Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027259 (Adal)
Chromosomal location
Chr 2: 120966168 - 120982416 (+)
Description
adenosine deaminase-like Gene [Source:MGI (curated);Acc:Adal-002]
RefSeq_dna
NM_029475 
RefSeq_peptide
NP_083751.1 
MGI
MGI:1923144 
Uniprot/SWISSPROT
Q80SY6 
Human Ortholog
ENSG00000168803 (ADAL)
Omim not available
UniTrap UNI18727
Vector Insertion
Chr 2: 120966403 - 120967828
Public Clones IST13215H4 (tigm)
Private Clones OST415894 (lexicon) OST288385 (lexicon) OST279497 (lexicon) OST234370 (lexicon)
OST175574 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24899
Vector Insertion
Chr 2: 120968259 - 120968391
Public Clones not available
Private Clones OST201748 (lexicon) OST186061 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24365
Vector Insertion
Chr 2: 120968884 - 120968946
Public Clones not available
Private Clones OST223420 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066155
Sequence
GCAATCTGAAGGAAGTCCAGCACCTCAGAGATTCCCACTTTGATAAGTTTATCGTCCAAGCCGAGAATAAGAGCAAAGAGAAACTTTTCCTTCTACTGAA

GTGATGGAGGCCGGACAGCAGTGGCCTGGGAAGACAGACTTTTATCTGCAATTACCAAAAGTG - UNI24899 - GAGCTCCATGCCCACTTGAATGG

CTCCATTAGTTCCAGTACCATGAAGAAACTGATAGCCAAGAAGCCACATCTTAACGTTCATGGTCACATGACCATGATTGACAAGGGGAAGAAAAGGACT

TTACAAGA - UNI24365 - - UNI24899 - ATGTTTCCAGATGTTCCAAGTTATACATCAGCTTACTACTAGTGCTGAGGACATCCTGATG - U

NI24365 - GTCACAAAAGACGTCATTAAGGAATTTGCAGATGATGGTGTCAAGTACCTGGAGCTGAGGAGCACTCCCAGAGAAGAAAATGCTACTG G

AATGACTAGGAAGACTTACGTGGAATCCGTCCTTGAAGGCATAAAACAATGCAAACAGGAAAACTTAGATATTGATGTTAG GTATTTGATGGCAATTGA

CAGAAGAGGTGGCCCAACAATAGCCAGGGAGACTGTCGAACTTGCTAAAGAGTTCTTCCTCTCTACTGAGAATACAGTTCTTGGCCTTGACCTCAGTGGA

GATCCAACT ATAGGACAAGCTAACGACTTCTTGGAGCCTCTTTTAGAAGCTAAAAAAGCAGGTCTGAAGTTGGCATTGCATCTTGCCGAG ATTCCAAA

CAGGGAAAAAGAAAATCAGATGCTGCTGAGTCTGCTCCCTGACAGAATTGGGCATGGGACATTCCTTAGCGCCTCTGAGGCAGGGGCCCTGGACCAAGTG

GACTTCGTGAGGCAACACCAGATACCCCTCG AACTTTGTTTGACCTCAAACATCAAAAGCCAGACAGTCCCTTCTTATGATCAGCATCACTTTGGATTT

TGGTACAGCATTGCTCATCCTTCTGTGATCTGT ACTGATGATAAAGGTGTTTTTGCGACATACCTTTCTCAAGAATATCAACTGGCAGCAGAAACATTT

AATTTGACCCCATTTCAGGTGTGGGATCTGTCCTATGAATCCATCAACTACATCTTTGCTTGTGACAACACCAGATCTGAACTGAGAAAAAGGTGGACTC

ACTTGAAGCAGAAAGTGTTAAACTGTAATGAGGTGAACTACTTTTGATTATACATTGTAGCCAAGATCTTCCTGCCCTGTGTATCCTACTCAGTTACTGC

CCACTTGAAATGACTTCCCTTGAATTTGGGTAGCCAAGTATATATGGGGTCTAACTCCAGCCCCTTCAACTGGTAAGTTCGAGGTTTTGCATGGCTGCAC

TTCCATGCTGCTTTTGCTGGAGGGTTGTTTAGCCCTCATTTCCTAGTGACTCTTGTTTTTACACTTAGTGCTCTTTAGACATTTGTGACCGTGAACCTTC

TGAGAAGTTGAAACTCTTTGTCTTCAGGGAAATCTCTGTTTTGTTAGGTTTAATCAGACTCCTTCCACTTCCTTTTACCCTTTCAAGTATTAACTTTTTT

AGACTGTTGATGTTAGGTCACAGTGCACACCTGAACTGTTTGTGTGGGTGCCTAGTTGTCAGGTGACTGTAGTAACAAAGCTAGAATCTGGCTTTGCCCT

TCTCCTAATATCTTTAGAAATATATAACGGGGGTTGGAGTAATCCCTTCAGTTTAAGAAAAGAAAAGAACGACTGGCTTGAAGTAAAAAAGACACATAGC

TGGAGCTTCTGATTTAAAATCAGGTTCTATTTGGCTTCCTTGTGGAAGCTACCAGGACCTCTACAGTGCTAGGACTCTCTTAAAAGATCTTTGTAGCAAT

GGTAGCATTGTGGCTTCTAGGGTTCTTAGATCACCAATAATCCCATGCCCACATGATAGCCTACAGGTATAGACTTATATAAACACACATATACCATGGC

CACATTAGCCGACTTTAGCAGATAACAAATGTCTTGGTTGGTTTTTTTCACAAGCTAGAGTCATTTGGGAAGAGGGACCCTCAACTGAGAAAATATTCCC

ACAAGATTGGCCCAATCAGTGCTTGATCAGTTAGTGGGCCCATGCCACAGAGGGTGATACCACCCTTAGGGACATGGTTCTGGGTGGAAAGCAAAGGAAA

TGGAACAAGGCACGAGGAGCAAGCCATAGGCAACACTCCTCCATGGCTTCAGCTTTAGTTCCTGCCTCAACTTCCCAGGATGACAGACTACAAATTATAA

GAGGAAATAACCCTTTCCTCCTTACATTACATTTGGTTATGGTGTTTTGTCACAGCATT
Translation
MEAGQQWPGKTDFYLQLPKV - UNI24899 - ELHAHLNGSISSSTMKKLIAKKPHLNVHGHMTMIDKGKKRTLQE - UNI24365 - - UNI248

99 - ECFQMFQVIHQLTTSAEDILM - UNI24365 - VTKDVIKEFADDGVKYLELRSTPREENATG GMTRKTYVESVLEGIKQCKQENLDIDVR 

RYLMAIDRRGGPTIARETVELAKEFFLSTENTVLGLDLSGDPT IGQANDFLEPLLEAKKAGLKLALHLAE IPNREKENQMLLSLLPDRIGHGTFLSAS

EAGALDQVDFVRQHQIPLE ELCLTSNIKSQTVPSYDQHHFGFWYSIAHPSVIC TDDKGVFATYLSQEYQLAAETFNLTPFQVWDLSYESINYIFACDN

TRSELRKRWTHLKQKVLNCNEVNYF
Transcript ENSMUST00000119031
Sequence
CGCGCACGTATCCGTGTGCGGCAAGCGATCGTTTGCTGAGGGAGCTGCTGTCGTTGGTGCTCTGGACCGTTCCCGCCCGGCGCTGGCGGCCTCGCGGGCC

CATGACGAGAAG - UNI18727 - GTGAAAGTGATCCCAGAGCCACACATAGTGCAAGTCTTGTTTAAAATGGCAATCTGAAGGAAGTCCAGCACCTC

AGAGATTCCCACTTTGATAAGTTTATCGTCCAAGCCGAGAATAAGAGCAAAGAGAAACTTTTCCTTCTACTGAAGTGATGGAGGCCGGACAGCAGTGGCC

TGGGAAGACAGACTTTTATCTGCAATTACCAAAAGTG - UNI24899 - GAGCTCCATGCCCACTTGAATGGCTCCATTAGTTCCAGTACCATGAAGA

AACTGATAGCCAAGAAGCCACATCTTAACGTTCATGGTCACATGACCATGATTGACAAGGGGAAGAAAAGGACTTTACAAGA - UNI24365 - - UN

I24899 - ATGTTTCCAGATGTTCCAAGTTATACATCAGCTTACTACTAGTGCTGAGGACATCCTGATG - UNI24365 - GTCACAAAAGACGTCA

TTAAGGAATTTGCAGATGATGGTGTCAAGTACCTGGAGCTGAGGAGCACTCCCAGAGAAGAAAATGCTACTG GAATGACTAGGAAGACTTACGTGGAAT

CCGTCCTTGAAGGCATAAAACAATGCAAACAGGAAAACTTAGATATTGATGTTAG GTATTTGATGGCAATTGACAGAAGAGGTGGCCCAACAATAGCCA

GGGAGACTGTCGAACTTGCTAAAGAGTTCTTCCTCTCTACTGAGAATACAGTTCTTGGCCTTGACCTCAGTGGAGATCCAACT ATAGGACAAGCTAACG

ACTTCTTGGAGCCTCTTTTAGAAGCTAAAAAAGCAGGTCTGAAGTTGGCATTGCATCTTGCCGAG ATTCCAAACAGGGAAAAAGAAAATCAGATGCTGC

TGAGTCTGCTCCCTGACAGAATTGGGCATGGGACATTCCTTAGCGCCTCTGAGGCAGGGGCCCTGGACCAAGTGGACTTCGTGAGGCAACACCAGATACC

CCTCG AACTTTGTTTGACCTCAAACATCAAAAGCCAGACAGTCCCTTCTTATGATCAGCATCACTTTGGATTTTGGTACAGCATTGCTCATCCTTCTGT

GATCTGT ACTGATGATAAAGGTGTTTTTGCGACATACCTTTCTCAAGAATATCAACTGGCAGCAGAAACATTTAATTTGACCCCATTTCAGGTGTGGGA

TCTGTCCTATGAATCCATCAACTACATCTTTGCTTGTGACAACACCAGATCTGAACTGAGAAAAAGGTGGACTCACTTGAAGCAGAAAGTGTTAAACTGT

AATGAGGTGAACTACTTTTGATTATACATTGTAGCCAAGATCTTCCTGCCCTGTGTATCCTACTCAGTTACTGCCCACTTGAAATGACTTCCCTTGAATT

TGGGTAGCCAAGTATATATGGGGTCTAACTCCAGCCCCTTCAACTGGTAAGTTCGAGGTTTTGCATGGCTGCACTTCCATGCTGCTTTTGCTGGAGGGTT

GTTTAGCCCTCATTTCCTAGTGACTCTTGTTTTTACACTTAGTGCTCTTTAGACATTTGTGACCGTGAACCTTCTGAGAAGTTGAAACTCTTTGTCTTCA

GGGAAATCTCTGTTTTGTTAGGTTTAATCAGACTCCTTCCACTTCCTTTTACCCTTTCAAGTATTAACTTTTTTAGACTGTTGATGTTAGGTCACAGTGC

ACACCTGAACTGTTTGTGTGGGTGCCTAGTTGTCAGGTGACTGTAGTAACAAAGCTAGAATCTGGCTTTGCCCTTCTCCTAATATCTTTAGAAATATATA

ACGGGGGTTGGAGTAATCCCTTCAGTTTAAGAAAAGAAAAGAACGACTGGCTTGAAGTAAAAAAGACACATAGCTGGAGCTTCTGATTTAAAATCAGGTT

CTATTTGGCTTCCTTGTGGAAGCTACCAGGACCTCTACAGTGCTAGGACTCTCTTAAAAGATCTTTGTAGCAATGGTAGCATTGTGGCTTCTAGGGTTCT

TAGATCACCAATAATCCCATGCCCACATGATAGCCTACAGGTATAGACTTATATAAACACACATATACCATGGCCACATTAGCCGACTTTAGCAGATAAC

AAATGTCTTGGTTGGTTTTTTTCACAAGCTAGAGTCATTTGGGAAGAGGGACCCTCAACTGAGAAAATATTCCCACAAGATTGGCCCAATCAGTGCTTGA

TCAGTTAGTGGGCCCATGCCACAGAGGGTGATACCACCCTTAGGGACATGGTTCTGGGTGGAAAGCAAAGGAAATGGAACAAGGCACGAGGAGCAAGCCA

TAGGCAACACTCCTCCATGGCTTCAGCTTTAGTTCCTGCCTCAACTTCCCAGGATGACAGACTACAAATTATAAGAGGAAATAACCCTTTCCTCCTTACA

TTACATTTGGTTATGGTGTTTTGTCACAGCATTAAAAACACTAAAACAATAA
Translation
 - UNI18727 - MEAGQQWPGKTDFYLQLPKV - UNI24899 - ELHAHLNGSISSSTMKKLIAKKPHLNVHGHMTMIDKGKKRTLQE - UNI24

365 - - UNI24899 - ECFQMFQVIHQLTTSAEDILM - UNI24365 - VTKDVIKEFADDGVKYLELRSTPREENATG GMTRKTYVESVLEGI

KQCKQENLDIDVR RYLMAIDRRGGPTIARETVELAKEFFLSTENTVLGLDLSGDPT IGQANDFLEPLLEAKKAGLKLALHLAE IPNREKENQMLLSL

LPDRIGHGTFLSASEAGALDQVDFVRQHQIPLE ELCLTSNIKSQTVPSYDQHHFGFWYSIAHPSVIC TDDKGVFATYLSQEYQLAAETFNLTPFQVWD

LSYESINYIFACDNTRSELRKRWTHLKQKVLNCNEVNYF
Transcript ENSMUST00000028702
Sequence
AATAGCCGCGGTGGATAAGCGGCGTGCGCCGCACGGGTCCCGGGACCAGCAGCGCCGCAAAGGGGTCGCGCACGTATCCGTGTGCGGCAAGCGATCGTTT

GCTGAGGGAGCTGCTGTCGTTGGTGCTCTGGACCGTTCCCGCCCGGCGCTGGCGGCCTCGCGGGCCCATGACGAGAAGGTGCTCAGCAATACTGCACACA

GAACACTTACCGAGCTCCCGCTCATCCGCTTCTGG - UNI18727 - GTGAAAGTGATCCCAGAGCCACACATAGTGCAAGTCTTGTTTAAAATGGCA

ATCTGAAGGAAGTCCAGCACCTCAGAGATTCCCACTTTGATAAGTTTATCGTCCAAGCCGAGAATAAGAGCAAAGAGAAACTTTTCCTTCTACTGAAGTG

ATGGAGGCCGGACAGCAGTGGCCTGGGAAGACAGACTTTTATCTGCAATTACCAAAAGTG - UNI24365 - - UNI24899 - ATGTTTCCAGATG

TTCCAAGTTATACATCAGCTTACTACTAGTGCTGAGGACATCCTGATG - UNI24365 - GTCACAAAAGACGTCATTAAGGAATTTGCAGATGATGG

TGTCAAGTACCTGGAGCTGAGGAGCACTCCCAGAGAAGAAAATGCTACTG GAATGACTAGGAAGACTTACGTGGAATCCGTCCTTGAAGGCATAAAACA

ATGCAAACAGGAAAACTTAGATATTGATGTTAG GTATTTGATGGCAATTGACAGAAGAGGTGGCCCAACAATAGCCAGGGAGACTGTCGAACTTGCTAA

AGAGTTCTTCCTCTCTACTGAGAATACAGTTCTTGGCCTTGACCTCAGTGGAGATCCAACT ATAGGACAAGCTAACGACTTCTTGGAGCCTCTTTTAGA

AGCTAAAAAAGCAGGTCTGAAGTTGGCATTGCATCTTGCCGAG ATTCCAAACAGGGAAAAAGAAAATCAGATGCTGCTGAGTCTGCTCCCTGACAGAAT

TGGGCATGGGACATTCCTTAGCGCCTCTGAGGCAGGGGCCCTGGACCAAGTGGACTTCGTGAGGCAACACCAGATACCCCTCG AACTTTGTTTGACCTC

AAACATCAAAAGCCAGACAGTCCCTTCTTATGATCAGCATCACTTTGGATTTTGGTACAGCATTGCTCATCCTTCTGTGATCTGT ACTGATGATAAAGG

TGTTTTTGCGACATACCTTTCTCAAGAATATCAACTGGCAGCAGAAACATTTAATTTGACCCCATTTCAGGTGTGGGATCTGTCCTATGAATCCATCAAC

TACATCTTTGCTTGTGACAACACCAGATCTGAACTGAGAAAAAGGTGGACTCACTTGAAGCAGAAAGTGTTAAACTGTAATGAGGTGAACTACTTTTGAT

TATACATTGTAGCCAAGATCTTCCTGCCCTGTGTATCCTACTCAGTTACTGCCCACTTGAAATGACTTCCCTTGAATTTGGGTAGCCAAGTATATATGGG

GTCTAACTCCAGCCCCTTCAACTGGTAAGTTCGAGGTTTTGCATGGCTGCACTTCCATGCTGCTTTTGCTGGAGGGTTGTTTAGCCCTCATTTCCTAGTG

ACTCTTGTTTTTACACTTAGTGCTCTTTAGACATTTGTGACCGTGAACCTTCTGAGAAGTTGAAACTCTTTGTCTTCAGGGAAATCTCTGTTTTGTTAGG

TTTAATCAGACTCCTTCCACTTCCTTTTACCCTTTCAAGTATTAACTTTTTTAGACTGTTGATGTTAGGTCACAGTGCACACCTGAACTGTTTGTGTGGG

TGCCTAGTTGTCAGGTGACTGTAGTAACAAAGCTAGAATCTGGCTTTGCCCTTCTCCTAATATCTTTAGAAATATATAACGGGGGTTGGAGTAATCCCTT

CAGTTTAAGAAAAGAAAAGAACGACTGGCTTGAAGTAAAAAAGACACATAGCTGGAGCTTCTGATTTAAAATCAGGTTCTATTTGGCTTCCTTGTGGAAG

CTACCAGGACCTCTACAGTGCTAGGACTCTCTTAAAAGATCTTTGTAGCAATGGTAGCATTGTGGCTTCTAGGGTTCTTAGATCACCAATAATCCCATGC

CCACATGATAGCCTACAGGTATAGACTTATATAAACACACATATACCATGGCCACATTAGCCGACTTTAGCAGATAACAAATGTCTTGGTTGGTTTTTTT

CACAAGCTAGAGTCATTTGGGAAGAGGGACCCTCAACTGAGAAAATATTCCCACAAGATTGGCCCAATCAGTGCTTGATCAGTTAGTGGGCCCATGCCAC

AGAGGGTGATACCACCCTTAGGGACATGGTTCTGGGTGGAAAGCAAAGGAAATGGAACAAGGCACGAGGAGCAAGCCATAGGCAACACTCCTCCATGGCT

TCAGCTTTAGTTCCTGCCTCAACTTCCCAGGATGACAGACTACAAATTATAAGAGGAAATAACCCTTTCCTCCTTACATTACATTTGGTTATGGTGTTTT

GTCACAGCATTAAAAACACTAAAACAATAATG
Translation
 - UNI18727 -  - UNI24365 - - UNI24899 - MFQVIHQLTTSAEDILM - UNI24365 - VTKDVIKEFADDGVKYLELRSTPREENA

TG GMTRKTYVESVLEGIKQCKQENLDIDVR RYLMAIDRRGGPTIARETVELAKEFFLSTENTVLGLDLSGDPT IGQANDFLEPLLEAKKAGLKLALH

LAE IPNREKENQMLLSLLPDRIGHGTFLSASEAGALDQVDFVRQHQIPLE ELCLTSNIKSQTVPSYDQHHFGFWYSIAHPSVIC TDDKGVFATYLSQ

EYQLAAETFNLTPFQVWDLSYESINYIFACDNTRSELRKRWTHLKQKVLNCNEVNYF
Transcript ENSMUST00000110666
Sequence
GCAATCTGAAGGAAGTCCAGCACCTCAGAGATTCCCACTTTGATAAGTTTATCGTCCAAGCCGAGAATAAGAGCAAAGAGAAACTTTTCCTTCTACTGAA

GTGATGGAGGCCGGACAGCAGTGGCCTGGGAAGACAGACTTTTATCTGCAATTACCAAAAGTG - UNI24899 - GAGCTCCATGCCCACTTGAATGG

CTCCATTAGTTCCAGTACCATGAAGAAACTGATAGCCAAGAAGCCACATCTTAACGTTCATGGTCACATGACCATGATTGACAAGGGGAAGAAAAGGACT

TTACAAGA - UNI24365 - - UNI24899 - ATGTTTCCAGATGTTCCAAGTTATACATCAGCTTACTACTAGTGCTGAGGACATCCTGATG - U

NI24365 - GTCACAAAAGACGTCATTAAGGAATTTGCAGATGATGGTGTCAAGTACCTGGAGCTGAGGAGCACTCCCAGAGAAGAAAATGCTACTG G

AATGACTAGGAAGACTTACGTGGAATCCGTCCTTGAAGGCATAAAACAATGCAAACAGGAAAACTTAGATATTGATGTTAG GTATTTGATGGCAATTGA

CAGAAGAGGTGGCCCAACAATAGCCAGGGAGACTGTCGAACTTGCTAAAGAGTTCTTCCTCTCTACTGAGAATACAGTTCTTGGCCTTGACCTCAGTGGA

GATCCAACT ATAGGACAAGCTAACGACTTCTTGGAGCCTCTTTTAGAAGCTAAAAAAGCAGGTCTGAAGTTGGCATTGCATCTTGCCGAG ATTCCAAA

CAGGGAAAAAGAAAATCAGATGCTGCTGAGTCTGCTCCCTGACAGAATTGGGCATGGGACATTCCTTAGCGCCTCTGAGGCAGGGGCCCTGGACCAAGTG

GACTTCGTGAGGCAACACCAGATACCCCTCG TGTTGGAAGCAAATGCAGAGCTCTACATGTGCAGGGCAGGCCCTCTTCTGCTGAGGCACATCCCCACT

CAGAACAAGTCCACATCACAAGTAATGAACATTTTGTGGG AACTTTGTTTGACCTCAAACATCAAAAGCCAGACAGTCCCTTCTTATGATCAGCATCAC

TTTGGATTTTGGTACAGCATTGCTCATCCTTCTGTGATCTGT ACTGATGATAAAGGTGTTTTTGCGACATACCTTTCTCAAGAATATCAACTGGCAGCA

GAAACATTTAATTTGACCCCATTTCAGGTGTGGGATCTGTCCTATGAATCCATCAACTACATCTTTGCTTGTGACAACACCAGATCTGAACTGAGAAAAA

GGTGGACTCACTTGAAGCAGAAAGTGTTAAACTGTAATGAGGTGAACTACTTTTGATTATACATTGTAGCCAAGATCTTCCTGCCCTGTGTATCCTACTC

AGTTACTGCCCACTTGAAATGACTTCCCTTGAATTTGGGTAGCCAAGTATATATGGGGTCTAACTCCAGCCCCTTCAACTGGTAAGTTCGAGGTTTTGCA

TGGCTGCACTTCCATGCTGCTTTTGCTGGAGGGTTGTTTAGCCCTCATTTCCTAGTGACTCTTGTTTTTACACTTAGTGCTCTTTAGACATTTGTGACCG

TGAACCTTCTGAGAAGTTGAAACTCTTTGTCTTCAGGGAAATCTCTGTTTTGTTAGGTTTAATCAGACTCCTTCCACTTCCTTTTACCCTTTCAAGTATT

AACTTTTTTAGACTGTTGATGTTAGGTCACAGTGCACACCTGAACTGTTTGTGTGGGTGCCTAGTTGTCAGGTGACTGTAGTAACAAAGCTAGAATCTGG

CTTTGCCCTTCTCCTAATATCTTTAGAAATATATAACGGGGGTTGGAGTAATCCCTTCAGTTTAAGAAAAGAAAAGAACGACTGGCTTGAAGTAAAAAAG

ACACATAGCTGGAGCTTCTGATTTAAAATCAGGTTCTATTTGGCTTCCTTGTGGAAGCTACCAGGACCTCTACAGTGCTAGGACTCTCTTAAAAGATCTT

TGTAGCAATGGTAGCATTGTGGCTTCTAGGGTTCTTAGATCACCAATAATCCCATGCCCACATGATAGCCTACAGGTATAGACTTATATAAACACACATA

TACCATGGCCACATTAGCCGACTTTAGCAGATAACAAATGTCTTGGTTGGTTTTTTTCACAAGCTAGAGTCATTTGGGAAGAGGGACCCTCAACTGAGAA

AATATTCCCACAAGATTGGCCCAATCAGTGCTTGATCAGTTAGTGGGCCCATGCCACAGAGGGTGATACCACCCTTAGGGACATGGTTCTGGGTGGAAAG

CAAAGGAAATGGAACAAGGCACGAGGAGCAAGCCATAGGCAACACTCCTCCATGGCTTCAGCTTTAGTTCCTGCCTCAACTTCCCAGGATGACAGACTAC

AAATTATAAGAGGAAATAACCCTTTCCTCCTTACATTACATTTGGTTATGGTGTTTTGTCACAGCATT
Translation
 - UNI24899 -  - UNI24365 - - UNI24899 -  - UNI24365 -   MAIDRRGGPTIARETVELAKEFFLSTENTVLGLDLSGDPT IG

QANDFLEPLLEAKKAGLKLALHLAE IPNREKENQMLLSLLPDRIGHGTFLSASEAGALDQVDFVRQHQIPLV VLEANAELYMCRAGPLLLRHIPTQNK

STSQVMNILWE ELCLTSNIKSQTVPSYDQHHFGFWYSIAHPSVIC TDDKGVFATYLSQEYQLAAETFNLTPFQVWDLSYESINYIFACDNTRSELRKR

WTHLKQKVLNCNEVNYF
Transcript ENSMUST00000110665
Sequence
GCGGTGGATAAGCGGCGTGCGCCGCACGGGTCCCGGGACCAGCAGCGCCGCAAAGGGGTCGCGCACGTATCCGTGTGCGGCAAGCGATCGTTTGCTGAGG

GAGCTGCTGTCGTTGGTGCTCTGGACCGTTCCCGCCCGGCGCTGGCGGCCTCGCGGGCCCATGACGAGAAG - UNI18727 - GTGAAAGTGATCCCA

GAGCCACACATAGTGCAAGTCTTGTTTAAAATGGCAATCTGAAGGAAGTCCAGCACCTCAGAGATTCCCACTTTGATAAGTTTATCGTCCAAGCCGAGAA

TAAGAGCAAAGAGAAACTTTTCCTTCTACTGAAGTGATGGAGGCCGGACAGCAGTGGCCTGGGAAGACAGACTTTTATCTGCAATTACCAAAAGTG - U

NI24365 - - UNI24899 - ATGTTTCCAGATGTTCCAAGTTATACATCAGCTTACTACTAGTGCTGAGGACATCCTGATGGTGAGACACAGAG GT

ATTTGATGGCAATTGACAGAAGAGGTGGCCCAACAATAGCCAGGGAGACTGTCGAACTTGCTAAAGAGTTCTTCCTCTCTACTGAGAATACAGTTCTTGG

CCTTGACCTCAGTGGAGATCCAACT ATAGGACAAGCTAACGACTTCTTGGAGCCTCTTTTAGAAGCTAAAAAAGCAGGTCTGAAGTTGGCATTGCATCT

TGCCGAG ATTCCAAACAGGGAAAAAGAAAATCAGATGCTGCTGAGTCTGCTCCCTGACAGAATTGGGCATGGGACATTCCTTAGCGCCTCTGAGGCAGG

GGCCCTGGACCAAGTGGACTTCGTGAGGCAACACCAGATACCCCTCG TGTTGGAAGCAAATGCAGAGCTCTACATGTGCAGGGCAGGCCCTCTTCTGCT

GAGGCACATCCCCACTCAGAACAAGTCCACATCACAAGTAATGAACATTTTGTGGG AACTTTGTTTGACCTCAAACATCAAAAGCCAGACAGTCCCTTC

TTATGATCAGCATCACTTTGGATTTTGGTACAGCATTGCTCATCCTTCTGTGATCTGT ACTGATGATAAAGGTGTTTTTGCGACATACCTTTCTCAAGA

ATATCAACTGGCAGCAGAAACATTTAATTTGACCCCATTTCAGGTGTGGGATCTGTCCTATGAATCCATCAACTACATCTTTGCTTGTGACAACACCAGA

TCTGAACTGAGAAAAAGGTGGACTCACTTGAAGCAGAAAGTGTTAAACTGTAATGAGGTGAACTACTTTTGATTATACATTGTAGCCAAGATCTTCCTGC

CCTGTGTATCCTACTCAGTTACTGCCCACTTGAAATGACTTCCCTTGAATTTGGGTAGCCAAGTATATATGGGGTCTAACTCCAGCCCCTTCAACTGGTA

AGTTCGAGGTTTTGCATGGCTGCACTTCCATGCTGCTTTTGCTGGAGGGTTGTTTAGCCCTCATTTCCTAGTGACTCTTGTTTTTACACTTAGTGCTCTT

TAGACATTTGTGACCGTGAACCTTCTGAGAAGTTGAAACTCTTTGTCTTCAGGGAAATCTCTGTTTTGTTAGGTTTAATCAGACTCCTTCCACTTCCTTT

TACCCTTTCAAGTATTAACTTTTTTAGACTGTTGATGTTAGGTCACAGTGCACACCTGAACTGTTTGTGTGGGTGCCTAGTTGTCAGGTGACTGTAGTAA

CAAAGCTAGAATCTGGCTTTGCCCTTCTCCTAATATCTTTAGAAATATATAACGGGGGTTGGAGTAATCCCTTCAGTTTAAGAAAAGAAAAGAACGACTG

GCTTGAAGTAAAAAAGACACATAGCTGGAGCTTCTGATTTAAAATCAGGTTCTATTTGGCTTCCTTGTGGAAGCTACCAGGACCTCTACAGTGCTAGGAC

TCTCTTAAAAGATCTTTGTAGCAATGGTAGCATTGTGGCTTCTAGGGTTCTTAGATCACCAATAATCCCATGCCCACATGATAGCCTACAGGTATAGACT

TATATAAACACACATATACCATGGCCACATTAGCCGACTTTAGCAGATAACAAATGTCTTGGTTGGTTTTTTTCACAAGCTAGAGTCATTTGGGAAGAGG

GACCCTCAACTGAGAAAATATTCCCACAAGATTGGCCCAATCAGTGCTTGATCAGTTAGTGGGCCCATGCCACAGAGGGTGATACCACCCTTAGGGACAT

GGTTCTGGGTGGAAAGCAAAGGAAATGGAACAAGGCACGAGGAGCAAGCCATAGGCAACACTCCTCCATGGCTTCAGCTTTAGTTCCTGCCTCAACTTCC

CAGGATGACAGACTACAAATTATAAGAGGAAATAACCCTTTCCTCCTTACATTACATTTGGTTATGGTGTTTTGTCACAGCATTAAAAACACTAAAACAA

TAA
Translation
 - UNI18727 -  - UNI24365 - - UNI24899 -  MAIDRRGGPTIARETVELAKEFFLSTENTVLGLDLSGDPT IGQANDFLEPLLEAKKA

GLKLALHLAE IPNREKENQMLLSLLPDRIGHGTFLSASEAGALDQVDFVRQHQIPLV VLEANAELYMCRAGPLLLRHIPTQNKSTSQVMNILWE ELC

LTSNIKSQTVPSYDQHHFGFWYSIAHPSVIC TDDKGVFATYLSQEYQLAAETFNLTPFQVWDLSYESINYIFACDNTRSELRKRWTHLKQKVLNCNEVN

YF
Transcript ENSMUST00000110662
Sequence
GCGCACGTATCCGTGTGCGGCAAGCGATCGTTTGCTGAGGGAGCTGCTGTCGTTGGTGCTCTGGACCGTTCCCGCCCGGCGCTGGCGGCCTCGCGGGCCC

ATGACGAGAAGGTGCTCAGCAATACTGCACACAGAACACTTACCGAGCTCCCGCTCATCCGCTTCTGG - UNI18727 - GTGAAAGTGATCCCAGAG

CCACACATAGTGCAAGTCTTGTTTAAAATGGCAATCTGAAGGAAGTCCAGCACCTCAGAGATTCCCACTTTGATAAGTTTATCGTCCAAGCCGAGAATAA

GAGCAAAGAGAAACTTTTCCTTCTACTGAAGTGATGGAGGCCGGACAGCAGTGGCCTGGGAAGACAGACTTTTATCTGCAATTACCAAAAGTG - UNI2

4365 - - UNI24899 - ATGTTTCCAGATGTTCCAAGTTATACATCAGCTTACTACTAGTGCTGAGGACATCCTGATG - UNI24365 - GTCAC

AAAAGACGTCATTAAGGAATTTGCAGATGATGGTGTCAAGTACCTGGAGCTGAGGAGCACTCCCAGAGAAGAAAATGCTACTG GTATTTGATGGCAATT

GACAGAAGAGGTGGCCCAACAATAGCCAGGGAGACTGTCGAACTTGCTAAAGAGTTCTTCCTCTCTACTGAGAATACAGTTCTTGGCCTTGACCTCAGTG

GAGATCCAACT ATAGGACAAGCTAACGACTTCTTGGAGCCTCTTTTAGAAGCTAAAAAAGCAGGTCTGAAGTTGGCATTGCATCTTGCCGAG ATTCCA

AACAGGGAAAAAGAAAATCAGATGCTGCTGAGTCTGCTCCCTGACAGAATTGGGCATGGGACATTCCTTAGCGCCTCTGAGGCAGGGGCCCTGGACCAAG

TGGACTTCGTGAGGCAACACCAGATACCCCTCG AACTTTGTTTGACCTCAAACATCAAAAGCCAGACAGTCCCTTCTTATGATCAGCATCACTTTGGAT

TTTGGTACAGCATTGCTCATCCTTCTGTGATCTGT ACTGATGATAAAGGTGTTTTTGCGACATACCTTTCTCAAGAATATCAACTGGCAGCAGAAACAT

TTAATTTGACCCCATTTCAGGTGTGGGATCTGTCCTATGAATCCATCAACTACATCTTTGCTTGTGACAACACCAGATCTGAACTGAGAAAAAGGTGGAC

TCACTTGAAGCAGAAAGTGTTAAACTGTAATGAGGTGAACTACTTTTGATTATACATTGTAGCCAAGATCTTCCTGCCCTGTGTATCCTAC
Translation
 - UNI18727 -  - UNI24365 - - UNI24899 -  - UNI24365 -  MAIDRRGGPTIARETVELAKEFFLSTENTVLGLDLSGDPT IGQ

ANDFLEPLLEAKKAGLKLALHLAE IPNREKENQMLLSLLPDRIGHGTFLSASEAGALDQVDFVRQHQIPLE ELCLTSNIKSQTVPSYDQHHFGFWYSI

AHPSVIC TDDKGVFATYLSQEYQLAAETFNLTPFQVWDLSYESINYIFACDNTRSELRKRWTHLKQKVLNCNEVNYF

For any suggestions or comments, please send an email to unitrap@crg.es