Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027329 (Spef1)
Chromosomal location
Chr 2: 130995997 - 131013018 (-)
Description
sperm flagellar 1 Gene [Source:MGI (curated);Acc:Spef1-001]
RefSeq_dna
NM_027641 
RefSeq_peptide
NP_081917.1 
UniGene
Mm.252722 
MGI
MGI:3513546 
Uniprot/SWISSPROT
Q99JL1 
Uniprot/SPTREMBL
A2ANS9 
Human Ortholog
ENSG00000101222 (C20orf28)
Omim not available
UniTrap UNI36518
Vector Insertion
Chr 2: 131000300 - 131013019
Public Clones IST11565F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32360
Vector Insertion
Chr 2: 130995996 - 130997762
Public Clones IST12807D5 (tigm) IST14346E7 (tigm) IST14338A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110218
Sequence
AGAAGGGATTTGTGTCTGTGCCGAATAGGGACCCAAACGTATATCTGAACGCTCGCAGTTGCGAGAGGAGGCATTTGAAAGGTCCTGGGGCTGGCGCTGG

GCTCTGTCGGGAACGTTGAGGCCTTGCTCTGGATCCAATGGAAAGCAGCGTGGATGAGGAGGCTCTGCACCAGCTGTACCTCTGGGTAGACAATATCCCT

CTGTCCAGACCCAAGAGAAACCTCTCCCGGGACTTCAGTGACGGAG - UNI36518 - TCCTGGTTGCAGAGCTTATCAAGTTTTACTTCCCCAAGAT

GGTGGAGATGCACAATTATGTCCCTGCCAACTCTCTCCAGCAGAAGCTCAGCAACTGGGGTCACCTGAACAG AAAGGTGCTGAACAAGCTGAACTTCTC

GGTCCCTGACGATGTGATGCGGAAGATTGCGCAGTGTTCTCCGGGAGTAGTGGAGCTAGTGCTCATTCCACTGAGGCAGCGCCTGGAGGAGCGGCAGAGG

CGCCAGAAGCTGGGTGTTGGCTCCTTACAG GAGCTGGCTCCTCAGGATAGCAGTGGCTACATGGATATGG GTTTGCCCCAGAAGGTTCGAGGAGAGGG

TGCCCCAGCCTTGGGAGAGCAGCTCAG - UNI32360 - AGAGGGCCGTCCGTTGGCTTCCCGACCCCCTGGGTATAACCAGGCGCTGCAGGGTGATC

CGAGCTTCGTCCTCCAGATCGCTGAAAAGGAGCAGGAGCTGTTGGCCTCTCAAGAGACAGTACAG - UNI32360 - GTCCTTCAGATGAAGGTGAAG

CGTCTGGAACATCTGCTCCAACTTAAGAACGTGCGCATCGATGATCTCTCCCGGCGGCTCCAGCAGGCCGAGCGCAAGCAGCGGTGAGCGGTGCCAGGGC

TGCGCCGGGCTTCCCAGTACCCGCCCGAGCCCAGACGCCGCGACCCACCCACTCACCTGCCGACGCAGGGTTGGGAGGGCGGAGCGAGCTGCTCACTAGT

GCCTCCTGCAGCTACGGCGCTCGGCTGCGGAGGGTTCGAGCGAACGTGGGGTTGCTCAACGCCGAGGCCGGGGACTGATCCTCCTCCTTACACTCCATCT

GGGCCAGGAAAAAGGATCACTTTCCACAGCCCAGAAAGCCTGTACATCGCATGATCTCCCAAACCACTTTGAAGCTCCCGGCGCTGGGCCTGGAGAGGCG

GTCCTCTGTCTCGTTCCACTCCTCTAGAACCGGTTCCTTTCTCAGCATAGAAGATAGCTTCATCTCTATCCTTGCTAAATCTCCAAGGCCTCCGACACTC

GAGAAATTATCCCGGGAAGCTGAGGAATTCTCTTGCCCATCCTGAGTGCTGACCGGGGACCAGTTTTAGGGCTGGAAATCACAGCAGCTGGAGAGGAAGG

GATAAGGTGTTGAAGTAGGCGGGAGTAAGGGAGGCACCCAGCTGTGCAGTCGCTCTCCTCTCACGGAGCATTCTAAGGAGTGCCTGGGAAGATAGGGCAG

AGTTGTCTCCATTAAAGGTGCTGTTGTGCGTTATTTCCTGTGCCTGCCTTCTCTTTCTGCCTGTATGGATCCCCAAAGGCAGTGAGTTCCTGGCTTGTCC

TTTATCCCTTTCGCCCAGCTGTCCTCTTTTAGACCCTGTGGGCCTATTATTACATTGATGATAATGCCAGTGGGAAGATTTTGTGACGTGTGACAGCCTG

CTTCTAGCACTGGGTGACCCCTTCCTTGTCTGTCCGTCCCCACCCCTCAGTGTCCTCTAATCTTGTTCAAACCCAAGCTACGATTTTCACCAATTGTGGC

CACTCATGTCCTCAACCTTGCCCATGGACTCTCTTAAATTAGCTTTCTGTATGACTCTCAACCCTGTCCACACACTGGTCTCAATTTATGGATGGTTGGC

TACATGTCACTTGACAGGCCTGGCAACTCCATTCATAGGCATATTACATGGGAGAAACTCTTGTGCCCTGAGTTCTGGGAGATACACTGTAACAATCATA

CAGAATTGAAGTGATGGGCTGGAGAGATGGCTTAGCCGTTAAGAGCATTTGCTGTTCTTACAGAGGACACAGGTTCCATGCCCAGCACCCACATGACAGC

TCACAACTGTTGATCACTCCAATTCCAGGGTCTCCAACACCCTCCTCTACCTCCATAAACTCCAGGACTGCATGTGGTGCACAGAGAGATATATGAGCTT

AAAATAACTCTAAAAACTTTAAAAAAAAAAGAATTAAAAGGAACTTGTATTTGGTTATCTATTACTGTGTACAAATTACCATCAATGTAAAGGCTTAAAG

CAACACATG
Translation
MESSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGV - UNI36518 - VLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNR RKVLNKLNFS

VPDDVMRKIAQCSPGVVELVLIPLRQRLEERQRRQKLGVGSLQ ELAPQDSSGYMDMG GLPQKVRGEGAPALGEQLR - UNI32360 - REGRPLAS

RPPGYNQALQGDPSFVLQIAEKEQELLASQETVQ - UNI32360 - VLQMKVKRLEHLLQLKNVRIDDLSRRLQQAERKQR
Transcript ENSMUST00000028801
Sequence
AAACTCAAAGACCGAGAGGTGGCGCGGCCGCTGAATGCCACCCAGCACGCGGGCAGGACTGAGAGCTGAACCCGGCGCAGACTTCTGCAGGG - UNI36

518 - GGACCCAAACGTATATCTGAACGCTCGCAGTTGCGAGAGGAGGCATTTGAAAGGTCCTGGGGCTGGCGCTGGGCTCTGTCGGGAACGTTGAGGC

CTTGCTCTGGATCCAATGGAAAGCAGCGTGGATGAGGAGGCTCTGCACCAGCTGTACCTCTGGGTAGACAATATCCCTCTGTCCAGACCCAAGAGAAACC

TCTCCCGGGACTTCAGTGACGGAG - UNI36518 - TCCTGGTTGCAGAGCTTATCAAGTTTTACTTCCCCAAGATGGTGGAGATGCACAATTATGTC

CCTGCCAACTCTCTCCAGCAGAAGCTCAGCAACTGGGGTCACCTGAACAG AAAGGTGCTGAACAAGCTGAACTTCTCGGTCCCTGACGATGTGATGCGG

AAGATTGCGCAGTGTTCTCCGGGAGTAGTGGAGCTAGTGCTCATTCCACTGAGGCAGCGCCTGGAGGAGCGGCAGAGGCGCCAGAAGCTGGGTGTTGGCT

CCTTACAG GAGCTGGCTCCTCAGGATAGCAGTGGCTACATGGATATGG GTTTGCCCCAGAAGGTTCGAGGAGAGGGTGCCCCAGCCTTGGGAGAGCAG

CTCAG - UNI32360 - AGAGGGCCGTCCGTTGGCTTCCCGACCCCCTGGGTATAACCAGGCGCTGCAGGGTGATCCGAGCTTCGTCCTCCAGATCGC

TGAAAAGGAGCAGGAGCTGTTGGCCTCTCAAGAGACAGTACAG - UNI32360 - GTCCTTCAGATGAAGGTGAAGCGTCTGGAACATCTGCTCCAAC

TTAAGAACGTGCGCATCGATGATCTCTCCCGGCGGCTCCAGCAGGCCGAGCGCAAGCAGCGGTGAGCGGTGCCAGGGCTGCGCCGGGCTTCCCAGTACCC

GCCCGAGCCCAGACGCCGCGACCCACCCACTCACCTGCCGACGCAGGGTTGGGAGGGCGGAGCGAGCTGCTCACTAGTGCCTCCTGCAGCTACGGCGCTC

GGCTGCGGAGGGTTCGAGCGAACGTGGGGTTGCTCAACGCCGAGGCCGGGGACTGATCCTCCTCCTTACACTCCATCTGGGCCAGGAAAAAGGATCACTT

TCCACAGCCCAGAAAGCCTGTACATCGCATGATCTCCCAAACCACTTTGAAGCTCCCGGCGCTGGGCCTGGAGAGGCGGTCCTCTGTCTCGTTCCACTCC

TCTAGAACCGGTTCCTTTCTCAGCATAGAAGATAGCTTCATCTCTATCCTTGCTAAATCTCCAAGGCCTCCGACACTCGAGAAATTATCCCGGGAAGCTG

AGGAATTCTCTTGCCCATCCTGAGTGCTGACCGGGGACCAGTTTTAGGGCTGGAAATCACAGCAGCTGGAGAGGAAGGGATAAGGTGTTGAAGTAGGCGG

GAGTAAGGGAGGCACCCAGCTGTGCAGTCGCTCTCCTCTCACGGAGCATTCTAAGGAGTGCCTGGGAAGATAGGGCAGAGTTGTCTCCATTAAAGGTGCT

GTTGTGCGTTATTTCCTGTGCCTGCCTTCTCTTTCTGCCTGTATGGATCCCCAAAGGCAGTGAGTTCCTGGCTTGTCCTTTATCCCTTTCGCCCAGCTGT

CCTCTTTTAGACCCTGTGGGCCTATTATTACATTGATGATAATGCCAGTGGGAAGATTTTGTGACGTGTGACAGCCTGCTTCTAGCACTGGGTGACCCCT

TCCTTGTCTGTCCGTCCCCACCCCTCAGTGTCCTCTAATCTTGTTCAAACCCAAGCTACGATTTTCACCAATTGTGGCCACTCATGTCCTCAACCTTGCC

CATGGACTCTCTTAAATTAGCTTTCTGTATGACTCTCAACCCTGTCCACACACTGGTCTCAATTTATGGATGGTTGGCTACATGTCACTTGACAGGCCTG

GCAACTCCATTCATAGGCATATTACATGGGAGAAACTCTTGTGCCCTGAGTTCTGGGAGATACACTGTAACAATCATACAGAATTGAAGTGATGGGCTGG

AGAGATGGCTTAGCCGTTAAGAGCATTTGCTGTTCTTACAGAGGACACAGGTTCCATGCCCAGCACCCACATGACAGCTCACAACTGTTGATCACTCCAA

TTCCAGGGTCTCCAACACCCTCCTCTACCTCCATAAACTCCAGGACTGCATGTGGTGCACAGAGAGATATATGAGCTTAAAATAACTCTAAAAACTTTAA

AAAAAAAAGAATTAAAAGGAACTTGTATTTGGTTATCTATTACTGTGTACAAATTACCATCAATGTAAAGGCTTAAAGCAACACATG
Translation
 - UNI36518 - MESSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGV - UNI36518 - VLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGH

LNR RKVLNKLNFSVPDDVMRKIAQCSPGVVELVLIPLRQRLEERQRRQKLGVGSLQ ELAPQDSSGYMDMG GLPQKVRGEGAPALGEQLR - UNI32

360 - REGRPLASRPPGYNQALQGDPSFVLQIAEKEQELLASQETVQ - UNI32360 - VLQMKVKRLEHLLQLKNVRIDDLSRRLQQAERKQR

For any suggestions or comments, please send an email to unitrap@crg.es