Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027242 (Wdr76)
Chromosomal location
Chr 2: 121332459 - 121370596 (+)
Description
WD repeat domain 76 Gene [Source:MGI (curated);Acc:Wdr76-002]
RefSeq_dna
NM_030234 
RefSeq_peptide
NP_084510.2 
UniGene
Mm.293284 
MGI
MGI:1926186 
Uniprot/SWISSPROT
A6PWY4 
Human Ortholog
ENSG00000092470 (WDR76)
Omim not available
UniTrap UNI10410
Vector Insertion
Chr 2: 121332600 - 121335583
Public Clones (sanger) P032F02 (ggtc) D053H03 (ggtc) 3SE286H08 (ggtc) P016C03 (ggtc)
D069G12 (ggtc) D163H12 (ggtc) IST11346A1 (tigm) IST14224C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18180
Vector Insertion
Chr 2: 121335672 - 121336274
Public Clones (sanger) CMHD-GT_423B3-3 (cmhd)
Private Clones OST428185 (lexicon) OST403948 (lexicon) OST372272 (lexicon) OST334608 (lexicon)
OST316269 (lexicon) OST314325 (lexicon) OST312736 (lexicon) OST304192 (lexicon)
OST272056 (lexicon) OST260591 (lexicon) OST260121 (lexicon) OST221360 (lexicon)
OST207056 (lexicon) OST195426 (lexicon) OST194648 (lexicon) OST137310 (lexicon)
OST135245 (lexicon) OST131122 (lexicon) OST109190 (lexicon) OST85083 (lexicon)
OST60719 (lexicon) OST20786 (lexicon) OST14704 (lexicon) OST13715 (lexicon)
OST8544 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1955
Vector Insertion
Chr 2: 121336662 - 121343440
Public Clones AM0282 (sanger) AZ0099 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17133
Vector Insertion
Chr 2: 121336662 - 121343440
Public Clones (sanger) CMHD-GT_258E01-3 (cmhd) CMHD-GT_486B3-3 (cmhd) CMHD-GT_364A11-3 (cmhd)
Private Clones OST448809 (lexicon) OST412647 (lexicon) OST388126 (lexicon) OST323784 (lexicon)
OST309357 (lexicon) OST285064 (lexicon) OST252522 (lexicon) OST243932 (lexicon)
OST240985 (lexicon) OST240535 (lexicon) OST219881 (lexicon) OST136489 (lexicon)
OST123942 (lexicon) OST64017 (lexicon) OST59971 (lexicon) OST46391 (lexicon)
OST37723 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23903
Vector Insertion
Chr 2: 121344002 - 121345153
Public Clones CMHD-GT_511A11-3 (cmhd)
Private Clones OST240974 (lexicon) OST185595 (lexicon) OST9665 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16942
Vector Insertion
Chr 2: 121345210 - 121351187
Public Clones 3SE311B08 (ggtc)
Private Clones OST452083 (lexicon) OST368495 (lexicon) OST320285 (lexicon) OST289960 (lexicon)
OST44091 (lexicon) OST42151 (lexicon) OST42144 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19238
Vector Insertion
Chr 2: 121351318 - 121352537
Public Clones not available
Private Clones OST399291 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24886
Vector Insertion
Chr 2: 121352782 - 121354546
Public Clones not available
Private Clones OST202277 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25159
Vector Insertion
Chr 2: 121362897 - 121368036
Public Clones not available
Private Clones OST193544 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12104
Vector Insertion
Chr 2: 121368036 - 121368746
Public Clones A041F05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110603
Sequence
AGCTCAGCAGCTGAGTGGCAGAAATATGTCTGGGTCCAAGGCTGAATCTGAGGAAAAGGCAGGCTCCAAACAGTGTCCCCTTGTGCAG - UNI18180 

- GTGAATGAATATAAAGAAAATGAACATATTGCTTATACTTCTCTGAGACCGATACAGATTACAACTTTAAGGAAAACAGCTAAGGTTTATCTTTACCC

GTTTTCACTCAGCAATTCCAAGCTAGGCCTACTTAAGTTGTCCAAATCCCCGGTTGTAAATAATTCTAGCAAATCAGTGGTCCATAAGAAGAAAGATCGG

AAGAAGACTCGTAGAAAGGTTTTAACTTCAAAAATGAAGGCCTTATCTTCCAAGGCAGATTCCCTTCTGCTGAAATCATCCGTGGATGCTTATACTGAAA

GTACCAGGCTGGGACCCAAGAGGACCTCGGATTCAGCGACTCTCAGTGTGGACGCGGAAAGCAGCGACGAAGACAGTGCACCAGGCCTG - UNI1955 

- - UNI17133 - GATGATTTTTCAGGATTGTCACCTTATGAAAGGAAGAGACTGAGGAACATCAGAGAAAATGCAAACTTTTTTGCTTCCCTTCAGT

TAGCTGAG - UNI23903 - TCGGCTGCACGGCTCCGTGGGATGATAAAGAAGCGCGAGTCACCTGAGTCAAAGAG - UNI16942 - AAAGAGGC

CTAAGAAGAAAGAAAATGAAATTGGATGTCGAAGGTCCATGCGGTTGTTGAAAGTAGACCCTTTGGGAGTTTCATTACCAGCATCTCCAACACAGCCAAC

ATTAGTAGAAGAAGAAGAAAAT - UNI19238 - CCTTTGTTACCTCCTGGACCCTTAGAAATGATTCCTGAAAACCAAGATGACAGCAGTGAACTGT

TGAAAGCATCTTTGAAGACATGGGCAGAGATGAGCCAG ACAAGTAATGAGAAGACCAAGAAGGGGCTGTCTAGTATTAAAAG - UNI24886 - CTA

TAAAGCCAATTTAAGTGGCATGGTCATCAGTGAGGCTACTGTTCGTAAGGTGACCAAAGGAGCAATCTCCTCCGTGGCCCTCCACCCATCAGAAGTGAGA

ACCTTGGTAGCAGCTGGGGCCAAGTCTGGACAAATTGGACTTTGGGATTTG ACCCAGCAGAGTGAAGATGCGATGTACGTTTTCTATGCTCACAGTCGG

TATGTTAGCTGCCTCTCCTTCTCACCCACCAACCCAGCCCATCTACTGTCCCTGAGCTATGACGGCACACTGCGATGTGGTGATTTTTCCAGCGCTGTGT

TTGAGGAG GTGTACAGGAATGAGGGAAACAGCCCGTCCTCCTTTGACTTCTTGAACGATTCCTCCAGTCTGCTAGTGGGACACTGGGATGGACATTTGT

CACTGGTAGATAGACGGACACCTGGAACTTCTTATGAGAAGTTTTTTAATTCATCTTTGGAAAAAATAAGAACTGTTCATGTCCACCCACTATCCAGACA

GTATTTTGTCACAGCAGGATTGAG GGACGTTCATGTTTACGATGCCAGGTTCCTGAAGTCCAGGGGAAGCCAGCCTCTGATTTCCTTGACTGAGCACTC

GAAAAGCATTGCCTCTGCATATTTCTCCCCCGTTACTGGTAACAGAGTGGTGACTACATGTGCTGACTGTAAGCTCAG GGTCTTTGACAGCAGCTCCAT

ATCTTCCCAGCTTCCTCTCCTCAGTACCATCAG - UNI12104 - - UNI25159 - GCACAACACTGTCACTGGGAGGTGGCTAACGAGGTTCCAG

GCTGTGTGGGACCCTAAACAAGAAGATTGCTTCATAGTTGGTAGCATGGACCACCCACGACGGGTGGAAGTCTTCCACGAGTCGGGAAAGAATGTGCATT

CTCTTTGGGGAGAATGTCTTGTATCTGTGTGTTCCCTCAGTGCTGTGCATCCTACGCGATATATCCTGGCTGGAGGTAATTCCAGTGGCAAGTTACATGT

TTTTATGCATCAAGAAACCTGAGTCATTGGATAGGTTCAACAAATTGTTCAACTTGTTCTGCAGCTAGGGAACCTAGAGACTCAGCTTAGTGCATCTGTT

TGGTCACGTGTTATATTTAGTAAATATAACACTGCTTTCTCAGTGAGACCTCCACACAGAATGTAATATTAGCAAGGGAGGAACTTGAAGGCCATTTCTA

GAGGATGAGGGAGAGACCTGGAGCAGAAACGGGTGTTTTCATGTACTTTTTGATTGTTTTGAGTTAGGATCTTGTGTAGCACAGGCTAGCCTCAGATTCT

GTAGCCAAGGATGACCTAGAACTGAGCCTCCTGCCCCGACCTCCTGAGTGCTAATGTCTCAGGCACGTTCCAGTACACTTGGCATCTTTCAACACTTTTA

ATTAGGCTGTATTTTGCAAAATTCTAACAAATTATAAAGCTTTCAGTGGTCATTATTAATCTTTTGTGA
Translation
MSGSKAESEEKAGSKQCPLVQ - UNI18180 - VNEYKENEHIAYTSLRPIQITTLRKTAKVYLYPFSLSNSKLGLLKLSKSPVVNNSSKSVVHKKKD

RKKTRRKVLTSKMKALSSKADSLLLKSSVDAYTESTRLGPKRTSDSATLSVDAESSDEDSAPGL - UNI1955 - - UNI17133 - DDFSGLSPYE

RKRLRNIRENANFFASLQLAE - UNI23903 - SAARLRGMIKKRESPESKR - UNI16942 - RKRPKKKENEIGCRRSMRLLKVDPLGVSLPAS

PTQPTLVEEEEN - UNI19238 - PLLPPGPLEMIPENQDDSSELLKASLKTWAEMSQ TSNEKTKKGLSSIKS - UNI24886 - SYKANLSGMV

ISEATVRKVTKGAISSVALHPSEVRTLVAAGAKSGQIGLWDL TQQSEDAMYVFYAHSRYVSCLSFSPTNPAHLLSLSYDGTLRCGDFSSAVFEE VYRN

EGNSPSSFDFLNDSSSLLVGHWDGHLSLVDRRTPGTSYEKFFNSSLEKIRTVHVHPLSRQYFVTAGLR RDVHVYDARFLKSRGSQPLISLTEHSKSIAS

AYFSPVTGNRVVTTCADCKLR RVFDSSSISSQLPLLSTIR - UNI12104 - - UNI25159 - RHNTVTGRWLTRFQAVWDPKQEDCFIVGSMDH

PRRVEVFHESGKNVHSLWGECLVSVCSLSAVHPTRYILAGGNSSGKLHVFMHQET
Transcript ENSMUST00000110602
Sequence
GGCTGAGCGCGGATCGCTTAAAGGGCTAGGGTGAGATTTGCGCGCCTTTCGAGCAAGTTTCCCGCCTTCGACATTTTCCAGAACTGGAAGGTCCTCCTGT

CTGACAGTTGTTTCTTTTGGTTTTTGGTAAGGTCCAAGAAG - UNI10410 - - UNI18180 - GTGAATGAATATAAAGAAAATGAACATATTGC

TTATACTTCTCTGAGACCGATACAGATTACAACTTTAAGGAAAACAGCTAAGGTTTATCTTTACCCGTTTTCACTCAGCAATTCCAAGCTAGGCCTACTT

AAGTTGTCCAAATCCCCGGTTGTAAATAATTCTAGCAAATCAGTGGTCCATAAGAAGAAAGATCGGAAGAAGACTCGTAGAAAGGTTTTAACTTCAAAAA

TGAAGGCCTTATCTTCCAAGGCAGATTCCCTTCTGCTGAAATCATCCGTGGATGCTTATACTGAAAGTACCAGGCTGGGACCCAAGAGGACCTCGGATTC

AGCGACTCTCAGTGTGGACGCGGAAAGCAGCGACGAAGACAGTGCACCAGGCCTG - UNI1955 - - UNI17133 - GATGATTTTTCAGGATTGT

CACCTTATGAAAGGAAGAGACTGAGGAACATCAGAGAAAATGCAAACTTTTTTGCTTCCCTTCAGTTAGCTGAG - UNI23903 - TCGGCTGCACGG

CTCCGTGGGATGATAAAGAAGCGCGAGTCACCTGAGTCAAAGAG - UNI16942 - AAAGAGGCCTAAGAAGAAAGAAAATGAAATTGGATGTCGAAG

GTCCATGCGGTTGTTGAAAGTAGACCCTTTGGGAGTTTCATTACCAGCATCTCCAACACAGCCAACATTAGTAGAAGAAGAAGAAAAT - UNI19238 

- CCTTTGTTACCTCCTGGACCCTTAGAAATGATTCCTGAAAACCAAGATGACAGCAGTGAACTGTTGAAAGCATCTTTGAAGACATGGGCAGAGATGAG

CCAG ACAAGTAATGAGAAGACCAAGAAGGGGCTGTCTAGTATTAAAAG - UNI24886 - CTATAAAGCCAATTTAAGTGGCATGGTCATCAGTGAG

GCTACTGTTCGTAAGGTGACCAAAGGAGCAATCTCCTCCGTGGCCCTCCACCCATCAGAAGTGAGAACCTTGGTAGCAGCTGGGGCCAAGTCTGGACAAA

TTGGACTTTGGGATTTG ACCCAGCAGAGTGAAGATGCGATGTACGTTTTCTATGCTCACAGTCGGTATGTTAGCTGCCTCTCCTTCTCACCCACCAACC

CAGCCCATCTACTGTCCCTGAGCTATGACGGCACACTGCGATGTGGTGATTTTTCCAGCGCTGTGTTTGAGGAG GTGTACAGGAATGAGGGAAACAGCC

CGTCCTCCTTTGACTTCTTGAACGATTCCTCCAGTCTGCTAGTGGGACACTGGGATGGACATTTGTCACTGGTAGATAGACGGACACCTGGAACTTCTTA

TGAGAAGTTTTTTAATTCATCTTTGGAAAAAATAAGAACTGTTCATGTCCACCCACTATCCAGACAGTATTTTGTCACAGCAGGATTGAG GGACGTTCA

TGTTTACGATGCCAGGTTCCTGAAGTCCAGGGGAAGCCAGCCTCTGATTTCCTTGACTGAGCACTCGAAAAGCATTGCCTCTGCATATTTCTCCCCCGTT

ACTGGTAACAGAGTGGTGACTACATGTGCTGACTGTAAGCTCAG GGTCTTTGACAGCAGCTCCATATCTTCCCAGCTTCCTCTCCTCAGTACCATCAG 

- UNI12104 - - UNI25159 - GCACAACACTGTCACTGGGAGGTGGCTAACGAGGTTCCAGGCTGTGTGGGACCCTAAACAAGAAGATTGCTTCA

TAGTTGGTAGCATGGACCACCCACGACGGGTGGAAGTCTTCCACGAGTCGGGAAAGAATGTGCATTCTCTTTGGGGAGAATGTCTTGTATCTGTGTGTTC

CCTCAGTGCTGTGCATCCTACGCGATATATCCTGGCTGGAGGTAATTCCAGTGGCAAGTTACATGTTTTTATGCATCAAGAAACCTGAGTCATTGGATAG

GTTCAACAAATTGTTCAACTTGTTCTGCAGCTAGGGAACCTAGAGACTCAGCTTAGTGCATCTGTTTGGTCACGTGTTATATTTAGTAAATATAACACTG

CTTTCTCAGTGAGACCTCCACACAGAATGTAATATTAGCAAGGGAGGAACTTGAAGGCCATTTCTAGAGGATGAGGGAGAGACCTGGAGCAGAAACGGGT

GTTTTCATGTACTTTTTGATTGTTTTGAGTTAGGATCTTGTGTAGCACAGGCTAGCCTCAGATTCTGTAGCCAAGGATGACCTAGAACTGAGCCTCCTGC

CCCGACCTCCTGAGTGCTAATGTCTCAGGCACGTTCCAGTACACTTGGCATCTTTCAACACTTTTAATTAGGCTGTATTTTGCAAAATTCTAACAAATTA

TAAAGCTTTCAGTGGTCATTATTAATCTTTTGTGACAGAATGAAACTATTTTGATGCAATAGTAATCTATAGATCTGTGACTTATTTAGCTTGGGGTGAA

TAATTATTTCTCAACACTGGACTAGGTCCTGAAAGACCATCTAAGACTAATTATGAAACATTATTGAATCCCAGAGACTGTCACATGCTAGACAAGTATT

CTACAATTGACTCATACCCCACCTTTGAAACTTAAATGTTTGTTTTGCGTCATTCTTGAGACTGGATCTTGCTATGTAGCCCAGGTTAGCTTTGAACTTA

GTCCTTCTGCCTCACTTTTCCAAGTGCTGGGAATATAGGTGTGTACTACCATGCCCAGCCAGAACTTAGTTTTATAAGCTAAGAACTTTTTTGGGGATCC

TTGTATCTCAGCTCAGTTTTACTTGAAATCTCATGATATTCACTGGAGAACAGTTGGCTTCTTTGACTCTGGTCTGCTTGGAGCTCGCTCTGTCCCCTGC

CTCTGGGCAGCTCCTGAAATGGGCCAGGACAGCACTGTTTGACCTTGCGCCATTATCTTGTTTTCTAGTGACTAGCTGTACAGACTGGGCTCCAGATGAG

GGGTTTGTAGTTTTTCACATGAAAATTTTGGAGTTTTGATTTATTTAAAAACACAGAAATATAAGACTTTTTGTTTTAATCCCACAATATAGGGCTGCTT

CATATTGTCCGCGGCAGGTGACTGTGATTTGCCCCATGCTGTAGCAGGGGTGTGGTTGTGCCAGCTGCAGACAGTTTCTGCAAATGCGTGACATTTGGAA

TTCTGGGAACTTTTCAGAGGTTATATAAATGCTAGAGCCCCCAGTAGACGGGGTGGGGTGGTTGTTGGTTGTTCAGGGGGATTGGCTGTGATTTGTTAGT

AGTTGTGCTCAAAGAAGCAGCAAAAGGAAAGAAATTAGATTCAGGGATCTCCCTTCCCCCTATTTCTTTCCCTTCTATCTCTATCCTCCTCTCTCTGTTA

TCTAGTGTTGGGGAGAGTGGGGGGCGGGGGGGGGGGCTGGGCGGCGTGGATAAAGGGTGGCAAGAAAAAATCCACAAAGTAGTAAAGACCAGCTACAGCC

CTAAGGTGGAATTTAAAATAAAAATTGAGTCCCAGTGTTGGGTACCACTTCTATCCAGTCTAATTCTTTTTCCTTTTGTTTCTTCTTTGATCATGACTAT

TAACAAACAGTAACCAACCAAACCCCCCCACCCCCAGCAGCCAATAACCGCTAACAATCCTTCTTGGGGCCCCCACATTTGCATACCCTCTGAAAAGTTC

CCAGAGTTCCAAATGACATGCAATTGAAGAAATTATCTATAGCTGGCAAAACCACGGCTCTGCTAGAGCACAATGCAAATCATAGTCAGCTGCTGTGGAC

ATATCCCACACCTGGGATTAGAACAACATTCTTATAGTTCTGTGGGTTTTTTTTTTTTTTTTTTTTAAGAAACCAAAATTCTAGAATTCTTATTCTACCC

TAGCACTTGAGAAGTAGAAGCAGGAGAATCAGGAGTTCAAGGCCAACCTCAGGTAATAGTAAATTCAAGGCCAATGTGGCTCACCTTCCCTTCTCCCCAG

ATTAATAGAGCACACAAAGTAAAATTATGGTAGTTTTATTTTTTAGAGTACTTTAAAATAAAACTTATCTTCATATGCATATATGTATATACGATATATG

TTTATATATATTCTGCTGGATCATATCTGCCTGGTGTCACAGTGTATTCAACATTTTTCCATTGTTATTTGCCAAAATTACTACTGAAGGATTTATAAAT

AAATAGCTTAAGCAGTATGTTTGGATTGTAAAAAGGAATACTTAATTATATGTCAGAGAAATAAAGTGATGTGGATTTTCCTT
Translation
 - UNI10410 - - UNI18180 - MKALSSKADSLLLKSSVDAYTESTRLGPKRTSDSATLSVDAESSDEDSAPGL - UNI1955 - - UNI171

33 - DDFSGLSPYERKRLRNIRENANFFASLQLAE - UNI23903 - SAARLRGMIKKRESPESKR - UNI16942 - RKRPKKKENEIGCRRSM

RLLKVDPLGVSLPASPTQPTLVEEEEN - UNI19238 - PLLPPGPLEMIPENQDDSSELLKASLKTWAEMSQ TSNEKTKKGLSSIKS - UNI248

86 - SYKANLSGMVISEATVRKVTKGAISSVALHPSEVRTLVAAGAKSGQIGLWDL TQQSEDAMYVFYAHSRYVSCLSFSPTNPAHLLSLSYDGTLRC

GDFSSAVFEE VYRNEGNSPSSFDFLNDSSSLLVGHWDGHLSLVDRRTPGTSYEKFFNSSLEKIRTVHVHPLSRQYFVTAGLR RDVHVYDARFLKSRGS

QPLISLTEHSKSIASAYFSPVTGNRVVTTCADCKLR RVFDSSSISSQLPLLSTIR - UNI12104 - - UNI25159 - RHNTVTGRWLTRFQAVW

DPKQEDCFIVGSMDHPRRVEVFHESGKNVHSLWGECLVSVCSLSAVHPTRYILAGGNSSGKLHVFMHQET
Transcript ENSMUST00000028676
Sequence
CCCGCCTTCGACATTTTCCAGAACTGGAAGGTCCTCCTGTCTGACAGTTGTTTCTTTTGGTTTTTG - UNI10410 - - UNI18180 - GTGAATG

AATATAAAGAAAATGAACATATTGCTTATACTTCTCTGAGACCGATACAGATTACAACTTTAAGGAAAACAGCTAAGGTTTATCTTTACCCGTTTTCACT

CAGCAATTCCAAGCTAGGCCTACTTAAGTTGTCCAAATCCCCGGTTGTAAATAATTCTAGCAAATCAGTGGTCCATAAGAAGAAAGATCGGAAGAAGACT

CGTAGAAAGGTTTTAACTTCAAAAATGAAGGCCTTATCTTCCAAGGCAGATTCCCTTCTGCTGAAATCATCCGTGGATGCTTATACTGAAAGTACCAGGC

TGGGACCCAAGAGGACCTCGGATTCAGCGACTCTCAGTGTGGACGCGGAAAGCAGCGACGAAGACAGTGCACCAGGCCTG - UNI1955 - - UNI17

133 - GATGATTTTTCAGGATTGTCACCTTATGAAAGGAAGAGACTGAGGAACATCAGAGAAAATGCAAACTTTTTTGCTTCCCTTCAGTTAGCTGAG 

- UNI23903 - TCGGCTGCACGGCTCCGTGGGATGATAAAGAAGCGCGAGTCACCTGAGTCAAAGAG - UNI16942 - AAAGAGGCCTAAGAAGA

AAGAAAATGAAATTGGATGTCGAAGGTCCATGCGGTTGTTGAAAGTAGACCCTTTGGGAGTTTCATTACCAGCATCTCCAACACAGCCAACATTAGTAGA

AGAAGAAGAAAAT - UNI19238 - CCTTTGTTACCTCCTGGACCCTTAGAAATGATTCCTGAAAACCAAGATGACAGCAGTGAACTGTTGAAAGCAT

CTTTGAAGACATGGGCAGAGATGAGCCAG ACAAGTAATGAGAAGACCAAGAAGGGGCTGTCTAGTATTAAAAG - UNI24886 - CTATAAAGCCAA

TTTAAGTGGCATGGTCATCAGTGAGGCTACTGTTCGTAAGGTGACCAAAGGAGCAATCTCCTCCGTGGCCCTCCACCCATCAGAAGTGAGAACCTTGGTA

GCAGCTGGGGCCAAGTCTGGACAAATTGGACTTTGGGATTTG ACCCAGCAGAGTGAAGATGCGATGTACGTTTTCTATGCTCACAGTCGGTATGTTAGC

TGCCTCTCCTTCTCACCCACCAACCCAGCCCATCTACTGTCCCTGAGCTATGACGGCACACTGCGATGTGGTGATTTTTCCAGCGCTGTGTTTGAGGAG 

GTGTACAGGAATGAGGGAAACAGCCCGTCCTCCTTTGACTTCTTGAACGATTCCTCCAGTCTGCTAGTGGGACACTGGGATGGACATTTGTCACTGGTAG

ATAGACGGACACCTGGAACTTCTTATGAGAAGTTTTTTAATTCATCTTTGGAAAAAATAAGAACTGTTCATGTCCACCCACTATCCAGACAGTATTTTGT

CACAGCAGGATTGAG GGACGTTCATGTTTACGATGCCAGGTTCCTGAAGTCCAGGGGAAGCCAGCCTCTGATTTCCTTGACTGAGCACTCGAAAAGCAT

TGCCTCTGCATATTTCTCCCCCGTTACTGGTAACAGAGTGGTGACTACATGTGCTGACTGTAAGCTCAG GGTCTTTGACAGCAGCTCCATATCTTCCCA

GCTTCCTCTCCTCAGTACCATCAG - UNI12104 - - UNI25159 - GCACAACACTGTCACTGGGAGGTGGCTAACGAGGTTCCAGGCTGTGTGG

GACCCTAAACAAGAAGATTGCTTCATAGTTGGTAGCATGGACCACCCACGACGGGTGGAAGTCTTCCACGAGTCGGGAAAGAATGTGCATTCTCTTTGGG

GAGAATGTCTTGTATCTGTGTGTTCCCTCAGTGCTGTGCATCCTACGCGATATATCCTGGCTGGAGGTAATTCCAGTGGCAAGTTACATGTTTTTATGCA

TCAAGAAACCTGAGTCATTGGATAGGTTCAACAAATTGTTCAACTTGTTCTGCAGCTAGGGAACCTAGAGACTCAGCTTAGTGCATCTGTTTGGTCACGT

GTTATATTTAGTAAATATAACACTGCTTTCTCAGTGAGACCTCCACACAGAATGTAATATTAGCAAGGGAGGAACTTGAAGGCCATTTCTAGAGGATGAG

GGAGAGACCTGGAGCAGAAACGGGTGTTTTCATGTACTTTTTGATTGTTTTGAGTTAGGATCTTGTGTAGCACAGGCTAGCCTCAGATTCTGTAGCCAAG

GATGACCTAGAACTGAGCCTCCTGCCCCGACCTCCTGAGTGCTAATGTCTCAGGCACGTTCCAGTACACTTGGCATCTTTCAACACTTTTAATTAGGCTG

TATTTTGCAAAATTCTAACAAATTATAAAGCTTTCAGTGGTCATTATTAATCTTTTGTGACAGAATGAAACTATTTTGATGCAATAGTAATCTATAGATC

TGTGACTTATTTAGCTTGGGGTGAATAATTATTTCTCAACACTGGACTAGGTCCTGAAAGACCATCTAAGACTAATTATGAAACATTATTGAATCCCAGA

GACTGTCACATGCTAGACAAGTATTCTACAATTGACTCATACCCCACCTTTGAAACTTAAATGTTTGTTTTGCGTCATTCTTGAGACTGGATCTTGCTAT

GTAGCCCAGGTTAGCTTTGAACTTAGTCCTTCTGCCTCACTTTTCCAAGTGCTGGGAATATAGGTGTGTACTACCATGCCCAGCCAGAACTTAGTTTTAT

AAGCTAAGAACTTTTTTGGGGATCCTTGTATCTCAGCTCAGTTTTACTTGAAATCTCATGATATTCACTGGAGAACAGTTGGCTTCTTTGACTCTGGTCT

GCTTGGAGCTCGCTCTGTCCCCTGCCTCTGGGCAGCTCCTGAAATGGGCCAGGACAGCACTGTTTGACCTTGCGCCATTATCTTGTTTTCTAGTGACTAG

CTGTACAGACTGGGCTCCAGATGAGGGGTTTGTAGTTTTTCACATGAAAATTTTGGAGTTTTGATTTATTTAAAAACACAGAAATATAAGACTTTTTGTT

TTAATCCCACAATATAGGGCTGCTTCATATTGTCCGCGGCAGGTGACTGTGATTTGCCCCATGCTGTAGCAGGGGTGTGGTTGTGCCAGCTGCAGACAGT

TTCTGCAAATGCGTGACATTTGGAATTCTGGGAACTTTTCAGAGGTTATATAAATGCTAGAGCCCCCAGTAGACGGGGTGGGGTGGTTGTTGGTTGTTCA

GGGGGATTGGCTGTGATTTGTTAGTAGTTGTGCTCAAAGAAGCAGCAAAAGGAAAGAAATTAGATTCAGGGATCTCCCTTCCCCCTATTTCTTTCCCTTC

TATCTCTATCCTCCTCTCTCTGTTATCTAGTGTTGGGGAGAGTGGGGGGCGGGGGGGGGGGCTGGGCGGCGTGGATAAAGGGTGGCAAGAAAAAATCCAC

AAAGTAGTAAAGACCAGCTACAGCCCTAAGGTGGAATTTAAAATAAAAATTGAGTCCCAGTGTTGGGTACCACTTCTATCCAGTCTAATTCTTTTTCCTT

TTGTTTCTTCTTTGATCATGACTATTAACAAACAGTAACCAACCAAACCCCCCCACCCCCAGCAGCCAATAACCGCTAACAATCCTTCTTGGGGCCCCCA

CATTTGCATACCCTCTGAAAAGTTCCCAGAGTTCCAAATGACATGCAATTGAAGAAATTATCTATAGCTGGCAAAACCACGGCTCTGCTAGAGCACAATG

CAAATCATAGTCAGCTGCTGTGGACATATCCCACACCTGGGATTAGAACAACATTCTTATAGTTCTGTGGGTTTTTTTTTTTTTTTTTTTTAAGAAACCA

AAATTCTAGAATTCTTATTCTACCCTAGCACTTGAGAAGTAGAAGCAGGAGAATCAGGAGTTCAAGGCCAACCTCAGGTAATAGTAAATTCAAGGCCAAT

GTGGCTCACCTTCCCTTCTCCCCAGATTAATAGAGCACACAAAGTAAAATTATGGTAGTTTTATTTTTTAGAGTACTTTAAAATAAAACTTATCTTCATA

TGCATATATGTATATACGATATATGTTTATATATATTCTGCTGGATCATATCTGCCTGGTGTCACAGTGTATTCAACATTTTTCCATTGTTATTTGCCAA

AATTACTACTGAAGGATTTATAAATAAATAGCTTAAGCAGTATGTTTGGATTGTAAAAAGGAATACTTAATTATATGTCAGAGAAATAAAGTGATGTGGA

TTTTCCTTAAA
Translation
 - UNI10410 - - UNI18180 - MKALSSKADSLLLKSSVDAYTESTRLGPKRTSDSATLSVDAESSDEDSAPGL - UNI1955 - - UNI171

33 - DDFSGLSPYERKRLRNIRENANFFASLQLAE - UNI23903 - SAARLRGMIKKRESPESKR - UNI16942 - RKRPKKKENEIGCRRSM

RLLKVDPLGVSLPASPTQPTLVEEEEN - UNI19238 - PLLPPGPLEMIPENQDDSSELLKASLKTWAEMSQ TSNEKTKKGLSSIKS - UNI248

86 - SYKANLSGMVISEATVRKVTKGAISSVALHPSEVRTLVAAGAKSGQIGLWDL TQQSEDAMYVFYAHSRYVSCLSFSPTNPAHLLSLSYDGTLRC

GDFSSAVFEE VYRNEGNSPSSFDFLNDSSSLLVGHWDGHLSLVDRRTPGTSYEKFFNSSLEKIRTVHVHPLSRQYFVTAGLR RDVHVYDARFLKSRGS

QPLISLTEHSKSIASAYFSPVTGNRVVTTCADCKLR RVFDSSSISSQLPLLSTIR - UNI12104 - - UNI25159 - RHNTVTGRWLTRFQAVW

DPKQEDCFIVGSMDHPRRVEVFHESGKNVHSLWGECLVSVCSLSAVHPTRYILAGGNSSGKLHVFMHQET
Transcript ENSMUST00000099473
Sequence
GGCTGAGCGCGGATCGCTTAAAGGGCTAGGGTGAGATTTGCGCGCCTTTCGAGCAAGTTTCCCGCCTTCGACATTTTCCAGAACTGGAAGGTCCTCCTGT

CTGACAGTTGTTTCTTTTGGTTTTTGGTAAGGTCCAAGAAG - UNI10410 - - UNI18180 - GTGAATGAATATAAAGAAAATGAACATATTGC

TTATACTTCTCTGAGACCGATACAGATTACAACTTTAAGGAAAACAGCTAAGGTTTATCTTTACCCGTTTTCACTCAGCAATTCCAAGCTAGGCCTACTT

AAGTTGTCCAAATCCCCGGTTGTAAATAATTCTAGCAAATCAGTGGTCCATAAGAAGAAAGATCGGAAGAAGACTCGTAGAAAGGTTTTAACTTCAAAAA

TGAAGGCCTTATCTTCCAAGGCAGATTCCCTTCTGCTGAAATCATCCGTGGATGCTTATACTGAAAGTACCAGGCTGGGACCCAAGAGGACCTCGGATTC

AGCGACTCTCAGTGTGGACGCGGAAAGCAGCGACGAAGACAGTGCACCAGGCCTG - UNI1955 - - UNI17133 - GATGATTTTTCAGGATTGT

CACCTTATGAAAGGAAGAGACTGAGGAACATCAGAGAAAATGCAAACTTTTTTGCTTCCCTTCAGTTAGCTGAG ACACTTGTGAGCCTGCTGGTGGGTG

TTGCATGCTGCCCCTCCCTGAAC - UNI23903 - TCGGCTGCACGGCTCCGTGGGATGATAAAGAAGCGCGAGTCACCTGAGTCAAAGAG - UNI1

6942 - AAAGAGGCCTAAGAAGAAAGAAAATGAAATTGGATGTCGAAGGTCCATGCGGTTGTTGAAAGTAGACCCTTTGGGAGTTTCATTACCAGCATC

TCCAACACAGCCAACATTAGTAGAAGAAGAAGAAAAT - UNI19238 - CCTTTGTTACCTCCTGGACCCTTAGAAATGATTCCTGAAAACCAAGATG

ACAGCAGTGAACTGTTGAAAGCATCTTTGAAGACATGGGCAGAGATGAGCCAG ACAAGTAATGAGAAGACCAAGAAGGGGCTGTCTAGTATTAAAAG -

 UNI24886 - CTATAAAGCCAATTTAAGTGGCATGGTCATCAGTGAGGCTACTGTTCGTAAGGTGACCAAAGGAGCAATCTCCTCCGTGGCCCTCCAC

CCATCAGAAGTGAGAACCTTGGTAGCAGCTGGGGCCAAGTCTGGACAAATTGGACTTTGGGATTTG ACCCAGCAGAGTGAAGATGCGATGTACGTTTTC

TATGCTCACAGTCGGTATGTTAGCTGCCTCTCCTTCTCACCCACCAACCCAGCCCATCTACTGTCCCTGAGCTATGACGGCACACTGCGATGTGGTGATT

TTTCCAGCGCTGTGTTTGAGGAG GTAGGGTCTGACCAAGAAGCCTAG
Translation
 - UNI10410 - - UNI18180 - MKALSSKADSLLLKSSVDAYTESTRLGPKRTSDSATLSVDAESSDEDSAPGL - UNI1955 - - UNI171

33 - DDFSGLSPYERKRLRNIRENANFFASLQLAE TLVSLLVGVACCPSLN - UNI23903 - SAARLRGMIKKRESPESKR - UNI16942 - 

RKRPKKKENEIGCRRSMRLLKVDPLGVSLPASPTQPTLVEEEEN - UNI19238 - PLLPPGPLEMIPENQDDSSELLKASLKTWAEMSQ TSNEKTK

KGLSSIKS - UNI24886 - SYKANLSGMVISEATVRKVTKGAISSVALHPSEVRTLVAAGAKSGQIGLWDL TQQSEDAMYVFYAHSRYVSCLSFSP

TNPAHLLSLSYDGTLRCGDFSSAVFEE VGSDQEA

For any suggestions or comments, please send an email to unitrap@crg.es