Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027286 (Lrrc57)
Chromosomal location
Chr 2: 120429974 - 120435256 (-)
Description
leucine rich repeat containing 57 Gene [Source:MGI (curated);Acc:Lrrc57-003]
RefSeq_dna
NM_025657 
RefSeq_peptide
NP_079933.2 
UniGene
Mm.472027 
MGI
MGI:1913856 
Uniprot/SWISSPROT
Q9D1G5 
Uniprot/SPTREMBL
A2AKH7 B0R031 Q8JZX5 Q9CTX7 Q9CSK4 
Human Ortholog
ENSG00000180979 (LRRC57)
Omim not available
UniTrap UNI23877
Vector Insertion
Chr 2: 120433804 - 120434408
Public Clones not available
Private Clones OST241781 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090011
Sequence
GGGCGTTCCTGCCCGGGCGGAAGCCCTGGG CGCGTCTCAGGCGAGCGCGGGTCCCCGGTGTTCCCTGGCGGAGTCTTCTTTGCACTGAGCGGTAGGAG 

GGAACTGAGCCGTGGCGCTAGGATGGGTAACAGTGCTCTCCGTGCTCATGTGGAAACAGCGCAGAAAACTGGTGTCTTTCAGCTTAAAGACCGTGGTCTG

ACCGAG TTCCCCTCAGAGTTGCAGAAGCTGACAAGCAATCTTAGGACCATCGATTTATCCAACAACAAGATTGACAGCCTACCGCCTCTGATAATAGGA

AAGTTCACTCTGCTAAAGAGCCTCTCCCTCAACAACAACAAACTGA - UNI23877 - CTGTTCTACCTGATGAATTATGCAATCTGAAAAAACTAGA

GACACTAAGTCTCAACAACAATCACCTGAGAGAGCTACCATCTACCTTTGGGCAGTTGTCTGCCCTGAAGACGCTGAGCCTCTCTGGGAATCAGCTGGGA

GCATTACCCCCCCAGCTTTGTTGCCTGAGACATCTAGATGTAGTAGATCTCTCTAAAAACCAGATTCGGAGTATACCTGACACAGTTGGGGAGCTGCAGG

CCATCGAACTCAATCTCAACCAGAACCAG ATCTCTCAGCTCTCTGTGAAGATATCCTGCTGTCCTCGCCTCAAGGTCCTCCGGCTGGAAGAGAACTGCC

TTGAGCTCAGCATGCTTCCACAGAGCATCCTCAGTGACTCCCAAATCTGCCTGCTTGCTGTGGAAGGCAATCTCTTTGAAATAAAGAAACTTCGAGAACT

AGAGGGTTATGATAAG TACATGGAGAGGTTCACAGCCACCAAGAAGAAATTTGCATGATATTCTCCAGGATCATGGGACAGACTTGGAACCTCTGTTGA

AATCTGACTGAGTCAAAGGCTCCTGATGTTGGATACACTGCAGAGAACATTTTACTTAATGACTTTTTCCTTTTTAGGACTATGTCAGATAAGCTGAAGG

AAAGGGATTTAGGAGTAGGAGACAGGAAGAACCCTTCATCTTGAGCCGTGTAGGTCATGGCCAGTGTTGATCTTCAAAACTATCATTAGTTGGGCTCTAA

GGAACCTGCTGTTCATGAAGGGAGGAAATGCTGCTTGCCATAGCTGGAGACTTTGAGTTTGCGAACTGTCAGCTTTCATAAAGTCTTTCCCATCACCTCT

GTGTTAATACTTCATATTTTTTATGAAATTCTAATTTGTGGGAAACGTATGACTAAGGATGAATGTGTTTGTTCCTGTACACTAACTCAATAGCAGTGTT

TACACTTGGAACTTAGGATGTACCTAAATATGTAGCTGTCTTGAAGAGACCTTTGTCAAAGGAGCACCAACACAACAGCCACCGAGAATGTTCCCCAAGG

CTGCAGTAGCAAATTTTTTTTTTTTTACTATTGCAGGTGCCTTATTGGTAGAAGGCTCTGAAAGAGCTAAAACTATATGCAAAAATTATACAAAATTTTT

GTTTTTAGACAGGTTTTTGCTATGTAGCCCAGGCTGGCCTCAGACTCAAAATCTCCCAACCTCACACCTCTCCCCTCCCCCACATGCTGGGATTGTAGGC

ATGCGCTACACTCAGCCTACTTGTAGGATTTTAAATTAATTTTAATAATCAAGATTTTCCTGAAGCTTTGTTAAAAATCATGTGCTATTTCTGGTAACTC

CTCCCCCTTTTGTATTTATAACTGTACTAATCAGATTACCTTCAAGAAAACCATTGCTACAATATTTTAAAATAACTTATGTTTATCATAGTTACTCTCT

GAATGAGAGAATATTCTAAATAAAATATTTTTAATG
Translation
GRSCPGGSPG RVSGERGSPVFPGGVFFALSGRR RELSRGARMGNSALRAHVETAQKTGVFQLKDRGLTE FPSELQKLTSNLRTIDLSNNKIDSLPPL

IIGKFTLLKSLSLNNNKLT - UNI23877 - TVLPDELCNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKN

QIRSIPDTVGELQAIELNLNQNQ ISQLSVKISCCPRLKVLRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDK YMERFTATKKKFA

Transcript ENSMUST00000028742
Sequence
GGAAGCCCTGGGAGCGCGTCTCAGGCGAGCGCGGGTCCCCGGTGTTCCCTGGCGGAGTCTTCTTTGCACTGAGCGGTAGGAGGCGAGTCTCAAGCTCCCT

GTTCCGGCAGCAGCTATCGGAGGCTCCCTGGCCCTTAGCTCTGCTGCCAAAGCATCAGGACCTTGTGGTAGCGCTGCCTGCTCGCCTGTTTTCTCCTTGC

CACTCTTGGGCTGGCCCCAGGGAAGTAGGGATAGGCAGAAG GGAACTGAGCCGTGGCGCTAGGATGGGTAACAGTGCTCTCCGTGCTCATGTGGAAACA

GCGCAGAAAACTGGTGTCTTTCAGCTTAAAGACCGTGGTCTGACCGAG TTCCCCTCAGAGTTGCAGAAGCTGACAAGCAATCTTAGGACCATCGATTTA

TCCAACAACAAGATTGACAGCCTACCGCCTCTGATAATAGGAAAGTTCACTCTGCTAAAGAGCCTCTCCCTCAACAACAACAAACTGA - UNI23877 

- CTGTTCTACCTGATGAATTATGCAATCTGAAAAAACTAGAGACACTAAGTCTCAACAACAATCACCTGAGAGAGCTACCATCTACCTTTGGGCAGTTG

TCTGCCCTGAAGACGCTGAGCCTCTCTGGGAATCAGCTGGGAGCATTACCCCCCCAGCTTTGTTGCCTGAGACATCTAGATGTAGTAGATCTCTCTAAAA

ACCAGATTCGGAGTATACCTGACACAGTTGGGGAGCTGCAGGCCATCGAACTCAATCTCAACCAGAACCAG ATCTCTCAGCTCTCTGTGAAGATATCCT

GCTGTCCTCGCCTCAAGGTCCTCCGGCTGGAAGAGAACTGCCTTGAGCTCAGCATGCTTCCACAGAGCATCCTCAGTGACTCCCAAATCTGCCTGCTTGC

TGTGGAAGGCAATCTCTTTGAAATAAAGAAACTTCGAGAACTAGAGGGTTATGATAAG TACATGGAGAGGTTCACAGCCACCAAGAAGAAATTTGCATG

ATATTCTCCAGGATCATGGGACAGACTTGGAACCTCTGTTGAAATCTGACTGAGTCAAAGGCTCCTGATGTTGGATACACTGCAGAGAACATTTTACTTA

ATGACTTTTTCCTTTTTAGGACTATGTCAGATAAGCTGAAGGAAAGGGATTTAGGAGTAGGAGACAGGAAGAACCCTTCATCTTGAGCCGTGTAGGTCAT

GGCCAGTGTTGATCTTCAAAACTATCATTAGTTGGGCTCTAAGGAACCTGCTGTTCATGAAGGGAGGAAATGCTGCTTGCCATAGCTGGAGACTTTGAGT

TTGCGAACTGTCAGCTTTCATAAAGTCTTTCCCATCACCTCTGTGTTAATACTTCATATTTTTTATGAAATTCTAATTTGTGGGAAACGTATGACTAAGG

ATGAATGTGTTTGTTCCTGTACACTAACTCAATAGCAGTGTTTACACTTGGAACTTAGGATGTACCTAAATATGTAGCTGTCTTGAAGAGACCTTTGTCA

AAGGAGCACCAACACAACAGCCACCGAGAATGTTCCCCAAGGCTGCAGTAGCAAATTTTTTTTTTTTTACTATTGCAGGTGCCTTATTGGTAGAAGGCTC

TGAAAGAGCTAAAACTATATGCAAAAATTATACAAAATTTTTGTTTTTAGACAGGTTTTTGCTATGTAGCCCAGGCTGGCCTCAGACTCAAAATCTCCCA

ACCTCACACCTCTCCCCTCCCCCACATGCTGGGATTGTAGGCATGCGCTACACTCAGCCTACTTGTAGGATTTTAAATTAATTTTAATAATCAAGATTTT

CCTGAAGCTTTGTTAAAAATCATGTGCTATTTCTGGTAACTCCTCCCCCTTTTGTATTTATAACTGTACTAATCAGATTACCTTCAAGAAAACCATTGCT

ACAATATTTTAAAATAACTTATGTTTATCATAGTTACTCTCTGAATGAGAGAATATTCTAAATAAAATATTTTTAATG
Translation
KPWERVSGERGSPVFPGGVFFALSGRRRVSSSLFRQQLSEAPWPLALLPKHQDLVVALPARLFSPCHSWAGPREVGIGRR RELSRGARMGNSALRAHVE

TAQKTGVFQLKDRGLTE FPSELQKLTSNLRTIDLSNNKIDSLPPLIIGKFTLLKSLSLNNNKLT - UNI23877 - TVLPDELCNLKKLETLSLNNN

HLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKNQIRSIPDTVGELQAIELNLNQNQ ISQLSVKISCCPRLKVLRLEENCLELSMLP

QSILSDSQICLLAVEGNLFEIKKLRELEGYDK YMERFTATKKKFA
Transcript ENSMUST00000102497
Sequence
GGAAGCCCTGGGAGCGCGTCTCAGGCGAGCGCGGGTCCCCGGTGTTCCCTGGCGGAGTCTTCTTTGCACTGAGCGGTAGGAGGCGAGTCTCAAGCTCCCT

GTTCCGGCAGCAGCTATCGGAGGCTCCCTGGCCCTTAGCTCTGCTGCCAAAGCATCAGGACCTTGTGGTAGCGCTGCCTGCTCGCCTGTTTTCTCCTTGC

CACTCTTGGGCTGGCCCCAGGGAAGTAGGGATAGGCAGAAG GGAACTGAGCCGTGGCGCTAGGATGGGTAACAGTGCTCTCCGTGCTCATGTGGAAACA

GCGCAGAAAACTGGTGTCTTTCAGCTTAAAGACCGTGGTCTGACCGAG TTCCCCTCAGAGTTGCAGAAGCTGACAAGCAATCTTAGGACCATCGATTTA

TCCAACAACAAGATTGACAGCCTACCGCCTCTGATAATAGGAAAGTTCACTCTGCTAAAGAGCCTCTCCCTCAACAACAACAAACTGA - UNI23877 

- CTGTTCTACCTGATGAATTATGCAATCTGAAAAAACTAGAGACACTAAGTCTCAACAACAATCACCTGAGAGAGCTACCATCTACCTTTGGGCAGTTG

TCTGCCCTGAAGACGCTGAGCCTCTCTGGGAATCAGCTGGGAGCATTACCCCCCCAGCTTTGTTGCCTGAGACATCTAGATGTAGTAGATCTCTCTAAAA

ACCAGATTCGGAGTATACCTGACACAGTTGGGGAGCTGCAGGCCATCGAACTCAATCTCAACCAGAACCAG ATCTCTCAGCTCTCTGTGAAGATATCCT

GCTGTCCTCGCCTCAAGGTCCTCCGGCTGGAAGAGAACTGCCTTGAGCTCAGCATGCTTCCACAGAGCATCCTCAGTGACTCCCAAATCTGCCTGCTTGC

TGTGGAAGGCAATCTCTTTGAAATAAAGAAACTTCGAGAACTAGAGGGTTATGATAAG TACATGGAGAGGTTCACAGCCACCAAGAAGAAATTTGCATG

ATATTCTCCAGGATCATGGGACAGACTTGGAACCTCTGTTGAAATCTGACTGAGTCAAAGGCTCCTGATGTTGGATACACTGCAGAGAACATTTTACTTA

ATGACTTTTTCCTTTTTAGGACTATGTCAGATAAGCTGAAGGAAAGGGATTTAGGAGTAGGAGACAGGAAGAACCCTTCATCTTGAGCCGTGTAGGTCAT

GGCCAGTGTTGATCTTCAAAACTATCATTAGTTGGGCTCTAAGGAACCTGCTGTTCATGAAGGGAGGAAATGCTGCTTGCCATAGCTGGAGACTTTGAGT

TTGCGAACTGTCAGCTTTCATAAAGTCTTTCCCATCACCTCTGTGTTAATACTTCATATTTTTTATGAAATTCTAATTTGTGGGAAACGTATGACTAAGG

ATGAATGTGTTTGTTCCTGTACACTAACTCAATAGCAGTGTTTACACTTGGAACTTAGGATGTACCTAAATATGTAGCTGTCTTGAAGAGACCTTTGTCA

AAGGAGCACCAACACAACAGCCACCGAGAATGTTCCCCAAGGCTGCAGTAGCAAATTTTTTTTTTTTTACTATTGCAGGTGCCTTATTGGTAGAAGGCTC

TGAAAGAGCTAAAACTATATGCAAAAATTATACAAAATTTTTGTTTTTAGACAGGTTTTTGCTATGTAGCCCAGGCTGGCCTCAGACTCAAAATCTCCCA

ACCTCACACCTCTCCCCTCCCCCACATGCTGGGATTGTAGGCATGCGCTACACTCAGCCTACTTGTAGGATTTTAAATTAATTTTAATAATCAAGATTTT

CCTGAAGCTTTGTTAAAAATCATGTGCTATTTCTGGTAACTCCTCCCCCTTTTGTATTTATAACTGTACTAATCAGATTACCTTCAAGAAAACCATTGCT

ACAATATTTTAAAATAACTTATGTTTATCATAGTTACTCTCTGAATGAGAGAATATTCTAAATAAAATATTTTTAATG
Translation
 MGNSALRAHVETAQKTGVFQLKDRGLTE FPSELQKLTSNLRTIDLSNNKIDSLPPLIIGKFTLLKSLSLNNNKLT - UNI23877 - TVLPDELCN

LKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKNQIRSIPDTVGELQAIELNLNQNQ ISQLSVKISCCPRLKVLR

LEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDK YMERFTATKKKFA
Transcript ENSMUST00000102498
Sequence
GCAGTAACCCAGCTGCAGTCTGCGAGGACGCTGGGTCCCACGGGTTGGCGGCCGCCATGGCTTCCGCACACCTCTGGAACTGGCGCGAGGAGTGAGGGGC

AACACCGCGAACAGGCGCGCGGTTTGATGATGTCACAGGGCGTTCCTGCCCGGGCGGAAGCCCTGGGAGCGCGTCTCAGGCGAGCGCGG CCGTGGCGCT

AGGATGGGTAACAGTGCTCTCCGTGCTCATGTGGAAACAGCGCAGAAAACTGGTGTCTTTCAGCTTAAAGACCGTGGTCTGACCGAG TTCCCCTCAGAG

TTGCAGAAGCTGACAAGCAATCTTAGGACCATCGATTTATCCAACAACAAGATTGACAGCCTACCGCCTCTGATAATAGGAAAGTTCACTCTGCTAAAGA

GCCTCTCCCTCAACAACAACAAACTGA - UNI23877 - CTGTTCTACCTGATGAATTATGCAATCTGAAAAAACTAGAGACACTAAGTCTCAACAAC

AATCACCTGAGAGAGCTACCATCTACCTTTGGGCAGTTGTCTGCCCTGAAGACGCTGAGCCTCTCTGGGAATCAGCTGGGAGCATTACCCCCCCAGCTTT

GTTGCCTGAGACATCTAGATGTAGTAGATCTCTCTAAAAACCAGATTCGGAGTATACCTGACACAGTTGGGGAGCTGCAGGCCATCGAACTCAATCTCAA

CCAGAACCAG ATCTCTCAGCTCTCTGTGAAGATATCCTGCTGTCCTCGCCTCAAGGTCCTCCGGCTGGAAGAGAACTGCCTTGAGCTCAGCATGCTTCC

ACAGAGCATCCTCAGTGACTCCCAAATCTGCCTGCTTGCTGTGGAAGGCAATCTCTTTGAAATAAAGAAACTTCGAGAACTAGAGGGTTATGATAAG TA

CATGGAGAGGTTCACAGCCACCAAGAAGAAATTTGCATGATATTCTCCAGGATCATGGGACAGACTTGGAACCTCTGTTGAAATCTGACTGAGTCAAAGG

CTCCTGATGTTGGATACACTGCAGAGAACATTTTACTTAATGACTTTTTCCTTTTTAGGACTATGTCAGATAAGCTGAAGGAAAGGGATTTAGGAGTAGG

AGACAGGAAGAACCCTTCATCTTGAGCCGTGTAGGTCATGGCCAGTGTTGATCTTCAAAACTATCATTAGTTGGGCTCTAAGGAACCTGCTGTTCATGAA

GGGAGGAAATGCTGCTTGCCATAGCTGGAGACTTTGAGTTTGCGAACTGTCAGCTTTCATAAAGTCTTTCCCATCACCTCTGTGTTAATACTTCATATTT

TTTATGAAATTCTAATTTGTGGGAAACGTATGACTAAGGATGAATGTGTTTGTTCCTGTACACTAACTCAATAGCAGTGTTTACACTTGGAACTTAGGAT

GTACCTAAATATGTAGCTGTCTTGAAGAGACCTTTGTCAAAGGAGCACCAACACAACAGCCACCGAGAATGTTCCCCAAGGCTGCAGTAGCAAATTTTTT

TTTTTTTACTATTGCAGGTGCCTTATTGGTAGAAGGCTCTGAAAGAGCTAAAACTATATGCAAAAATTATACAAAATTTTTGTTTTTAGACAGGTTTTTG

CTATGTAGCCCAGGCTGGCCTCAGACTCAAAATCTCCCAACCTCACACCTCTCCCCTCCCCCACATGCTGGGATTGTAGGCATGCGCTACACTCAGCCTA

CTTGTAGGATTTTAAATTAATTTTAATAATCAAGATTTTCCTGAAGCTTTGTTAAAAATCATGTGCTATTTCTGGTAACTCCTCCCCCTTTTGTATTTAT

AACTGTACTAATCAGATTACCTTCAAGAAAACCATTGCTACAATATTTTAAAATAACTTATGTTTATCATAGTTACTCTCTGAATGAGAGAATATTCTAA

ATAAAATATTTTTAATGAA
Translation
 MGNSALRAHVETAQKTGVFQLKDRGLTE FPSELQKLTSNLRTIDLSNNKIDSLPPLIIGKFTLLKSLSLNNNKLT - UNI23877 - TVLPDELCN

LKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKNQIRSIPDTVGELQAIELNLNQNQ ISQLSVKISCCPRLKVLR

LEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDK YMERFTATKKKFA
Transcript ENSMUST00000102499
Sequence
AAGTGGTTTAGCAGTAACCCAGCTGCAGTCTGCGAGGACGCTGGGTCCCACGGGTTGGCGGCCGCCATGGCTTCCGCACACCTCTGGAACTGGCGCGAGG

AGTGAGGGGCAACACCGCGAACAGGCGCGCGGTTTGATGATGTCACAGGGCGTTCCTGCCCGGGCGGAAGCCCTGGGAGCGCGTCTCAGGCGAGCGCGGG

TCCCCGGTGTTCCCTGGCGGAGTCTTCTTTGCACTGAGCG GGAACTGAGCCGTGGCGCTAGGATGGGTAACAGTGCTCTCCGTGCTCATGTGGAAACAG

CGCAGAAAACTGGTGTCTTTCAGCTTAAAGACCGTGGTCTGACCGAG TTCCCCTCAGAGTTGCAGAAGCTGACAAGCAATCTTAGGACCATCGATTTAT

CCAACAACAAGATTGACAGCCTACCGCCTCTGATAATAGGAAAGTTCACTCTGCTAAAGAGCCTCTCCCTCAACAACAACAAACTGA - UNI23877 -

 CTGTTCTACCTGATGAATTATGCAATCTGAAAAAACTAGAGACACTAAGTCTCAACAACAATCACCTGAGAGAGCTACCATCTACCTTTGGGCAGTTGT

CTGCCCTGAAGACGCTGAGCCTCTCTGGGAATCAGCTGGGAGCATTACCCCCCCAGCTTTGTTGCCTGAGACATCTAGATGTAGTAGATCTCTCTAAAAA

CCAGATTCGGAGTATACCTGACACAGTTGGGGAGCTGCAGGCCATCGAACTCAATCTCAACCAGAACCAG ATCTCTCAGCTCTCTGTGAAGATATCCTG

CTGTCCTCGCCTCAAGGTCCTCCGGCTGGAAGAGAACTGCCTTGAGCTCAGCATGCTTCCACAGAGCATCCTCAGTGACTCCCAAATCTGCCTGCTTGCT

GTGGAAGGCAATCTCTTTGAAATAAAGAAACTTCGAGAACTAGAGGGTTATGATAAG TACATGGAGAGGTTCACAGCCACCAAGAAGAAATTTGCATGA

TATTCTCCAGGATCATGGGACAGACTTGGAACCTCTGTTGAAATCTGACTGAGTCAAAGGCTCCTGATGTTGGATACACTGCAGAGAACATTTTACTTAA

TGACTTTTTCCTTTTTAGGACTATGTCAGATAAGCTGAAGGAAAGGGATTTAGGAGTAGGAGACAGGAAGAACCCTTCATCTTGAGCCGTGTAGGTCATG

GCCAGTGTTGATCTTCAAAACTATCATTAGTTGGGCTCTAAGGAACCTGCTGTTCATGAAGGGAGGAAATGCTGCTTGCCATAGCTGGAGACTTTGAGTT

TGCGAACTGTCAGCTTTCATAAAGTCTTTCCCATCACCTCTGTGTTAATACTTCATATTTTTTATGAAATTCTAATTTGTGGGAAACGTATGACTAAGGA

TGAATGTGTTTGTTCCTGTACACTAACTCAATAGCAGTGTTTACACTTGGAACTTAGGATGTACCTAAATATGTAGCTGTCTTGAAGAGACCTTTGTCAA

AGGAGCACCAACACAACAGCCACCGAGAATGTTCCCCAAGGCTGCAGTAGCAAATTTTTTTTTTTTTACTATTGCAGGTGCCTTATTGGTAGAAGGCTCT

GAAAGAGCTAAAACTATATGCAAAAATTATACAAAATTTTTGTTTTTAGACAGGTTTTTGCTATGTAGCCCAGGCTGGCCTCAGACTCAAAATCTCCCAA

CCTCACACCTCTCCCCTCCCCCACATGCTGGGATTGTAGGCATGCGCTACACTCAGCCTACTTGTAGGATTTTAAATTAATTTTAATAATCAAGATTTTC

CTGAAGCTTTGTTAAAAATCATGTGCTATTTCTGGTAACTCCTCCCCCTTTTGTATTTATAACTGTACTAATCAGATTACCTTCAAGAAAACCATTGCTA

CAATATTTTAAAATAACTTATGTTTATCATAGTTACTCTCTGAATGAGAGAATATTCTAAATAAAATATTTTTAATGAA
Translation
 MGNSALRAHVETAQKTGVFQLKDRGLTE FPSELQKLTSNLRTIDLSNNKIDSLPPLIIGKFTLLKSLSLNNNKLT - UNI23877 - TVLPDELCN

LKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKNQIRSIPDTVGELQAIELNLNQNQ ISQLSVKISCCPRLKVLR

LEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDK YMERFTATKKKFA
Transcript ENSMUST00000102496
Sequence
GGTGTTCCCTGGCGGAGTCTTCTTTGCACTGAGCGGTAGGAGGCGAGTCTCAAGCTCCCTGTTCCGGCAGCAGCTATCGGAGGCTCCCTGGCCCTTAGCT

CTGCTGCCAAAGCATCAGGACCTTGTG GGAACTGAGCCGTGGCGCTAGGATGGGTAACAGTGCTCTCCGTGCTCATGTGGAAACAGCGCAGAAAACTGG

TGTCTTTCAGCTTAAAGACCGTGGTCTGACCGAG TTCCCCTCAGAGTTGCAGAAGCTGACAAGCAATCTTAGGACCATCGATTTATCCAACAACAAGAT

TGACAGCCTACCGCCTCTGATAATAGGAAAGTTCACTCTGCTAAAGAGCCTCTCCCTCAACAACAACAAACTGA - UNI23877 - CTGTTCTACCTG

ATGAATTATGCAATCTGAAAAAACTAGAGACACTAAGTCTCAACAACAATCACCTGAGAGAGCTACCATCTACCTTTGGGCAGTTGTCTGCCCTGAAGAC

GCTGAGCCTCTCTGGGAATCAGCTGGGAGCATTACCCCCCCAGCTTTGTTGCCTGAGACATCTAGATGTAGTAGATCTCTCTAAAAACCAGATTCGGAGT

ATACCTGACACAGTTGGGGAGCTGCAGGCCATCGAACTCAATCTCAACCAGAACCAG ATCTCTCAGCTCTCTGTGAAGATATCCTGCTGTCCTCGCCTC

AAGGTCCTCCGGCTGGAAGAGAACTGCCTTGAGCTCAGCATGCTTCCACAGAGCATCCTCAGTGACTCCCAAATCTGCCTGCTTGCTGTGGAAGGCAATC

TCTTTGAAATAAAGAAACTTCGAGAACTAGAGGGTTATGATAAG TACATGGAGAGGTTCACAGCCACCAAGAAGAAATTTGCATGATATTCTCCAGGAT

CATGGGACAGACTTGGAACCTCTGTTGAAATCTGACTGAGTCAAAGGCTCCTGATGTTGGATACACTGCAGAGAACATTTTACTTAATGACTTTTTCCTT

TTTAGGACTATGTCAGATAAGCTGAAGGAAAGGGATTTAGGAGTAGGAGACAGGAAGAACCCTTCATCTTGAGCCGTGTAGGTCATGGCCAGTGTTGATC

TTCAAAACTATCATTAGTTGGGCTCTAAGGAACCTGCTGTTCATGAAGGGAGGAAATGCTGCTTGCCATAGCTGGAGACTTTGAGTTTGCGAACTGTCAG

CTTTCATAAAGTCTTTCCCATCACCTCTGTGTTAATACTTCATATTTTTTATGAAATTCTAATTTGTGGGAAACGTATGACTAAGGATGAATGTGTTTGT

TCCTGTACACTAACTCAATAGCAGTGTTTACACTTGGAACTTAGGATGTACCTAAATATGTAGCTGTCTTGAAGAGACCTTTGTCAAAGGAGCACCAACA

CAACAGCCACCGAGAATGTTCCCCAAGGCTGCAGTAGCAAATTTTTTTTTTTTTACTATTGCAGGTGCCTTATTGGTAGAAGGCTCTGAAAGAGCTAAAA

CTATATGCAAAAATTATACAAAATTTTTGTTTTTAGACAGGTTTTTGCTATGTAGCCCAGGCTGGCCTCAGACTCAAAATCTCCCAACCTCACACCTCTC

CCCTCCCCCACATGCTGGGATTGTAGGCATGCGCTACACTCAGCCTACTTGTAGGATTTTAAATTAATTTTAATAATCAAGATTTTCCTGAAGCTTTGTT

AAAAATCATGTGCTATTTCTGGTAACTCCTCCCCCTTTTGTATTTATAACTGTACTAATCAGATTACCTTCAAGAAAACCATTGCTACAATATTTTAAAA

TAACTTATGTTTATCATAGTTACTCTCTGAATGAGAGAATATTCTAAATAAAATATTTTTAATGAA
Translation
 MGNSALRAHVETAQKTGVFQLKDRGLTE FPSELQKLTSNLRTIDLSNNKIDSLPPLIIGKFTLLKSLSLNNNKLT - UNI23877 - TVLPDELCN

LKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKNQIRSIPDTVGELQAIELNLNQNQ ISQLSVKISCCPRLKVLR

LEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDK YMERFTATKKKFA

For any suggestions or comments, please send an email to unitrap@crg.es