Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027326 (Casc5)
Chromosomal location
Chr 2: 118872855 - 118931237 (+)
Description
cancer susceptibility candidate 5 Gene [Source:MGI (curated);Acc:Casc5-004]
RefSeq_dna
NM_029617 
RefSeq_peptide
NP_083893.2 
UniGene
Mm.202518 
MGI
MGI:1923714 
Uniprot/SWISSPROT
Q66JQ7 
Uniprot/SPTREMBL
A3KGI3 A3KGI5 A3KGI6 Q9CYF0 A3KGI4 
Human Ortholog
ENSG00000137812 (CASC5)
Omim not available
UniTrap UNI15836
Vector Insertion
Chr 2: 118873297 - 118883016
Public Clones E122B10 (ggtc) IST14231B2 (tigm)
Private Clones OST471984 (lexicon) OST470183 (lexicon) OST434038 (lexicon) OST246134 (lexicon)
OST132967 (lexicon) OST103099 (lexicon) OST91970 (lexicon) OST68407 (lexicon)
OST57673 (lexicon) OST48113 (lexicon) OST43139 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26532
Vector Insertion
Chr 2: 118884131 - 118885279
Public Clones not available
Private Clones OST112403 (lexicon) OST96762 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9543
Vector Insertion
Chr 2: 118889834 - 118891684
Public Clones XE395 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3892
Vector Insertion
Chr 2: 118898656 - 118901967
Public Clones AW0098 (sanger) RRU368 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099542
Sequence
ACTGAGCATGCGCATCACTAGGGCGGTTAGATTTGAATACTTCAGGGACGTTGAGAGGTGACGTCCGACTCCAAGGAGCGCGAGGACCCCAGACAAGTCA

AGCAG - UNI15836 - AAAAAAGTTTTCAAAAATGGATGGGGTATATTCAGAAGCTAATGAAGAGAA TGACAATACACAGAGACCTGTTAGAAGAC

AGCATTCCTCA - UNI26532 - ATTTTGAAACCCCCAAGGAGTCCTCTTCAGGACCTCAAATGTGGAAATCAAACAAACCAG GAACCTAATCCTCC

AAGAAAAAGGAAAAGCTCTCGTCGAGTCAGCTTTGCAGATACTATAAA AGTATTCCAGACAGAGTCTCACATGAAAACAGAGAGAAATTCAGAAATTTC

AG - UNI9543 - GTATGAACACTTTGCTTTGTGCTCCAATTCAGACTCAGATGCAACAAAAGGAG TTCTCAATTACAGACTGCAACCATGAAAGGA

AACATGCAAATGATCAGACAGTCATCTTTTCAGATGAAAACCAGATGGATCTGACAGCAAGTCACACTGTAATGATTACCAAAGGTCTTTCAGACTGTAC

CAAAAATGAAAATTCTACAAAAATAGATACCACGTCCTTTCTGGAGAATTTAAAGCATCATGCTGCAAATTCAAGAATTAAAAAGGATTTAGCATGTTCC

ACAGTTTCCTTAAGTCAAAACATTTTCTCAGAAAAGATCAATTCTGACAACTTCATAAAAAGATTGAAGACAGGAAAACATATTTCGTCTTCTACAGAGC

TTGATAAGGAAAATGCTGAGATACCTGTTTATTCCAAAGACTCAAACAGTGCCTCTTCAACATATCAAATGCATGCATCTCTTGGTGTAGATGAAAATAG

TAGTAATAGGACTAGAATCTTTAGAGAACAAGATGATGGTATGAATTTGACCCAATGTCATACAGCCTGTATTAAGACTTGGATTCCTCCATCCACGGAG

GCCAAAATAGGAGAATTCAAAGGTGATAAAACAATTTATGGCAATGAGTGTATGGAGTTGACAACTAACTATACGATACAGGTTTTGTCATCAGAAAATA

ATTTATCTGAAAGAGAAACTCAAACTCAAAATGGTATGAATGTTACAACAGTTGATGGAGCTACAGCTCCAGCTCCAGAGAAGAAAACAGCCCTTAAGGA

TAAACTAAATGCTGCTTTTCAAGGCTCTTTCCCAAACCCTGAAAATAAAATTCATATTATCAAATGTCATCCTATAGAGTCAGAAACTCATACAGTCACA

CAGATTTCTAGTCAAAGTGCCAGCACATTGGCTGTAACTTCAAAATCTATATGTTCTAGTCCAGCTATTGAGGGGTATAAGACAATTTTTCATTCTAGTA

GCAATGATGCAATGGAACTGACTAAGTGTCTATCAGCTATGGAAGAGGAAAAAAAATTGCTGAAGGCTGATGATAAGTATTCTAAAATATGTACCAATCC

AGATGCTGGCCCACTCAGAGAGAAAACTATTTATTTAGAAGAGGATAGCATGGACATTACCAAAAGTCACACCGTTGCAATAGATAATAAAATATTTAAA

CATGATCAAGAAAACATTAAAAAAGAAATAATAGCCATACCAATATTTGAAAAGGAAATGGTGCTCCGAAATCTTATGCCTATGTCAAAAGATGAGAAAA

GGGATGTAAATTATATTTCAGTTCCTCAAGTATCTAAGGAAAGCTTACAACGGAGTCAGACAAACACTTTATCTGTTTCATTGACTGACAAAAAGATGGA

ATTCTTGGCAGATGAAGATATGGATCTGACTAAAAGTCACACAACTAAGTTAAGTCAAGTTATTCCTACAACTTTTGACTTAGCATCAAAGAATGTCACC

AAATCATACTCTCACAGCAAAAGCCCTTTAAATGAGTGGGAAAGCCTGGATAAACAAGTAGTGCTAGGCCAGCATTCTAAACTTCCTTTACCACAGAGGA

AAGATAGAGATGATCCTGACTGTTCTCATCATAAGATAATGTATTCAGAGGAGTTACAAACTATGGATCTAACCAAGAGCCACACTATTGTAATTGGCTT

TGGTCCTTCTGAAGTACAAGAACATAGTAAAATTAATTTAGAACACAAAAACAGCCAACTTACAGCAGAAAGCATACAAACAGCTGTGAACGTTCCTGCA

GCAAACTCTAGAGTAGTAACAACTAATGATATGGACATGTTAAAGGACAGAAGTACACATAAGCCAGAATTGCTGAAGGAAAAGCAAAACATCAAAATCT

ATGGAAGAAAAAGTATTGGTAGACTGAAAATTGATAAAACTATATTATTTTCAGAGGGTAATGAGGGTGATATGGATATCACCAAGAGTTGCACAGTCAA

AATAAATCATAGATCTTTATTAGATAAGCATGATTCTCATTTAGTATCTTTGGCAGGAACTTCTAAAACCATTTTGCATGCACGTGGTCAGGTTGAAATG

GAAATCAATAGAAGTCACACAACTCCTTTAGAATGTAAAATTATCTCGCCCAGTGATATAACTCCTGGTGATCTGGATAAGACTATGATGTCTATAGATG

ATCATGAGGAACTAGACATGACCAAGTCCCATACTGTTTTCATTGACTACCAAGCAGAGGCAAAAGGTGTACTTCCAGACAGACTTGACTTTCAATTATC

CAAAAAGGAAAGCCTACAGAAGCCGAAAGTGACATCTCTGGCTGAAGAGATTTACATTTCAAAAAATAGTGAAAGCAACCATCTACCAGCAAAAGGCAGC

CAGCTAACAATATTAGAGGAAGGGTCTAATAGCGGGCTTGGAGAGGAAACTAATGATGCACAAAAGCCTGGATTTCTGAATGAACTTCTGTCAGGCAAAA

CTCAGAGAAGAAAAAGCCTTAGCCTCAAAAACAAGAGTATTACATTTCCAGAGAATGATAAAAGTTATAGAGAGATCCCTCAGAGTTCTGCAGTAGAAAT

AAATAATGAAACTAGGCTGGAAGACAGAAAGGGCTTCAGTTTTGTGCCATTGGCAGGAACTTCCAAACCAGTTTTGTCTGCATATGGGCCCGAGGACATG

GAGATTTCTATAGGTCAAACCACTGCTTCAGAATATAAAACTGTCCCACCAGAAGAAATAACTACTATACCTATGGATAAAACTGTAATGTTTGTAGATA

ATTTCGGTGATCTGGATGTCACCAGATCCCATACGGTTTTCATCGATTGTCAAGCCAAAGAAAAGGTACTTGATGAATATACTAACTTGGGAATACAGAA

AACAAAAACTTTGAGTGGTTCTGAAGGTGATACCCATATTCAAGAAATCACAAAAAACCCAGCAGCTCAACACAAACACCATATGACAACTGTTATTCCT

TCTAGTACAGTAGTTAGTGATCAAAGTTCAATGAAAATCAAGTTTCACAAAGCTGATAGAGATGAGGAGGTCAAAGGAAAGGAAGTGGAAGCCAATATGC

TGAAACAAACTAAACCTGAAAGCTGTCTGTTAAATATAACAGATGGAAAAAATGTGGATTTTACAAGCAGTTATACAGCTGATGTTTGTAGATCCAGTGA

CAAGTATTCCTCTTTACCAAATATTTCTTCTTCTGATAATTCGGGTGGTAATACTATGTCCTTGTGTGATAAAAATAAGGAGAAAGCTTATAATTGCCAA

GTGCCAAATGAATTTACTTATGCAGCTATCTTACCAAGTACATATCACATGGATTCTAAAAAACTGTCTGTCTTTCCACCTTGTCCTTCAAAAGAAGTCA

CTCAAACTGAAAGTGCCATAGCGCTGCTTAAAGATGAAGATCCGGTAGAAGAGCCTCTGGGGGAGATGGCTACATTTAACTCAAAGCATGTATCTCTTAA

CCTGGCAAAGGATCAAACAGAGGCCTTTGTTGATGTTAGTGTTGCTTCTCAGCCTCATCTCTCAGCCCAACAAAGTCCATCAACTCAAAAAGGGCAGGAT

GTTGCCCGTAGAGATGAAGGAATATTAGCTAAAGCTGGGAAGAAGGCTTTACCTTTTCTTCTAGAAAATGTCGCTGCATCCACATGGGAAAATGAGTCCA

AAATACCCACTAATGTGGAACACTTTGCTGTAACCTATGAAAAAGAACTGAGTATAAGTATTCAAACAGATAAATGTAATACAAATGTACAGAGCCCTAG

TAACTCGGCCCTGACAACACAAGTCATTCAGACGCATGCAAATGCTGAAGGAGCACTAGACTTTTTAGTTCCATCTACTGTTTCATGTTTTAGTAGTACC

AAACCAAGTCTGAGTAATTTGAATAGAAAAACTGAGGAGGTCTTAGACTTTCAGACTGTTAATTTATTACCTCCTGCCGAACAGTTACTTGAAGAAGGAA

GTCAGGCACATAGTATGAGTATAGTACAAGCTACAGAAATATATAGACTAGGTTCCAGGAATGATAGAGATGAAGAAAGTAAAACTTTCTGTAATGAGGC

TGAAACTACATCTGTACCACTAAAAACAGCTGTTAAAGACAAAACAAGAAGATGTTCATTGGGGATATTTTTACCCAAATTACCAAGCAAGAGAAGTTGT

AGTATCACTGGTGTTGATGACCTGGAACAGATTCTAGCAGATGCAGCTGACTTAACTCAACTAGAAACTCAGCCAGTCTGTAGTAAAGATCCAGGCATTG

GATCTGTTGCAGCCAAACTGAATTTGAGTCCATCTCAGTTTATAAATGAGGAAAATCTCCCTGTATATCCTGGTGAGATACTTTCATCAGATTCTGTTAG

CCTGGACATTGAGGAAAGTGTTCTGATTGACACATCTCAGAGAGAGAGTTTACCGTCTGAAAACAAAACCGAAAACTGCAGGGCCCAAAAAAGAACCCGG

GTTGAAGAAAATGATGTTACAAATGAGAAAAAAATCAGAACACATGACAGTGCACAAGATCAAGAG - UNI3892 - ATTTTTGATAATCATATGGAA

GAGGATATCAATAAAAATGTCAACAGTGTATTGCTGAAAAGCCTGAGCAGGACACCGTCTAGTTGCAGCAGCTCTCTGGATTCAATCAAGTCTGATGGAC

TCTCTCTGGATGTCAGCA CACAGCGTAATAGCCAAATGGAATCACAGTTTCTTGGTGACACTATCTCTGAAGAGAGTTTGAAGGAG AAACTCAAGGAT

GGACAAATTACAATAAAGGAGTTCTTCATACTTCTTCAGGTCCACATCTTAATACAGAAACCTAGGCAGAGCACTCTCCCAGCCAAA TTTACTATAAAC

ACATTACCTACCACAGAAGATCTGATGTTGAGACAATATGTTTATGGACCCAGGATACAGATTTATAAAGAAGACTGTGAGCTTCTTCGACAAAAGATTG

ACGA ATTAAAGATATCTGCATTGAACCAAAATAAACTATTGGCGGATGTAAATAGGAACTTGTGGGAAAAAGTGAAAGACTACTCTGATGAAGAG CTG

AAGAACTATGGGATTTACCTTAACAAAATCAAATCACGTTATACCAAGATGACAAAAGTCTTCAATCACCAAGGAAAAGTGGCTCTGTATAACAAATTGG

TGCATTCAGCTGAG AATGAGAAGAACAAACTTCAGATAAAAATAAATGAGATGGACACTATCCTCAAGAAGATCAATAACTGTCTCGCTGAAGTGGAAA

CAG AAACTAAGAATTTGGAGAATGAAGAGAAAAATGATGCCATGGAAGAATGGGATTCTGAAATGAGAGATGCAGAGAAAG AACTGGAACAGCTGAAA

ACTGAAGAAGAGGAGCTTCAGAG AAAGTTCTTAGAAGTAGAGACACAGAAAACGCAGACCCTTGCTCAGATAGAATTTATAAAAGAACAAACAACTAAA

ACTGAAGAATTACTGGATCAATTGAG TTTGTCTGAGTGGGATGTCATTGAGTGGAGTGATGATCAAGCTGTATTTACCTTTGTCTATGATTCAATAGAA

CTCATCATCACCTTTGGAGAGCCACTAG TTGGTCTCCCTTTTTTGGACAAGGCTTGCAGGAAGATTAATGCACTCAGTTTTCAGTCTCTGTTAGATG A

AGATAAAGCTCCTCCCTCCTCCCTTTTAGTTCACAAGCTTATTTTTCAGTACATTGAGGAACAGGAATCCTGGAAGAAGAAATGCACAGCACAGCATCAG

GTGCCCCAG ATGCTTCAAGAACTCTCACTGGTAGTGAACCATTGTAGGCTTCTTGGAGAGGAGATCGAATTTTTAAAGCGATGGGGGCCAAATTATAGC

CTAATGCATATAAATGTGAATAATACTGA ATTGAGGCTTTTATTCTCCAGTTGTGCAGCATTTGCAAAGTTTGAGATAACTTTGTCTCCCTCGGCCCAT

TATCCCTTGGTCCCGTTACCGTTCACCATTCACAATCACATTGGGAAGACTGG CCATGATGAAATTGCTGCAATTATCTCTAAAGTGCCCTTAGAGGAA

AACTACCTGAAGAATGTAGTCAAGCAAATTTACCAAGATCTACTTAAGGACTGAAAGTTTTCCCGTAAGACCCACAGATCACAGCTATAACAACAAAG
Translation
 - UNI15836 - MDGVYSEANEEN NDNTQRPVRRQHSS - UNI26532 - ILKPPRSPLQDLKCGNQTNQ EPNPPRKRKSSRRVSFADTIK KV

FQTESHMKTERNSEISG - UNI9543 - GMNTLLCAPIQTQMQQKE FSITDCNHERKHANDQTVIFSDENQMDLTASHTVMITKGLSDCTKNENSTK

IDTTSFLENLKHHAANSRIKKDLACSTVSLSQNIFSEKINSDNFIKRLKTGKHISSSTELDKENAEIPVYSKDSNSASSTYQMHASLGVDENSSNRTRIF

REQDDGMNLTQCHTACIKTWIPPSTEAKIGEFKGDKTIYGNECMELTTNYTIQVLSSENNLSERETQTQNGMNVTTVDGATAPAPEKKTALKDKLNAAFQ

GSFPNPENKIHIIKCHPIESETHTVTQISSQSASTLAVTSKSICSSPAIEGYKTIFHSSSNDAMELTKCLSAMEEEKKLLKADDKYSKICTNPDAGPLRE

KTIYLEEDSMDITKSHTVAIDNKIFKHDQENIKKEIIAIPIFEKEMVLRNLMPMSKDEKRDVNYISVPQVSKESLQRSQTNTLSVSLTDKKMEFLADEDM

DLTKSHTTKLSQVIPTTFDLASKNVTKSYSHSKSPLNEWESLDKQVVLGQHSKLPLPQRKDRDDPDCSHHKIMYSEELQTMDLTKSHTIVIGFGPSEVQE

HSKINLEHKNSQLTAESIQTAVNVPAANSRVVTTNDMDMLKDRSTHKPELLKEKQNIKIYGRKSIGRLKIDKTILFSEGNEGDMDITKSCTVKINHRSLL

DKHDSHLVSLAGTSKTILHARGQVEMEINRSHTTPLECKIISPSDITPGDLDKTMMSIDDHEELDMTKSHTVFIDYQAEAKGVLPDRLDFQLSKKESLQK

PKVTSLAEEIYISKNSESNHLPAKGSQLTILEEGSNSGLGEETNDAQKPGFLNELLSGKTQRRKSLSLKNKSITFPENDKSYREIPQSSAVEINNETRLE

DRKGFSFVPLAGTSKPVLSAYGPEDMEISIGQTTASEYKTVPPEEITTIPMDKTVMFVDNFGDLDVTRSHTVFIDCQAKEKVLDEYTNLGIQKTKTLSGS

EGDTHIQEITKNPAAQHKHHMTTVIPSSTVVSDQSSMKIKFHKADRDEEVKGKEVEANMLKQTKPESCLLNITDGKNVDFTSSYTADVCRSSDKYSSLPN

ISSSDNSGGNTMSLCDKNKEKAYNCQVPNEFTYAAILPSTYHMDSKKLSVFPPCPSKEVTQTESAIALLKDEDPVEEPLGEMATFNSKHVSLNLAKDQTE

AFVDVSVASQPHLSAQQSPSTQKGQDVARRDEGILAKAGKKALPFLLENVAASTWENESKIPTNVEHFAVTYEKELSISIQTDKCNTNVQSPSNSALTTQ

VIQTHANAEGALDFLVPSTVSCFSSTKPSLSNLNRKTEEVLDFQTVNLLPPAEQLLEEGSQAHSMSIVQATEIYRLGSRNDRDEESKTFCNEAETTSVPL

KTAVKDKTRRCSLGIFLPKLPSKRSCSITGVDDLEQILADAADLTQLETQPVCSKDPGIGSVAAKLNLSPSQFINEENLPVYPGEILSSDSVSLDIEESV

LIDTSQRESLPSENKTENCRAQKRTRVEENDVTNEKKIRTHDSAQDQE - UNI3892 - IFDNHMEEDINKNVNSVLLKSLSRTPSSCSSSLDSIKSD

GLSLDVST TQRNSQMESQFLGDTISEESLKE KLKDGQITIKEFFILLQVHILIQKPRQSTLPAK FTINTLPTTEDLMLRQYVYGPRIQIYKEDCELL

RQKIDE ELKISALNQNKLLADVNRNLWEKVKDYSDEE LKNYGIYLNKIKSRYTKMTKVFNHQGKVALYNKLVHSAE NEKNKLQIKINEMDTILKKIN

NCLAEVETE ETKNLENEEKNDAMEEWDSEMRDAEKE ELEQLKTEEEELQR RKFLEVETQKTQTLAQIEFIKEQTTKTEELLDQLS SLSEWDVIEWS

DDQAVFTFVYDSIELIITFGEPLV VGLPFLDKACRKINALSFQSLLDE EDKAPPSSLLVHKLIFQYIEEQESWKKKCTAQHQVPQ MLQELSLVVNHC

RLLGEEIEFLKRWGPNYSLMHINVNNTE ELRLLFSSCAAFAKFEITLSPSAHYPLVPLPFTIHNHIGKTG GHDEIAAIISKVPLEENYLKNVVKQIYQ

DLLKD
Transcript ENSMUST00000028802
Sequence
AAAAAAGTTTTCAAAAATGGATGGGGTATATTCAGAAGCTAATGAAGAGAA TGACAATACACAGAGACCTGTTAGAAGACAGCATTCCTCA - UNI26

532 - ATTTTGAAACCCCCAAGGAGTCCTCTTCAGGACCTCAAATGTGGAAATCAAACAAACCAG GAACCTAATCCTCCAAGAAAAAGGAAAAGCTCT

CGTCGAGTCAGCTTTGCAGATACTATAAA AGTATTCCAGACAGAGTCTCACATGAAAACAGAGAGAAATTCAGAAATTTCAG - UNI9543 - GTAT

GAACACTTTGCTTTGTGCTCCAATTCAGACTCAGATGCAACAAAAGGAG TTCTCAATTACAGACTGCAACCATGAAAGGAAACATGCAAATGATCAGAC

AGTCATCTTTTCAGATGAAAACCAGATGGATCTGACAGCAAGTCACACTGTAATGATTACCAAAGGTCTTTCAGACTGTACCAAAAATGAAAATTCTACA

AAAATAGATACCACGTCCTTTCTGGAGAATTTAAAGCATCATGCTGCAAATTCAAGAATTAAAAAGGATTTAGCATGTTCCACAGTTTCCTTAAGTCAAA

ACATTTTCTCAGAAAAGATCAATTCTGACAACTTCATAAAAAGATTGAAGACAGGAAAACATATTTCGTCTTCTACAGAGCTTGATAAGGAAAATGCTGA

GATACCTGTTTATTCCAAAGACTCAAACAGTGCCTCTTCAACATATCAAATGCATGCATCTCTTGGTGTAGATGAAAATAGTAGTAATAGGACTAGAATC

TTTAGAGAACAAGATGATGGTATGAATTTGACCCAATGTCATACAGCCTGTATTAAGACTTGGATTCCTCCATCCACGGAGGCCAAAATAGGAGAATTCA

AAGGTGATAAAACAATTTATGGCAATGAGTGTATGGAGTTGACAACTAACTATACGATACAGGTTTTGTCATCAGAAAATAATTTATCTGAAAGAGAAAC

TCAAACTCAAAATGGTATGAATGTTACAACAGTTGATGGAGCTACAGCTCCAGCTCCAGAGAAGAAAACAGCCCTTAAGGATAAACTAAATGCTGCTTTT

CAAGGCTCTTTCCCAAACCCTGAAAATAAAATTCATATTATCAAATGTCATCCTATAGAGTCAGAAACTCATACAGTCACACAGATTTCTAGTCAAAGTG

CCAGCACATTGGCTGTAACTTCAAAATCTATATGTTCTAGTCCAGCTATTGAGGGGTATAAGACAATTTTTCATTCTAGTAGCAATGATGCAATGGAACT

GACTAAGTGTCTATCAGCTATGGAAGAGGAAAAAAAATTGCTGAAGGCTGATGATAAGTATTCTAAAATATGTACCAATCCAGATGCTGGCCCACTCAGA

GAGAAAACTATTTATTTAGAAGAGGATAGCATGGACATTACCAAAAGTCACACCGTTGCAATAGATAATAAAATATTTAAACATGATCAAGAAAACATTA

AAAAAGAAATAATAGCCATACCAATATTTGAAAAGGAAATGGTGCTCCGAAATCTTATGCCTATGTCAAAAGATGAGAAAAGGGATGTAAATTATATTTC

AGTTCCTCAAGTATCTAAGGAAAGCTTACAACGGAGTCAGACAAACACTTTATCTGTTTCATTGACTGACAAAAAGATGGAATTCTTGGCAGATGAAGAT

ATGGATCTGACTAAAAGTCACACAACTAAGTTAAGTCAAGTTATTCCTACAACTTTTGACTTAGCATCAAAGAATGTCACCAAATCATACTCTCACAGCA

AAAGCCCTTTAAATGAGTGGGAAAGCCTGGATAAACAAGTAGTGCTAGGCCAGCATTCTAAACTTCCTTTACCACAGAGGAAAGATAGAGATGATCCTGA

CTGTTCTCATCATAAGATAATGTATTCAGAGGAGTTACAAACTATGGATCTAACCAAGAGCCACACTATTGTAATTGGCTTTGGTCCTTCTGAAGTACAA

GAACATAGTAAAATTAATTTAGAACACAAAAACAGCCAACTTACAGCAGAAAGCATACAAACAGCTGTGAACGTTCCTGCAGCAAACTCTAGAGTAGTAA

CAACTAATGATATGGACATGTTAAAGGACAGAAGTACACATAAGCCAGAATTGCTGAAGGAAAAGCAAAACATCAAAATCTATGGAAGAAAAAGTATTGG

TAGACTGAAAATTGATAAAACTATATTATTTTCAGAGGGTAATGAGGGTGATATGGATATCACCAAGAGTTGCACAGTCAAAATAAATCATAGATCTTTA

TTAGATAAGCATGATTCTCATTTAGTATCTTTGGCAGGAACTTCTAAAACCATTTTGCATGCACGTGGTCAGGTTGAAATGGAAATCAATAGAAGTCACA

CAACTCCTTTAGAATGTAAAATTATCTCGCCCAGTGATATAACTCCTGGTGATCTGGATAAGACTATGATGTCTATAGATGATCATGAGGAACTAGACAT

GACCAAGTCCCATACTGTTTTCATTGACTACCAAGCAGAGGCAAAAGGTGTACTTCCAGACAGACTTGACTTTCAATTATCCAAAAAGGAAAGCCTACAG

AAGCCGAAAGTGACATCTCTGGCTGAAGAGATTTACATTTCAAAAAATAGTGAAAGCAACCATCTACCAGCAAAAGGCAGCCAGCTAACAATATTAGAGG

AAGGGTCTAATAGCGGGCTTGGAGAGGAAACTAATGATGCACAAAAGCCTGGATTTCTGAATGAACTTCTGTCAGGCAAAACTCAGAGAAGAAAAAGCCT

TAGCCTCAAAAACAAGAGTATTACATTTCCAGAGAATGATAAAAGTTATAGAGAGATCCCTCAGAGTTCTGCAGTAGAAATAAATAATGAAACTAGGCTG

GAAGACAGAAAGGGCTTCAGTTTTGTGCCATTGGCAGGAACTTCCAAACCAGTTTTGTCTGCATATGGGCCCGAGGACATGGAGATTTCTATAGGTCAAA

CCACTGCTTCAGAATATAAAACTGTCCCACCAGAAGAAATAACTACTATACCTATGGATAAAACTGTAATGTTTGTAGATAATTTCGGTGATCTGGATGT

CACCAGATCCCATACGGTTTTCATCGATTGTCAAGCCAAAGAAAAGGTACTTGATGAATATACTAACTTGGGAATACAGAAAACAAAAACTTTGAGTGGT

TCTGAAGGTGATACCCATATTCAAGAAATCACAAAAAACCCAGCAGCTCAACACAAACACCATATGACAACTGTTATTCCTTCTAGTACAGTAGTTAGTG

ATCAAAGTTCAATGAAAATCAAGTTTCACAAAGCTGATAGAGATGAGGAGGTCAAAGGAAAGGAAGTGGAAGCCAATATGCTGAAACAAACTAAACCTGA

AAGCTGTCTGTTAAATATAACAGATGGAAAAAATGTGGATTTTACAAGCAGTTATACAGCTGATGTTTGTAGATCCAGTGACAAGTATTCCTCTTTACCA

AATATTTCTTCTTCTGATAATTCGGGTGGTAATACTATGTCCTTGTGTGATAAAAATAAGGAGAAAGCTTATAATTGCCAAGTGCCAAATGAATTTACTT

ATGCAGCTATCTTACCAAGTACATATCACATGGATTCTAAAAAACTGTCTGTCTTTCCACCTTGTCCTTCAAAAGAAGTCACTCAAACTGAAAGTGCCAT

AGCGCTGCTTAAAGATGAAGATCCGGTAGAAGAGCCTCTGGGGGAGATGGCTACATTTAACTCAAAGCATGTATCTCTTAACCTGGCAAAGGATCAAACA

GAGGCCTTTGTTGATGTTAGTGTTGCTTCTCAGCCTCATCTCTCAGCCCAACAAAGTCCATCAACTCAAAAAGGGCAGGATGTTGCCCGTAGAGATGAAG

GAATATTAGCTAAAGCTGGGAAGAAGGCTTTACCTTTTCTTCTAGAAAATGTCGCTGCATCCACATGGGAAAATGAGTCCAAAATACCCACTAATGTGGA

ACACTTTGCTGTAACCTATGAAAAAGAACTGAGTATAAGTATTCAAACAGATAAATGTAATACAAATGTACAGAGCCCTAGTAACTCGGCCCTGACAACA

CAAGTCATTCAGACGCATGCAAATGCTGAAGGAGCACTAGACTTTTTAGTTCCATCTACTGTTTCATGTTTTAGTAGTACCAAACCAAGTCTGAGTAATT

TGAATAGAAAAACTGAGGAGGTCTTAGACTTTCAGACTGTTAATTTATTACCTCCTGCCGAACAGTTACTTGAAGAAGGAAGTCAGGCACATAGTATGAG

TATAGTACAAGCTACAGAAATATATAGACTAGGTTCCAGGAATGATAGAGATGAAGAAAGTAAAACTTTCTGTAATGAGGCTGAAACTACATCTGTACCA

CTAAAAACAGCTGTTAAAGACAAAACAAGAAGATGTTCATTGGGGATATTTTTACCCAAATTACCAAGCAAGAGAAGTTGTAGTATCACTGGTGTTGATG

ACCTGGAACAGATTCTAGCAGATGCAGCTGACTTAACTCAACTAGAAACTCAGCCAGTCTGTAGTAAAGATCCAGGCATTGGATCTGTTGCAGCCAAACT

GAATTTGAGTCCATCTCAGTTTATAAATGAGGAAAATCTCCCTGTATATCCTGGTGAGATACTTTCATCAGATTCTGTTAGCCTGGACATTGAGGAAAGT

GTTCTGATTGACACATCTCAGAGAGAGAGTTTACCGTCTGAAAACAAAACCGAAAACTGCAGGGCCCAAAAAAGAACCCGGGTTGAAGAAAATGATGTTA

CAAATGAGAAAAAAATCAGAACACATGACAGTGCACAAGATCAAGAG - UNI3892 - ATTTTTGATAATCATATGGAAGAGGATATCAATAAAAATG

TCAACAGTGTATTGCTGAAAAGCCTGAGCAGGACACCGTCTAGTTGCAGCAGCTCTCTGGATTCAATCAAGTCTGATGGACTCTCTCTGGATGTCAGCA 

CACAGCGTAATAGCCAAATGGAATCACAGTTTCTTGGTGACACTATCTCTGAAGAGAGTTTGAAGGAG AAACTCAAGGATGGACAAATTACAATAAAGG

AGTTCTTCATACTTCTTCAGGTCCACATCTTAATACAGAAACCTAGGCAGAGCACTCTCCCAGCCAAA TTTACTATAAACACATTACCTACCACAGAAG

ATCTGATGTTGAGACAATATGTTTATGGACCCAGGATACAGATTTATAAAGAAGACTGTGAGCTTCTTCGACAAAAGATTGACGA ATTAAAGATATCTG

CATTGAACCAAAATAAACTATTGGCGGATGTAAATAGGAACTTGTGGGAAAAAGTGAAAGACTACTCTGATGAAGAG CTGAAGAACTATGGGATTTACC

TTAACAAAATCAAATCACGTTATACCAAGATGACAAAAGTCTTCAATCACCAAGGAAAAGTGGCTCTGTATAACAAATTGGTGCATTCAGCTGAG AATG

AGAAGAACAAACTTCAGATAAAAATAAATGAGATGGACACTATCCTCAAGAAGATCAATAACTGTCTCGCTGAAGTGGAAACAG AAACTAAGAATTTGG

AGAATGAAGAGAAAAATGATGCCATGGAAGAATGGGATTCTGAAATGAGAGATGCAGAGAAAG AACTGGAACAGCTGAAAACTGAAGAAGAGGAGCTTC

AGAG AAAGTTCTTAGAAGTAGAGACACAGAAAACGCAGACCCTTGCTCAGATAGAATTTATAAAAGAACAAACAACTAAAACTGAAGAATTACTGGATC

AATTGAG TTTGTCTGAGTGGGATGTCATTGAGTGGAGTGATGATCAAGCTGTATTTACCTTTGTCTATGATTCAATAGAACTCATCATCACCTTTGGAG

AGCCACTAG TTGGTCTCCCTTTTTTGGACAAGGCTTGCAGGAAGATTAATGCACTCAGTTTTCAGTCTCTGTTAGATG AAGATAAAGCTCCTCCCTCC

TCCCTTTTAGTTCACAAGCTTATTTTTCAGTACATTGAGGAACAGGAATCCTGGAAGAAGAAATGCACAGCACAGCATCAGGTGCCCCAG ATGCTTCAA

GAACTCTCACTGGTAGTGAACCATTGTAGGCTTCTTGGAGAGGAGATCGAATTTTTAAAGCGATGGGGGCCAAATTATAGCCTAATGCATATAAATGTGA

ATAATACTGA ATTGAGGCTTTTATTCTCCAGTTGTGCAGCATTTGCAAAGTTTGAGATAACTTTGTCTCCCTCGGCCCATTATCCCTTGGTCCCGTTAC

CGTTCACCATTCACAATCACATTGGGAAGACTGG CCATGATGAAATTGCTGCAATTATCTCTAAAGTGCCCTTAGAGGAAAACTACCTGAAGAATGTAG

TCAAGCAAATTTACCAAGATCTACTTAAGGACTGAAAGTTTTCCCGTAAGACCCACAGATCACAGCTATAACAACAAAGGAAAAAAAAATCCATTTACCC

AGGCCCCATATAGAGGCAAACGCTTATAATCTCAGGATTCCAGTGAGAGAAGATCAAGGCTAGCCTGGGCTGTCTAGGAGACCTGGTTGAAAAACAAAAT

ACTTAAATGATATATCGGGGTCAATATTGATATTTATCTTTTGTCTTAACATCATATAAAAGTAGCAAAATTCTGCCAGGTGGTGGTGGTACACGCCTTT

AATCCCAGCACTTGGGAGGCAGAGGCAGGCGGATTTCTGAGTTCGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGATCAGCCCAGGCTATACAGAGAAA

CCCTGTCTTGAAAAACAAAAACAAAACAAACAAAAATGCAAAATTCCTCCTGATGATATCATAATTAATTTGTATCATTAGTTTTAAAATACCTAGTTGA

AAATGATGAGGTCTCAAATAGCATGTTATCTGCTTGCTATTATCCTTATACCCAAGATTAAATGATCAAACATGTGAGAAAATTTTCCTAAAGTAGCTTG

TTGATAGACCACTTACCTTGTGTGTATAAAGCCCTATTTTTTAAAAAGTCTAAAGTTGTGCTCTTCTCTTAATACAAGCTCTAAGGGGTAACATTTATAA

GGAGGTAGTGCACAAAGATTAAGCCTTTCCTCTTTTTGGGTTTTTTTTGGGGGGGGGGGGTGTTTGGTGTTGTTTTTATTTGTTTTGGTTTTTGGTTTTT

CGAGACAGGATGTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTTAAACTGAGAAATCTACCTGCCTCTGCCTTCCAAG

TGCTGGGATTAAAGGCATGCGCCACCACTGCCTAGCTAATCATTTCTTGTTATCTAGAGCTGTGTATTTATGGGTTTTGCCTAGCAGATATGTCTAGAGT

GGAAACACTTCTATCAGGTTCTGGTAGAACATATCTATGGCTGCAGATACTCAGATCACTGAAAGAGGGAGACCACATGATCTCATGACTTCAAGACGAG

CACGGTCAACATAGCCAGGGAGATTTGTCTCCATAACACCAACAGAACATATCTATTCACAAATTATTCATTCTTCTCCATTTCAGAAATGCTGTTTAAA

AAAAAAAACTACTCAACTTTTGGAATGGTTGCCATCTTGCAAGTCTTAGTATTTTTTTACAATGTTTATTAATGTTTTCTCTTTCTAATGTATATTCTTT

TTATTTCTCATGTATACTCTTTCTAGGAAAAGATCATTCATTTTGGCCTGATATATTATGTAAATATATGAATATTTTGTATTTGTAATATATGTGGTAA

TGAAATAATTTGCCTTCGGTATAGGTCATTTCCTTATCTATAAAGAATGCTTTACAGGC
Translation
MDGVYSEANEEN NDNTQRPVRRQHSS - UNI26532 - ILKPPRSPLQDLKCGNQTNQ EPNPPRKRKSSRRVSFADTIK KVFQTESHMKTERNSE

ISG - UNI9543 - GMNTLLCAPIQTQMQQKE FSITDCNHERKHANDQTVIFSDENQMDLTASHTVMITKGLSDCTKNENSTKIDTTSFLENLKHHA

ANSRIKKDLACSTVSLSQNIFSEKINSDNFIKRLKTGKHISSSTELDKENAEIPVYSKDSNSASSTYQMHASLGVDENSSNRTRIFREQDDGMNLTQCHT

ACIKTWIPPSTEAKIGEFKGDKTIYGNECMELTTNYTIQVLSSENNLSERETQTQNGMNVTTVDGATAPAPEKKTALKDKLNAAFQGSFPNPENKIHIIK

CHPIESETHTVTQISSQSASTLAVTSKSICSSPAIEGYKTIFHSSSNDAMELTKCLSAMEEEKKLLKADDKYSKICTNPDAGPLREKTIYLEEDSMDITK

SHTVAIDNKIFKHDQENIKKEIIAIPIFEKEMVLRNLMPMSKDEKRDVNYISVPQVSKESLQRSQTNTLSVSLTDKKMEFLADEDMDLTKSHTTKLSQVI

PTTFDLASKNVTKSYSHSKSPLNEWESLDKQVVLGQHSKLPLPQRKDRDDPDCSHHKIMYSEELQTMDLTKSHTIVIGFGPSEVQEHSKINLEHKNSQLT

AESIQTAVNVPAANSRVVTTNDMDMLKDRSTHKPELLKEKQNIKIYGRKSIGRLKIDKTILFSEGNEGDMDITKSCTVKINHRSLLDKHDSHLVSLAGTS

KTILHARGQVEMEINRSHTTPLECKIISPSDITPGDLDKTMMSIDDHEELDMTKSHTVFIDYQAEAKGVLPDRLDFQLSKKESLQKPKVTSLAEEIYISK

NSESNHLPAKGSQLTILEEGSNSGLGEETNDAQKPGFLNELLSGKTQRRKSLSLKNKSITFPENDKSYREIPQSSAVEINNETRLEDRKGFSFVPLAGTS

KPVLSAYGPEDMEISIGQTTASEYKTVPPEEITTIPMDKTVMFVDNFGDLDVTRSHTVFIDCQAKEKVLDEYTNLGIQKTKTLSGSEGDTHIQEITKNPA

AQHKHHMTTVIPSSTVVSDQSSMKIKFHKADRDEEVKGKEVEANMLKQTKPESCLLNITDGKNVDFTSSYTADVCRSSDKYSSLPNISSSDNSGGNTMSL

CDKNKEKAYNCQVPNEFTYAAILPSTYHMDSKKLSVFPPCPSKEVTQTESAIALLKDEDPVEEPLGEMATFNSKHVSLNLAKDQTEAFVDVSVASQPHLS

AQQSPSTQKGQDVARRDEGILAKAGKKALPFLLENVAASTWENESKIPTNVEHFAVTYEKELSISIQTDKCNTNVQSPSNSALTTQVIQTHANAEGALDF

LVPSTVSCFSSTKPSLSNLNRKTEEVLDFQTVNLLPPAEQLLEEGSQAHSMSIVQATEIYRLGSRNDRDEESKTFCNEAETTSVPLKTAVKDKTRRCSLG

IFLPKLPSKRSCSITGVDDLEQILADAADLTQLETQPVCSKDPGIGSVAAKLNLSPSQFINEENLPVYPGEILSSDSVSLDIEESVLIDTSQRESLPSEN

KTENCRAQKRTRVEENDVTNEKKIRTHDSAQDQE - UNI3892 - IFDNHMEEDINKNVNSVLLKSLSRTPSSCSSSLDSIKSDGLSLDVST TQRNS

QMESQFLGDTISEESLKE KLKDGQITIKEFFILLQVHILIQKPRQSTLPAK FTINTLPTTEDLMLRQYVYGPRIQIYKEDCELLRQKIDE ELKISAL

NQNKLLADVNRNLWEKVKDYSDEE LKNYGIYLNKIKSRYTKMTKVFNHQGKVALYNKLVHSAE NEKNKLQIKINEMDTILKKINNCLAEVETE ETKN

LENEEKNDAMEEWDSEMRDAEKE ELEQLKTEEEELQR RKFLEVETQKTQTLAQIEFIKEQTTKTEELLDQLS SLSEWDVIEWSDDQAVFTFVYDSIE

LIITFGEPLV VGLPFLDKACRKINALSFQSLLDE EDKAPPSSLLVHKLIFQYIEEQESWKKKCTAQHQVPQ MLQELSLVVNHCRLLGEEIEFLKRWG

PNYSLMHINVNNTE ELRLLFSSCAAFAKFEITLSPSAHYPLVPLPFTIHNHIGKTG GHDEIAAIISKVPLEENYLKNVVKQIYQDLLKD
Transcript ENSMUST00000028799
Sequence
TTTGAATACTTCAGGGACGTTGAGAGGTGACGTCCGACTCCAAGGAGCGCGAGGACCCCAGACAAGTCAAGCAGGTGGTCGGTGGCGGGTCAGAATGCTC

CTTTCCGTTCTGGGCTCCTGAGAGGGCTCGGGTTCTGTTTGAGTGCTGAAGGGCGGGCGCGGGTTGCTGAGGTCGCTCGGTCGTCGGGGCGATCTCGGAA

AGGCCCTGCAGCCGACCGGACCGCGCGAGCGCCAACGGCCCGCTCTCCTTCTCCTGGAGCGCCGCGTTTCGCTTCTCCTTTCCCAAAGCCGCTCCATTCC

CGGGGTCGTGTCGTCTGCGCGGTGCGCCGTGGGCCTCCGGGTTCGCCCCGCCCATCATCTTTGGTCAGGGCTCCGGGATCCGGTCCCACCGTCTCTCGCC

AACTCCTTGTG - UNI15836 - AAAAAAGTTTTCAAAAATGGATGGGGTATATTCAGAAGCTAATGAAGAGAA TGACAATACACAGAGACCTGTTA

GAAGACAGCATTCCTCA - UNI26532 - ATTTTGAAACCCCCAAGGAGTCCTCTTCAGGACCTCAAATGTGGAAATCAAACAAACCAG GAACCTAA

TCCTCCAAGAAAAAGGAAAAGCTCTCGTCGAGTCAGCTTTGCAGATACTATAAA AGTATTCCAGACAGAGTCTCACATGAAAACAGAGAGAAATTCAGA

AATTTCAG - UNI9543 - GTATGAACACTTTGCTTTGTGCTCCAATTCAGACTCAGATGCAACAAAAGGAG TTCTCAATTACAGACTGCAACCATG

AAAGGAAACATGCAAATGATCAGACAGTCATCTTTTCAGATGAAAACCAGATGGATCTGACAGCAAGTCACACTGTAATGATTACCAAAGGTCTTTCAGA

CTGTACCAAAAATGAAAATTCTACAAAAATAGATACCACGTCCTTTCTGGAGAATTTAAAGCATCATGCTGCAAATTCAAGAATTAAAAAGGATTTAGCA

TGTTCCACAGTTTCCTTAAGTCAAAACATTTTCTCAGAAAAGATCAATTCTGACAACTTCATAAAAAGATTGAAGACAGGAAAACATATTTCGTCTTCTA

CAGAGCTTGATAAGGAAAATGCTGAGATACCTGTTTATTCCAAAGACTCAAACAGTGCCTCTTCAACATATCAAATGCATGCATCTCTTGGTGTAGATGA

AAATAGTAGTAATAGGACTAGAATCTTTAGAGAACAAGATGATGGTATGAATTTGACCCAATGTCATACAGCCTGTATTAAGACTTGGATTCCTCCATCC

ACGGAGGCCAAAATAGGAGAATTCAAAGGTGATAAAACAATTTATGGCAATGAGTGTATGGAGTTGACAACTAACTATACGATACAGGTTTTGTCATCAG

AAAATAATTTATCTGAAAGAGAAACTCAAACTCAAAATGGTATGAATGTTACAACAGTTGATGGAGCTACAGCTCCAGCTCCAGAGAAGAAAACAGCCCT

TAAGGATAAACTAAATGCTGCTTTTCAAGGCTCTTTCCCAAACCCTGAAAATAAAATTCATATTATCAAATGTCATCCTATAGAGTCAGAAACTCATACA

GTCACACAGATTTCTAGTCAAAGTGCCAGCACATTGGCTGTAACTTCAAAATCTATATGTTCTAGTCCAGCTATTGAGGGGTATAAGACAATTTTTCATT

CTAGTAGCAATGATGCAATGGAACTGACTAAGTGTCTATCAGCTATGGAAGAGGAAAAAAAATTGCTGAAGGCTGATGATAAGTATTCTAAAATATGTAC

CAATCCAGATGCTGGCCCACTCAGAGAGAAAACTATTTATTTAGAAGAGGATAGCATGGACATTACCAAAAGTCACACCGTTGCAATAGATAATAAAATA

TTTAAACATGATCAAGAAAACATTAAAAAAGAAATAATAGCCATACCAATATTTGAAAAGGAAATGGTGCTCCGAAATCTTATGCCTATGTCAAAAGATG

AGAAAAGGGATGTAAATTATATTTCAGTTCCTCAAGTATCTAAGGAAAGCTTACAACGGAGTCAGACAAACACTTTATCTGTTTCATTGACTGACAAAAA

GATGGAATTCTTGGCAGATGAAGATATGGATCTGACTAAAAGTCACACAACTAAGTTAAGTCAAGTTATTCCTACAACTTTTGACTTAGCATCAAAGAAT

GTCACCAAATCATACTCTCACAGCAAAAGCCCTTTAAATGAGTGGGAAAGCCTGGATAAACAAGTAGTGCTAGGCCAGCATTCTAAACTTCCTTTACCAC

AGAGGAAAGATAGAGATGATCCTGACTGTTCTCATCATAAGATAATGTATTCAGAGGAGTTACAAACTATGGATCTAACCAAGAGCCACACTATTGTAAT

TGGCTTTGGTCCTTCTGAAGTACAAGAACATAGTAAAATTAATTTAGAACACAAAAACAGCCAACTTACAGCAGAAAGCATACAAACAGCTGTGAACGTT

CCTGCAGCAAACTCTAGAGTAGTAACAACTAATGATATGGACATGTTAAAGGACAGAAGTACACATAAGCCAGAATTGCTGAAGGAAAAGCAAAACATCA

AAATCTATGGAAGAAAAAGTATTGGTAGACTGAAAATTGATAAAACTATATTATTTTCAGAGGGTAATGAGGGTGATATGGATATCACCAAGAGTTGCAC

AGTCAAAATAAATCATAGATCTTTATTAGATAAGCATGATTCTCATTTAGTATCTTTGGCAGGAACTTCTAAAACCATTTTGCATGCACGTGGTCAGGTT

GAAATGGAAATCAATAGAAGTCACACAACTCCTTTAGAATGTAAAATTATCTCGCCCAGTGATATAACTCCTGGTGATCTGGATAAGACTATGATGTCTA

TAGATGATCATGAGGAACTAGACATGACCAAGTCCCATACTGTTTTCATTGACTACCAAGCAGAGGCAAAAGGTGTACTTCCAGACAGACTTGACTTTCA

ATTATCCAAAAAGGAAAGCCTACAGAAGCCGAAAGTGACATCTCTGGCTGAAGAGATTTACATTTCAAAAAATAGTGAAAGCAACCATCTACCAGCAAAA

GGCAGCCAGCTAACAATATTAGAGGAAGGGTCTAATAGCGGGCTTGGAGAGGAAACTAATGATGCACAAAAGCCTGGATTTCTGAATGAACTTCTGTCAG

GCAAAACTCAGAGAAGAAAAAGCCTTAGCCTCAAAAACAAGAGTATTACATTTCCAGAGAATGATAAAAGTTATAGAGAGATCCCTCAGAGTTCTGCAGT

AGAAATAAATAATGAAACTAGGCTGGAAGACAGAAAGGGCTTCAGTTTTGTGCCATTGGCAGGAACTTCCAAACCAGTTTTGTCTGCATATGGGCCCGAG

GACATGGAGATTTCTATAGGTCAAACCACTGCTTCAGAATATAAAACTGTCCCACCAGAAGAAATAACTACTATACCTATGGATAAAACTGTAATGTTTG

TAGATAATTTCGGTGATCTGGATGTCACCAGATCCCATACGGTTTTCATCGATTGTCAAGCCAAAGAAAAGGTACTTGATGAATATACTAACTTGGGAAT

ACAGAAAACAAAAACTTTGAGTGGTTCTGAAGGTGATACCCATATTCAAGAAATCACAAAAAACCCAGCAGCTCAACACAAACACCATATGACAACTGTT

ATTCCTTCTAGTACAGTAGTTAGTGATCAAAGTTCAATGAAAATCAAGTTTCACAAAGCTGATAGAGATGAGGAGGTCAAAGGAAAGGAAGTGGAAGCCA

ATATGCTGAAACAAACTAAACCTGAAAGCTGTCTGTTAAATATAACAGATGGAAAAAATGTGGATTTTACAAGCAGTTATACAGCTGATGTTTGTAGATC

CAGTGACAAGTATTCCTCTTTACCAAATATTTCTTCTTCTGATAATTCGGGTGGTAATACTATGTCCTTGTGTGATAAAAATAAGGAGAAAGCTTATAAT

TGCCAAGTGCCAAATGAATTTACTTATGCAGCTATCTTACCAAGTACATATCACATGGATTCTAAAAAACTGTCTGTCTTTCCACCTTGTCCTTCAAAAG

AAGTCACTCAAACTGAAAGTGCCATAGCGCTGCTTAAAGATGAAGATCCGGTAGAAGAGCCTCTGGGGGAGATGGCTACATTTAACTCAAAGCATGTATC

TCTTAACCTGGCAAAGGATCAAACAGAGGCCTTTGTTGATGTTAGTGTTGCTTCTCAGCCTCATCTCTCAGCCCAACAAAGTCCATCAACTCAAAAAGGG

CAGGATGTTGCCCGTAGAGATGAAGGAATATTAGCTAAAGCTGGGAAGAAGGCTTTACCTTTTCTTCTAGAAAATGTCGCTGCATCCACATGGGAAAATG

AGTCCAAAATACCCACTAATGTGGAACACTTTGCTGTAACCTATGAAAAAGAACTGAGTATAAGTATTCAAACAGATAAATGTAATACAAATGTACAGAG

CCCTAGTAACTCGGCCCTGACAACACAAGTCATTCAGACGCATGCAAATGCTGAAGGAGCACTAGACTTTTTAGTTCCATCTACTGTTTCATGTTTTAGT

AGTACCAAACCAAGTCTGAGTAATTTGAATAGAAAAACTGAGGAGGTCTTAGACTTTCAGACTGTTAATTTATTACCTCCTGCCGAACAGTTACTTGAAG

AAGGAAGTCAGGCACATAGTATGAGTATAGTACAAGCTACAGAAATATATAGACTAGGTTCCAGGAATGATAGAGATGAAGAAAGTAAAACTTTCTGTAA

TGAGGCTGAAACTACATCTGTACCACTAAAAACAGCTGTTAAAGACAAAACAAGAAGATGTTCATTGGGGATATTTTTACCCAAATTACCAAGCAAGAGA

AGTTGTAGTATCACTGGTGTTGATGACCTGGAACAGATTCTAGCAGATGCAGCTGACTTAACTCAACTAGAAACTCAGCCAGTCTGTAGTAAAGATCCAG

GCATTGGATCTGTTGCAGCCAAACTGAATTTGAGTCCATCTCAGTTTATAAATGAGGAAAATCTCCCTGTATATCCTGGTGAGATACTTTCATCAGATTC

TGTTAGCCTGGACATTGAGGAAAGTGTTCTGATTGACACATCTCAGAGAGAGAGTTTACCGTCTGAAAACAAAACCGAAAACTGCAGGGCCCAAAAAAGA

ACCCGGGTTGAAGAAAATGATGTTACAAATGAGAAAAAAATCAGAACACATGACAGTGCACAAGATCAAGAGGTAAGCTGTCTTGAGCCAAAAAATGTTC

TTGAATTTTAAGTATCTAAGCAATAGAAACTATTTCTACTTACTATAGGTTAGTGAAATATTCCTGTGTAGAATTATTAGAGGTCAGTTGGTAAAGGATT

TACCATGACACGATGGCCTATACCTGTAATCCCAGCACTCTGAAGGCTAAGGAAAGGGGACTGCTGTGACTTTGAGGCTAGCCAAGGCTACGTAACAGAA

TCTTATCTCAAAACAATAATTTGTTGTGGCAAATACCCACAAAAATGGAATTAAAATTGTATAGATACCAAA
Translation
 - UNI15836 - MDGVYSEANEEN NDNTQRPVRRQHSS - UNI26532 - ILKPPRSPLQDLKCGNQTNQ EPNPPRKRKSSRRVSFADTIK KV

FQTESHMKTERNSEISG - UNI9543 - GMNTLLCAPIQTQMQQKE FSITDCNHERKHANDQTVIFSDENQMDLTASHTVMITKGLSDCTKNENSTK

IDTTSFLENLKHHAANSRIKKDLACSTVSLSQNIFSEKINSDNFIKRLKTGKHISSSTELDKENAEIPVYSKDSNSASSTYQMHASLGVDENSSNRTRIF

REQDDGMNLTQCHTACIKTWIPPSTEAKIGEFKGDKTIYGNECMELTTNYTIQVLSSENNLSERETQTQNGMNVTTVDGATAPAPEKKTALKDKLNAAFQ

GSFPNPENKIHIIKCHPIESETHTVTQISSQSASTLAVTSKSICSSPAIEGYKTIFHSSSNDAMELTKCLSAMEEEKKLLKADDKYSKICTNPDAGPLRE

KTIYLEEDSMDITKSHTVAIDNKIFKHDQENIKKEIIAIPIFEKEMVLRNLMPMSKDEKRDVNYISVPQVSKESLQRSQTNTLSVSLTDKKMEFLADEDM

DLTKSHTTKLSQVIPTTFDLASKNVTKSYSHSKSPLNEWESLDKQVVLGQHSKLPLPQRKDRDDPDCSHHKIMYSEELQTMDLTKSHTIVIGFGPSEVQE

HSKINLEHKNSQLTAESIQTAVNVPAANSRVVTTNDMDMLKDRSTHKPELLKEKQNIKIYGRKSIGRLKIDKTILFSEGNEGDMDITKSCTVKINHRSLL

DKHDSHLVSLAGTSKTILHARGQVEMEINRSHTTPLECKIISPSDITPGDLDKTMMSIDDHEELDMTKSHTVFIDYQAEAKGVLPDRLDFQLSKKESLQK

PKVTSLAEEIYISKNSESNHLPAKGSQLTILEEGSNSGLGEETNDAQKPGFLNELLSGKTQRRKSLSLKNKSITFPENDKSYREIPQSSAVEINNETRLE

DRKGFSFVPLAGTSKPVLSAYGPEDMEISIGQTTASEYKTVPPEEITTIPMDKTVMFVDNFGDLDVTRSHTVFIDCQAKEKVLDEYTNLGIQKTKTLSGS

EGDTHIQEITKNPAAQHKHHMTTVIPSSTVVSDQSSMKIKFHKADRDEEVKGKEVEANMLKQTKPESCLLNITDGKNVDFTSSYTADVCRSSDKYSSLPN

ISSSDNSGGNTMSLCDKNKEKAYNCQVPNEFTYAAILPSTYHMDSKKLSVFPPCPSKEVTQTESAIALLKDEDPVEEPLGEMATFNSKHVSLNLAKDQTE

AFVDVSVASQPHLSAQQSPSTQKGQDVARRDEGILAKAGKKALPFLLENVAASTWENESKIPTNVEHFAVTYEKELSISIQTDKCNTNVQSPSNSALTTQ

VIQTHANAEGALDFLVPSTVSCFSSTKPSLSNLNRKTEEVLDFQTVNLLPPAEQLLEEGSQAHSMSIVQATEIYRLGSRNDRDEESKTFCNEAETTSVPL

KTAVKDKTRRCSLGIFLPKLPSKRSCSITGVDDLEQILADAADLTQLETQPVCSKDPGIGSVAAKLNLSPSQFINEENLPVYPGEILSSDSVSLDIEESV

LIDTSQRESLPSENKTENCRAQKRTRVEENDVTNEKKIRTHDSAQDQEVSCLEPKNVLEF

For any suggestions or comments, please send an email to unitrap@crg.es