAG

CAGCGTCCCCAGGACACGAAGAAGAGCTGTGCACATCTCTATCATGGAAG GCCTTGAGTCGCTACGAGACAGTGCCCATTCCACCCCAGTGCGGTCCTC

TTCCCATGGGGACACCTTCCTGCCTCACGTGAGAAGCAGCCGGGCAGACAGCAATGAACGTGTCGCTGTGATAGCGGATGAGGCCTACAGCCCCGCAGAC

AGTGTGCTGCCCACCCCTGTAGCCGAGCACAGCCTGGAGCTGATGCTGCTCTCCCGGCAGATCAACGGGGCCACGTGCAGCATTGAGGAGGAGAAGGAGT

CGGAGGCCAGCACCCCGACTGCGACAGAGGCGGAGGCCCTGGGAGGAGAGCTGAGGGCCCTGTGTCAGGGGCACGGCGGGTCAGAGCAAGAACAG AGAG

TGCATCTGAAGGGACCACAGCTACAGCAGCAGCAGTGGAAGGGGTGGGGTAAGTCTGTCCCCTTAGACTAGAGCCTAGTGAACACCTGAGTTGTATTTAA

TGTTTTGCTTTTCTTTCTGAAGAACCTCAAGACTTTTAGTGCTTCTGGGGTGTCAAAGTGGTGCCAGAGTGTGCGGTCAGAGATGTCCCACAGCACAGTT

ACCAGAGACCTGTGCTGAGTCACACGAGAGCCTGCAGAGCCGCAGGGAGCTGTGCTTGTCTTGTTACAGTATGCCCCTCCCCCCAAAAAAGACTATTTCA

AGCTCTATTTTAACAGCAAAATGTTATTTTCCTATCTATTCCTATTTTGTTTTCACTTTATGAATCAAAAGATGCAAGAGAGAGACAGATCTGAGGAAGG

CATCGAGAAGGAGCAGCGGCCTTGGAAGGGACCAGGAAGCACTAAGCAGGACCTCTAAGCAATGCCTACAGGTGACAGAATTTGACCATGGCAGAGACCA

GCACTTACTATAGGAATGCCACCCTTAGGGTCAACCCCTGCTCCTGGAAACAAGGTCTAAGAGCACTTAGTGTCGTCCCTCACAGCAGCATACGTGTACA

CACACACACACACACACACACACACACACACACACGCACGAGCTGCAGTCCCTAAGCCTCTACACTTCTTACCACCAATAACACACAAGAGCATGTTTTC

ATCTCAGGGAGACCGCAAGTCATCTGAGGCCCAAGGACTCACGTAAAGGACAGTCAAAGGGCACACTCCTGGGACCAGAAAACAGTGGAGCGGAGCAGCC

CCAACAGATTGGGCGGTAGAATATTTGAGCTTCCCTTATTTGTTGCCTGGGGTAGAACCATGTCCACATTCAGAATATGACAGCCATTAAAAGCAACAAC

AACACCCAAAAACAAACAAATGGGGTTTTGAAGATGCTGGGAGGGCATTTACATAATTTTAAAGAAAGATGACATCCTTATCTAGACCAGAGGTCAACAA

ACCTCTTTTAATAAAATTTTGATTTTGTGGACCATGCTCTGCCACCCTAGCACGCCTCTGATAATGCATGCATAGAAGAACATGGCTTGCTCTGAGAAAA

TTTTATAAAAACATAGGGCTGAGGATGTGTAGCTCAGAGGGTAAAGTATTTTTCTAACATGTATAAGGCCCTGGATTTGACTTCAAACAATACACAAAAC

CAGGTGTGGTAGCATATACCCGTGGTCCCAGCATTCAGCAGGGAGACGGGAAGATCAGAAGTTCAAGGCAATCCTCAGTCAGTGAGTTAATCCCAGTCTG

GGATACATGAGGTGTCTCAGACCACCGGCTTCCCACTCCCTAAAAACAAACCTAAATCTGCAATATGCTGAGAGACTGGTCCCCAGCAGTACGATGCAAA

CCCTGGTCTACACAGGGCCAGCTTCCATTGCTGTTTTGTGTAAGCTACCCAGAACCATTTCCCAATGGGCAGGGTGCTCCAACAACCAACCAGCAGTGAT

GTGTGTCATCTGATACCAAGATCAAGAAGTACTGCCACTGTGAACAGCGGTGACACTATGAACGGGTCCAGGCCTATCTGATCATTTCCGTACCAGCAAC

AATTTGTGTGAGATCTAAAACATATACCACATGACAAGACAAACTGAGGGGATCCTAGTAAAGACCAGAGGTTACTTAAAAGCAATGAGCCACTGCTGCT

TGTCAACTGCATAACCAAGGTGTGTACTCAGCACAGGACTGACAGCAAAGGCTACTGGGAAACAGGGCTGTGTGAACTGGGATTTCTATTCTTATGCAAC

ATAGCAGATTGCCTTCTAGAGTGGTGCTCCTACCTCAGTCTGTAGAACACAGTGTCTATGCAGTGAGTGGTAGTCTCGCCTCTGACCTTTCATAGCCTCG

AGAGAGGCAGCCTGCCATTGCCTGGTGTGTTTCTTGTGTCTAGAGTCCTAACAGTGCTGCGATCCGTGCCATTTCCAACATCTGACCCAGAATCTTCAGG

TCATTTTCTCCCTCAAGGCTTAGCCCAGAAAATAAGGACAGAAAAGGCTCCCTTCGATTCGGTTTCCAAATAGTTTTCAATAGTTCAGTAACAAACCCCC

TTTACTGGTGACTAGTGTTTTTCATCATTTCCCCATCATTACAAAAGTTTCTGTTTTCGTCTGGTTTTGCCGTATTCTGTGTCTCTTCTTTCCTCTCAGA

ATTATTGATCTCACTGTAGAAAAGCAGATCTGCCTAGCATTATTGATCAGAGGAAATACTTACTGAATAGTGGACTGCATCTTTAAGCAGTAGAGGATAA

ACTACCTACAAATGTGAATTTCTTAGTTTCACTTAAAAGTATACACCTGTTAACCTTTCGTGTGCCAAATCTAAGTTACGTTTTCCTTCAAAGCAATGTA

CTCTTTTCTACATATGTAGTATGTAGTTAGCATAAAATCATTGGTGCCATGAAGATTATTTTTAAATCCAATAAATATTTAAATACCGT
Translation
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQ - UNI4526 - - UNI17846 - - UNI32275 - RDAKGQYLFDLLCHHLNLLEKDYFGIR

FVDPDKQR - UNI25478 - HWLEFTKSVVKQLRS - UNI19417 - - UNI25478 - SQPPFTMCFRVKFYPADPAALKEEITR - UNI163

71 - RYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQA - UNI17138 - AEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELS SGQT

PATSELNFLRKAQTLETYGVDPHPCK DVSGNAAFLAFTPFGFVVLQGNKRVHFIKW WNEVTKLKFEGKTFYLYVSQKE EKKIILTYFAPTPEACKHL

WKCGIENQAFYK KLEKSSQVRTVSSSNLFFKGSRFRYS SGRVAKEVMESSAKIKREPPEIHR RAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIM

EG GLESLRDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEAEAL

GGELRALCQGHGGSEQEQ RVHLKGPQLQQQQWKGWGKSVPLD
Transcript ENSMUST00000110592
Sequence
AAGGAAGAAGAGTGGGGCGGGAGGAAGCAGCGGTGGCGATCCGGTCAGGGTGATGGTGCAGGTGCTAAGGGCCGGCGCGGAGCTGCCGCGCTGAGGGGCG

ACGGGTCCGGAGTCCGCAGCGCCGCCGCGTCGCTCCCGAGGACGGGCGAGCGGGCGGGAAGATGCTGAGCAGGTTGATGAGCGGCAGCAGCAGGAGTCTG

GAGCGCGAGTACAGCTGCACCGTGCGGCTGCTGGACGACAGCGAGTACACCTGCACCATCCAG - UNI4526 - - UNI17846 - - UNI32275 

- AGAGATGCCAAAGGCCAGTACCTGTTTGACCTCCTTTGCCACCACCTGAACCTACTTGAGAAAGACTACTTTGGGATTCGTTTTGTGGACCCAGATAA

GCAGCGG - UNI25478 - CATTGGTTGGAGTTTACAAAGTCAGTGGTGAAGCAGCTGAGAT - UNI19417 - - UNI25478 - CCCAGCCTC

CGTTCACCATGTGCTTCCGCGTGAAGTTTTACCCTGCCGACCCCGCTGCCCTGAAAGAGGAAATAACCAG - UNI16371 - GTACTTAGTCTTCCTT

CAGATCAAAAGGGATCTCTACCACGGCCGTCTTCTCTGTAAAACATCGGATGCCGCCTTGTTAGCGGCCTATATCCTTCAAG - UNI17138 - CGGA

GATTGGGGATTATGACCCGGGAAAGCACCCTGAAGGCTACAGCTCCAAGTTCCAATTTTTCCCGAAACATTCAGAGAAACTGGAAAAGAAAATTGCTGAG

ATTCACAAGACCGAACTCAG TGGTCAAACACCAGCAACATCAGAGCTGAATTTCTTAAGAAAGGCCCAGACGTTAGAGACCTACGGAGTGGACCCTCAC

CCATGTAAG GATGTGTCGGGAAATGCTGCGTTTCTGGCCTTCACTCCTTTCGGGTTTGTTGTTCTTCAAGGAAACAAGAGGGTCCACTTCATTAAATG 

GAATGAGGTGACCAAGCTGAAATTTGAAGGAAAGACTTTCTATTTATATGTAAGTCAGAAAGAG GAAAAAAAGATTATTCTCACATATTTTGCCCCAAC

TCCAGAAGCCTGCAAGCACCTCTGGAAATGTGGAATTGAGAACCAAGCCTTCTACAA GCTGGAAAAGTCAAGCCAAGTCCGCACAGTGTCCAGCAGCAA

TTTGTTCTTTAAGGGGAGCCGGTTCCGATACAG TGGCCGGGTCGCAAAGGAAGTAATGGAGTCCAGTGCCAAGATCAAACGGGAGCCGCCAGAAATACA

CAG AGCAGGGATGGTCCCTAGCCGCAGCTGTCCTTCTATAACCCATGGCCCACGACTGAGCAGCGTCCCCAGGACACGAAGAAGAGCTGTGCACATCTC

TATCATGGAAG GCCTTGAGTCGCTACGAGACAGTGCCCATTCCACCCCAGTGCGGTCCTCTTCCCATGGGGACACCTTCCTGCCTCACGTGAGAAGCAG

CCGGGCAGACAGCAATGAACGTGTCGCTGTGATAGCGGATGAGGCCTACAGCCCCGCAGACAGTGTGCTGCCCACCCCTGTAGCCGAGCACAGCCTGGAG

CTGATGCTGCTCTCCCGGCAGATCAACGGGGCCACGTGCAGCATTGAGGAGGAGAAGGAGTCGGAGGCCAGCACCCCGACTGCGACAGAGGCGGAGGCCC

TGGGAGGAGAGCTGAGGGCCCTGTGTCAGGGGCACGGCGGGTCAGAGCAAGAACAGGTGAATAAGTTTGTTTTAAGTGTTCTCCGTTTGCTCCTTGTGAC

CATGGGACTCCTCTTTGTTTTGCTCCTCCTCCTGATCATCCTTACTGAGTCTGACCTTGACGTTGCTTTTTTCCGAGATATCCGCCAGACCCCCGAGTTT

GAACAATTCCACTATCAATACTTTTGTCCCCTCAGGCGATGGTTTGCCTGCAAAATCCGCTCAGTGGTGAGCCTGCTCATTGACACCTGAGAAGGCATGA

CTCCTCCCAATAACTAGCCGGGTGGACCAAGGAACCCGGCTACCCATTCCCAGCAATGGGACCCATCGCGGAACCATCGGCACACACACCAAGTCCTCTC

ATGACTCAAAGTCCACTGAGCCTAGCAGGGTTCTTTCCCAGCAGAAGAAAGGGATATAGGCTAATGCTCTGTAAACCGGGAACATTCAGTTTCTTCAGAG

GCTCTTCCGAGAAAGGCTCAGCAACTCAAATGTTTCTCATCCTTCAATATGCAGAATAATTTGGGGGTTTGAACTTTTAGTTTTTCATAGATGTGTATTA

TTTTGAAAGTATCCAAATAAAAGTCACTTATTTTACTA
Translation
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQ - UNI4526 - - UNI17846 - - UNI32275 - RDAKGQYLFDLLCHHLNLLEKDYFGIR

FVDPDKQR - UNI25478 - HWLEFTKSVVKQLRS - UNI19417 - - UNI25478 - SQPPFTMCFRVKFYPADPAALKEEITR - UNI163

71 - RYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQA - UNI17138 - AEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELS SGQT

PATSELNFLRKAQTLETYGVDPHPCK DVSGNAAFLAFTPFGFVVLQGNKRVHFIKW WNEVTKLKFEGKTFYLYVSQKE EKKIILTYFAPTPEACKHL

WKCGIENQAFYK KLEKSSQVRTVSSSNLFFKGSRFRYS SGRVAKEVMESSAKIKREPPEIHR RAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIM

EG GLESLRDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEAEAL

GGELRALCQGHGGSEQEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDVAFFRDIRQTPEFEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Transcript ENSMUST00000110591
Sequence
ACATTCCATGGACGCTTCGGAGGCCTGAAGGAAAGCCATAGACAAAACGCTGAG - UNI17846 - AGAGATGCCAAAGGCCAGTACCTGTTTGACCT

CCTTTGCCACCACCTGAACCTACTTGAGAAAGACTACTTTGGGATTCGTTTTGTGGACCCAGATAAGCAGCGG - UNI25478 - CATTGGTTGGAGT

TTACAAAGTCAGTGGTGAAGCAGCTGAGAT - UNI19417 - - UNI25478 - CCCAGCCTCCGTTCACCATGTGCTTCCGCGTGAAGTTTTACCC

TGCCGACCCCGCTGCCCTGAAAGAGGAAATAACCAG - UNI16371 - GTACTTAGTCTTCCTTCAGATCAAAAGGGATCTCTACCACGGCCGTCTTC

TCTGTAAAACATCGGATGCCGCCTTGTTAGCGGCCTATATCCTTCAAG - UNI17138 - CGGAGATTGGGGATTATGACCCGGGAAAGCACCCTGAA

GGCTACAGCTCCAAGTTCCAATTTTTCCCGAAACATTCAGAGAAACTGGAAAAGAAAATTGCTGAGATTCACAAGACCGAACTCAG TGGTCAAACACCA

GCAACATCAGAGCTGAATTTCTTAAGAAAGGCCCAGACGTTAGAGACCTACGGAGTGGACCCTCACCCATGTAAG GATGTGTCGGGAAATGCTGCGTTT

CTGGCCTTCACTCCTTTCGGGTTTGTTGTTCTTCAAGGAAACAAGAGGGTCCACTTCATTAAATG GAATGAGGTGACCAAGCTGAAATTTGAAGGAAAG

ACTTTCTATTTATATGTAAGTCAGAAAGAG GAAAAAAAGATTATTCTCACATATTTTGCCCCAACTCCAGAAGCCTGCAAGCACCTCTGGAAATGTGGA

ATTGAGAACCAAGCCTTCTACAA GCTGGAAAAGTCAAGCCAAGTCCGCACAGTGTCCAGCAGCAATTTGTTCTTTAAGGGGAGCCGGTTCCGATACAG 

TGGCCGGGTCGCAAAGGAAGTAATGGAGTCCAGTGCCAAGATCAAACGGGAGCCGCCAGAAATACACAG AGCAGGGATGGTCCCTAGCCGCAGCTGTCC

TTCTATAACCCATGGCCCACGACTGAGCAGCGTCCCCAGGACACGAAGAAGAGCTGTGCACATCTCTATCATGGAAG GCCTTGAGTCGCTACGAGACAG

TGCCCATTCCACCCCAGTGCGGTCCTCTTCCCATGGGGACACCTTCCTGCCTCACGTGAGAAGCAGCCGGGCAGACAGCAATGAACGTGTCGCTGTGATA

GCGGATGAGGCCTACAGCCCCGCAGACAGTGTGCTGCCCACCCCTGTAGCCGAGCACAGCCTGGAGCTGATGCTGCTCTCCCGGCAGATCAACGGGGCCA

CGTGCAGCATTGAGGAGGAGAAGGAGTCGGAGGCCAGCACCCCGACTGCGACAGAGGCGGAGGCCCTGGGAGGAGAGCTGAGGGCCCTGTGTCAGGGGCA

CGGCGGGTCAGAGCAAGAACAGGTGAATAAGTTTGTTTTAAGTGTTCTCCGTTTGCTCCTTGTGACCATGGGACTCCTCTTTGTTTTGCTCCTCCTCCTG

ATCATCCTTACTGAGTCTGACCTTGACGTTGCTTTTTTCCGAGATATCCGCCAGACCCCCGAGTTTGAACAATTCCACTATCAATACTTTTGTCCCCTCA

GGCGATGGTTTGCCTGCAAAATCCGCTCAGTGGTGAGCCTGCTCATTGACACCTGA
Translation
 - UNI17846 -  - UNI25478 -  - UNI19417 - - UNI25478 - MCFRVKFYPADPAALKEEITR - UNI16371 - RYLVFLQIKR

DLYHGRLLCKTSDAALLAAYILQA - UNI17138 - AEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELS SGQTPATSELNFLRKAQTL

ETYGVDPHPCK DVSGNAAFLAFTPFGFVVLQGNKRVHFIKW WNEVTKLKFEGKTFYLYVSQKE EKKIILTYFAPTPEACKHLWKCGIENQAFYK KL

EKSSQVRTVSSSNLFFKGSRFRYS SGRVAKEVMESSAKIKREPPEIHR RAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEG GLESLRDSAHST

PVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEAEALGGELRALCQGHGGSE

QEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDVAFFRDIRQTPEFEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Transcript ENSMUST00000121219
Sequence
GTGATCCAGCTCCTGGGTCCTACATGAAGTAGAGCCGTCAGTCCTTAGGAACTGCAACCCCAGAGACAGCTTCCTCGTCCTTG - UNI17846 - - U

NI32275 - AGAGATGCCAAAGGCCAGTACCTGTTTGACCTCCTTTGCCACCACCTGAACCTACTTGAGAAAGACTACTTTGGGATTCGTTTTGTGGAC

CCAGATAAGCAGCGG - UNI25478 - CATTGGTTGGAGTTTACAAAGTCAGTGGTGAAGCAGCTGAGAT - UNI19417 - - UNI25478 - C

CCAGCCTCCGTTCACCATGTGCTTCCGCGTGAAGTTTTACCCTGCCGACCCCGCTGCCCTGAAAGAGGAAATAACCAG - UNI16371 - GTACTTAG

TCTTCCTTCAGATCAAAAGGGATCTCTACCACGGCCGTCTTCTCTGTAAAACATCGGATGCCGCCTTGTTAGCGGCCTATATCCTTCAAG - UNI1713

8 - CGGAGATTGGGGATTATGACCCGGGAAAGCACCCTGAAGGCTACAGCTCCAAGTTCCAATTTTTCCCGAAACATTCAGAGAAACTGGAAAAGAAAA

TTGCTGAGATTCACAAGACCGAACTCAG TGGTCAAACACCAGCAACATCAGAGCTGAATTTCTTAAGAAAGGCCCAGACGTTAGAGACCTACGGAGTGG

ACCCTCACCCATGTAAG GATGTGTCGGGAAATGCTGCGTTTCTGGCCTTCACTCCTTTCGGGTTTGTTGTTCTTCAAGGAAACAAGAGGGTCCACTTCA

TTAAATG GAATGAGGTGACCAAGCTGAAATTTGAAGGAAAGACTTTCTATTTATATGTAAGTCAGAAAGAG GAAAAAAAGATTATTCTCACATATTTT

GCCCCAACTCCAGAAGCCTGCAAGCACCTCTGGAAATGTGGAATTGAGAACCAAGCCTTCTACAA GCTGGAAAAGTCAAGCCAAGTCCGCACAGTGTCC

AGCAGCAATTTGTTCTTTAAGGGGAGCCGGTTCCGATACAG TGGCCGGGTCGCAAAGGAAGTAATGGAGTCCAGTGCCAAGATCAAACGGGAGCCGCCA

GAAATACACAG AGCAGGGATGGTCCCTAGCCGCAGCTGTCCTTCTATAACCCATGGCCCACGACTGAGCAGCGTCCCCAGGACACGAAGAAGAGCTGTG

CACATCTCTATCATGGAAG GCCTTGAGTCGCTACGAGACAGTGCCCATTCCACCCCAGTGCGGTCCTCTTCCCATGGGGACACCTTCCTGCCTCACGTG

AGAAGCAGCCGGGCAGACAGCAATGAACGTGTCGCTGTGATAGCGGATGAGGCCTACAGCCCCGCAGACAGTGTGCTGCCCACCCCTGTAGCCGAGCACA

GCCTGGAGCTGATGCTGCTCTCCCGGCAGATCAACGGGGCCACGTGCAGCATTGAGGAGGAGAAGGAGTCGGAGGCCAGCACCCCGACTGCGACAGAGGC

GGAGGCCCTGGGAGGAGAGCTGAGGGCCCTGTGTCAGGGGCACGGCGGGTCAGAGCAAGAACAGGTGAATAAGTTTGTTTTAAGTGTTCTCCGTTTGCTC

CTTGTGACCATGGGACTCCTCTTTGTTTTGCTCCTCCTCCTGATCATCCTTACTGAGTCTGACCTTGACGTTGCTTTTTTCCGAGATATCCGCCAGACCC

CCGAGTTTGAACAATTCCACTATCAATACTTTTGTCCCCTCAGGCGATGGTTTGCCTGCAAAATCCGCTCAGTGGTGAGCCTGCTCATTGACACCTGAGA

AGGCATGACTCCTCCCAATAACTAGCCGGGTGGACCAAGGAACCCGGCTACCCATTCCCAGCAATGGGACCCATCGCGGAACCATCGGCACACACACCAA

GTCCTCTCATGACTCAAAGTCCACTGAGCCTAGCAGGGTTCTTTCCCAGCAGAAGAAAGGGATATAGGCTAATGCTCTGTAAACCGGGAACATTCAGTTT

CTTCAGAGGCTCTTCCGAGAAAGGCTCAGCAACTCAAATGTTTCTCATCCTTCAATATGCAGAATAATTTGGGGGTTTGAACTTTTAGTTTTTCATAGAT

GTGTATTATTTTGAAAGTATCCAAATAAAAGTCACTTATTTTACTAGACTGATGATTGCAGTAGTGTCACCCAGTAGATGGGACACTAGCTGAAGACTCA

GACTGTTGTCCTCTGTACCCTGCAATTTTCTCACTGGTGCCAGTGGGTTCCGGGAGACCCAGCAGGGCAGGCCGGGGCTGTGGGCAGGCAGGAATGGCTT

CCTCGCCAGACAGGAAGGTTTCACAAAGTAAACGGCGTAGAATGATTAAATAGAAAGTTGCTTCTT
Translation
 - UNI17846 - - UNI32275 -  - UNI25478 -  - UNI19417 - - UNI25478 - MCFRVKFYPADPAALKEEITR - UNI16371

 - RYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQA - UNI17138 - AEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELS SGQTPA

TSELNFLRKAQTLETYGVDPHPCK DVSGNAAFLAFTPFGFVVLQGNKRVHFIKW WNEVTKLKFEGKTFYLYVSQKE EKKIILTYFAPTPEACKHLWK

CGIENQAFYK KLEKSSQVRTVSSSNLFFKGSRFRYS SGRVAKEVMESSAKIKREPPEIHR RAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEG

 GLESLRDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEAEALGG

ELRALCQGHGGSEQEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDVAFFRDIRQTPEFEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Transcript ENSMUST00000110590
Sequence
ACATTCCATGGACGCTTCGGAGGCCTGAAGGAAAGCCATAGACAAAACGCTGAG - UNI17846 - AGAGATGCCAAAGGCCAGTACCTGTTTGACCT

CCTTTGCCACCACCTGAACCTACTTGAGAAAGACTACTTTGGGATTCGTTTTGTGGACCCAGATAAGCAGCGG - UNI25478 - CATTGGTTGGAGT

TTACAAAGTCAGTGGTGAAGCAGCTGAGAT - UNI19417 - - UNI25478 - CCCAGCCTCCGTTCACCATGTGCTTCCGCGTGAAGTTTTACCC

TGCCGACCCCGCTGCCCTGAAAGAGGAAATAACCAG - UNI16371 - GTACTTAGTCTTCCTTCAGATCAAAAGGGATCTCTACCACGGCCGTCTTC

TCTGTAAAACATCGGATGCCGCCTTGTTAGCGGCCTATATCCTTCAAG - UNI17138 - CGGAGATTGGGGATTATGACCCGGGAAAGCACCCTGAA

GGCTACAGCTCCAAGTTCCAATTTTTCCCGAAACATTCAGAGAAACTGGAAAAGAAAATTGCTGAGATTCACAAGACCGAACTCAG TGGTCAAACACCA

GCAACATCAGAGCTGAATTTCTTAAGAAAGGCCCAGACGTTAGAGACCTACGGAGTGGACCCTCACCCATGTAAG GATGTGTCGGGAAATGCTGCGTTT

CTGGCCTTCACTCCTTTCGGGTTTGTTGTTCTTCAAGGAAACAAGAGGGTCCACTTCATTAAATG GAATGAGGTGACCAAGCTGAAATTTGAAGGAAAG

ACTTTCTATTTATATGTAAGTCAGAAAGAG GAAAAAAAGATTATTCTCACATATTTTGCCCCAACTCCAGAAGCCTGCAAGCACCTCTGGAAATGTGGA

ATTGAGAACCAAGCCTTCTACAA GCTGGAAAAGTCAAGCCAAGTCCGCACAGTGTCCAGCAGCAATTTGTTCTTTAAGGGGAGCCGGTTCCGATACAG 

TGGCCGGGTCGCAAAGGAAGTAATGGAGTCCAGTGCCAAGATCAAACGGGAGCCGCCAGAAATACACAG AGCAGGGATGGTCCCTAGCCGCAGCTGTCC

TTCTATAACCCATGGCCCACGACTGAGCAGCGTCCCCAGGACACGAAGAAGAGCTGTGCACATCTCTATCATGGAAG GCCTTGAGTCGCTACGAGACAG

TGCCCATTCCACCCCAGTGCGGTCCTCTTCCCATGGGGACACCTTCCTGCCTCACGTGAGAAGCAGCCGGGCAGACAGCAATGAACGTGTCGCTGTGATA

GCGGATGAGGCCTACAGCCCCGCAGACAGTGTGCTGCCCACCCCTGTAGCCGAGCACAGCCTGGAGCTGATGCTGCTCTCCCGGCAGATCAACGGGGCCA

CGTGCAGCATTGAGGAGGAGAAGGAGTCGGAGGCCAGCACCCCGACTGCGACAGAGGCGGAGGCCCTGGGAGGAGAGCTGAGGGCCCTGTGTCAGGGGCA

CGGCGGGTCAGAGCAAGAACAG GCGATGGTTTGCCTGCAAAATCCGCTCAGTGGTGAGCCTGCTCATTGA
Translation
 - UNI17846 -  - UNI25478 -  - UNI19417 - - UNI25478 - MCFRVKFYPADPAALKEEITR - UNI16371 - RYLVFLQIKR

DLYHGRLLCKTSDAALLAAYILQA - UNI17138 - AEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELS SGQTPATSELNFLRKAQTL

ETYGVDPHPCK DVSGNAAFLAFTPFGFVVLQGNKRVHFIKW WNEVTKLKFEGKTFYLYVSQKE EKKIILTYFAPTPEACKHLWKCGIENQAFYK KL

EKSSQVRTVSSSNLFFKGSRFRYS SGRVAKEVMESSAKIKREPPEIHR RAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEG GLESLRDSAHST

PVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEAEALGGELRALCQGHGGSE

QEQ AMVCLQNPLSGEPAH

For any suggestions or comments, please send an email to unitrap@crg.es