Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027341 (5730494N06Rik)
Chromosomal location
Chr 2: 132065228 - 132073518 (-)
Description
RIKEN cDNA 5730494N06 gene Gene [Source:MGI Symbol;Acc:MGI:1917862]
RefSeq_dna
NM_027478 
RefSeq_peptide
NP_081754.1 
UniGene
Mm.404798 Mm.425583 Mm.30116 
MGI
MGI:1917862 
Uniprot/SWISSPROT
Q8CIB6 
Uniprot/SPTREMBL
A2AMQ1 
Human Ortholog
ENSG00000089063 (C20orf30)
Omim not available
UniTrap UNI30072
Vector Insertion
Chr 2: 132071691 - 132073506
Public Clones D127F07 (ggtc) CMHD-GT_518H12-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22693
Vector Insertion
Chr 2: 132066363 - 132069754
Public Clones not available
Private Clones OST287668 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028816
Sequence
AAGACCGCCCCTTCCGCTTGGCTGTTGAGCGAGCCTTGCGAGCGCGCCTAACGGAGAACGGGGAGCGCAGCGCGGGTAGGGGGCGGGCGCGCGCTCCCGG

AAGCCAGCCGCGAGACCTGGCCCTGCCACCGAGGCTGCTTCCCGGAGACAGTTAGTTCACGTTGGCGGCGGCGGAGGGCGACGAGAGGTTGTCCACAGCG

CCACGCTTAG - UNI30072 - ACTAGCTGTGTTACTCTGTTATGATGCCGTCTCGTACCAACCTGGCAACTGGACTCCCCAGCAGTAAAGTCAAATA

TTCAAGGCTTGCCAGCACAGACGATGGCTACATTGACCTTCAG - UNI30072 - TTTAAAAAAAGCCCTCCTAAGATCCCTTATAAGGCCATTGCCC

TTGCTACCGTGCTGTTTTTGATTGGCACCTTTCTCATAATCATAGGCTCTCTCCTGCTGTCGGGCTACATCAGCAAAGGG - UNI22693 - GGGGCA

GACCGAGCCGTTCCTGTCCTCATCATAGGCATTTTGGTGTTCCTACCGGGATTTTACCATTTGCGCATCGCCTATTATGCATCCAAGGGCTACCGGGGTT

ACTCCTACGATGACATTCCAGACTTTGATGACTAGCCTTCGCCTCAGCCTTGAGAAGAGTCGCACACAGTGCAACCACTTTAAGACATCAAGCAAGAACT

CTGGCTAAGGGCTGAAGAAGTCTACAATTTGCAGATGTTTAGCAAAACAATGGCCAGATTGTATGAGTCCTTCTCCAAAACGCTCCTGCTTTATAATTAG

CTAATTAGGACATGGTATGTTTTCATCTCCTGGCCCTGGCTAAACTTGACAAGTTTTTCCACATGAGTGTGCATCATGTAAGAGTTGTGAAGCTAACTGT

CTGGGAAGGCAGCCTGTTCTATAGTGGAAGGTGTTACCCTCCTTAGAGCTGAACCTTTCTTTTGTCTTCCATTGTCTGCTTGGTTTTGTAGCATAATGGG

AAATGTATTGTCTAGTTTCTTATTACTAAGTAATTTATTTTTAAAATTACCTATCTTATCTCTCACCCTCTCCTCTACCATTATATCCTAGTAAAATTAA

AGTATCTGTCTTACCTTCATATGCTCCTCCACCTTCATATCCCAGTAAAACCAAATATCTGTAGATCCATCTCTAATTGGCTTTTTTTACATTGACAGCA

ACCTGGAATTTTTAAACCATGAAGCTGGGTATTATGATCCCAGTACTTGGGAGGCAGAGCCAGGTGGATCTCTATGAGTTCAAGGCCAGCCTGGTCTACA

TAGAGTTTTACGACAACTAGGGCTACCTAGTGAGACCCTGTCTCAAGAAAAGGGAAACTTCCTCTGGTTTCTCCATAGTTTGCCTACTACAAAACTCAGG

TGAATCTGTCCTTTGTAGGTCAAGAGATTGTGTGAATCATACCTCAAGGACTAGACTTTGGCTGTTTCTTCGTAAAACTGTAGATAAGTGTACTTAGAGT

TTATAGCCCTACTGCTGGCTGGTACTATGATATCATTCTGCTAAAGATTACAAGACTTGGCCAAGATCCCTGAAAATGTATTAAGTCAAATCTGGTTCTC

AGCTTATAAAAAGTGACAATTTTTTCT
Translation
 - UNI30072 - MMPSRTNLATGLPSSKVKYSRLASTDDGYIDLQ - UNI30072 - FKKSPPKIPYKAIALATVLFLIGTFLIIIGSLLLSGYIS

KG - UNI22693 - GADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Transcript ENSMUST00000110163
Sequence
CCGCTTGGCTGTTGAGCGAGCCTTGCGAGCGCGCCTAACGGAGAACGGGGAGCGCAGCGCGGGTAGGGGGCGGGCGCGCGCTCCCGGAAGCCAGCCGCGA

GACCTGGCCCTGCCACCGAGGCTGCTTCCCGGAGACAGTTAGTTCACGTTGGCGGCGGCGGAGGGCGACGAGAG - UNI30072 - ACTAGCTGTGTT

ACTCTGTTATGATGCCGTCTCGTACCAACCTGGCAACTGGACTCCCCAGCAGTAAAGTCAAATATTCAAGGCTTGCCAGCACAGACGATGGCTACATTGA

CCTTCAG - UNI30072 - TTTAAAAAAAGCCCTCCTAAGATCCCTTATAAGGCCATTGCCCTTGCTACCGTGCTGTTTTTGATTGGCACCTTTCTCA

TAATCATAGGCTCTCTCCTGCTGTCGGGCTACATCAGCAAAGGG - UNI22693 - GGGGCAGACCGAGCCGTTCCTGTCCTCATCATAGGCATTTTG

GTGTTCCTACCGGGATTTTACCATTTGCGCATCGCCTATTATGCATCCAAGGGCTACCGGGGTTACTCCTACGATGACATTCCAGACTTTGATGACTAGC

CTTCGCCTCAGCCTTGAGAAGAGTCGCACACAGTGCAACCACTTTAAGACATCAAGCAAGAACTCTGGCTAAGGGCTGAAGAAGTCTACAATTTGCAGAT

GTTTAGCAAAACAATGGCCAGATTGTATGAGTCCTTCTCCAAAACGCTCCTGCTTTATAATTAGCTAATTAGGACATGGTATGTTTTCATCTCCTGGCCC

TGGCTAAACTTGACAAGTTTTTCCACATGAGTGTGCATCATGTAAGAGTTGTGAAGCTAACTGTCTGGGAAGGCAGCCTGTTCTATAGTGGAAGGTGTTA

CCCTCCTTAGAGCTGAACCTTTCTTTTGTCTTCCATTGTCTGCTTGGTTTTGTAGCATAATGGGAAATGTATTGTCTAGTTTCTTATTACTAAGTAATTT

ATTTTTAAAATTACCTATCTTATCTCTCACCCTCTCCTCTACCATTATATCCTAGTAAAATTAAAGTATCTGTCTTACCTTCATATGCTCCTCCACCTTC

ATATCCCAGTAAAACCAAATATCTGTAGATCCATCTCTAATTGGCTTTTTTTACATTGACAGCAACCTGGAATTTTTAAACCATGAAGCTGGGTATTATG

ATCCCAGTACTTGGGAGGCAGAGCCAGGTGGATCTCTATGAGTTCAAGGCCAGCCTGGTCTACATAGAGTTTTACGACAACTAGGGCTACCTAGTGAGAC

CCTGTCTCAAGAAAAGGGAAACTTCCTCTGGTTTCTCCATAGTTTGCCTACTACAAAACTCAGGTGAATCTGTCCTTTGTAGGTCAAGAGATTGTGTGAA

TCATACCTCAAGGACTAGACTTTGGCTGTTTCTTCGTAAAACTGTAGATAAGTGTACTTAGAGTTTATAGCCCTACTGCTGGCTGGTACTATGATATCAT

TCTGCTAAAGATTACAAGACTTGGCCAAGATCCCTGAAAATGTATTAAGTCAAATCTGGTTCTCAGCTTATAAAAAGTGACAATTTTTTCTAA
Translation
 - UNI30072 - MMPSRTNLATGLPSSKVKYSRLASTDDGYIDLQ - UNI30072 - FKKSPPKIPYKAIALATVLFLIGTFLIIIGSLLLSGYIS

KG - UNI22693 - GADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Transcript ENSMUST00000110164
Sequence
CCGAGGCTGCTTCCCGGAGACAGTTAGTTCACGTTGGCGGCGGCGGAGGGCGACGAGAGGTTGTCCACAGCGCCACGCTTAGGTCCTTGTGGGCCCGGGA

GGGTGGGCAGAAATCGTGGTGGGGCCGGTAAAAAGTGTAGCAGAAACTTGGGCTGATAGTTTTTTAAGTTGTCATTTACTATGTGATAACGCCACTCTAG

AATCCCTTGCTAAGAAAAACAAATCTTCCCATTTCGTTGTCGTGCTGCAACGTTTTTGTTTTGGTGCGAGTTTATAAGTGGAAAGTACATAACTTTATAA

CTTGTAATACAAATCAGGCATGGTTTAATGCTTCGAAAATCCTGCTTATTGGTAGCTTCAACTTTTAGATATGAGGAATTAAACATGTTATGGGATGGCA

ACATCAAAAACCTAGTACCTAAGGTTTAGAAATGTAAATGGATTCCCGTTGCTCCTTTTTAGTACTTCTGAACTAGGATGTAATTAACCAAAACGCAGAA

ACACTTGACACCAGTTTTTTGCATGCTAGTTACTTAAGGTCGACTGTAATACCAGTGTCTGGCAGCTCATTAAGATCGAAAAAATATCACATGCCATTGT

GGAGATTATGTGCAAAACATCACACCAGTGAAGGCCACTTAGTTTTCTTCTTAAAGATGGACTTTTTGCGTTTAGAATTCAAATGCCATTGCAAATAAAA

TAGTCTGTTTTGTTTACATAATTGTATGACTTTATAAAGAATCCACACATTTCATTTATGGTAGGGGAGAGTGTCTGGTCTTCCTATGTTGCCCAGACTG

GCCTCCAACTTCGTATATCCACACCTTTCTTCCCAAGTAGTTGGGATTAGAGTAACCTACTGAAGTACTGAGCTTAAATTTCAAACTTTTAAGATTTAAA

CGTCATTGCTTTTAAATTTTACCTACTCTCAAATAATTCAGTAGTTATGATTTTTATTATGTCTGTCTGCTTTGAATAGTTTGAGTAAAACGGATTTTTA

GATCCGTTTTTTCAGGAGCTACATGATGTGGAATGTAAACTCACTTGTTTCATGCTTGGGATGGGAGCAGAGAGGCAGGTGGCCGTGGATGTCTAGTGTG

GTATGGATAGCCAGGGCGTTTCCCACATGGATAAGAATTTGTACATAGAACCGTACCACACCTAGAAGTAGACACGATGCTGATGTGTGTGTCATTCCTT

ATCCTCCTCCTCCTCCTTTCATGGCAGACAAAAAAGTTATGTGAATTTATGCTCCTGAGGAAAGTTAAGGGGTAGGCAGTACTGTAAGGGAGGGGTTGAA

AATGTGAACATTGGACTTTAGAAAATTAGGCCAGAAACATCGGTAGCAGATTGAACAGAGCCTGATTCTTGGTGAAGTGCCTTTGGTGTCTTTCTGTGAA

GTCAACCTAGATCCATAAAGGAAGCATGCTTAGTGTGTACAAGAAGTGTCGGGTCACCGTAAGCAGTGAAACGCCTAAGCTACCATGGGTAGCATGTGGC

ACAGCAGCTCGGAACAGTATCTGACATCCTTTCCTGGGCTGTACTGGGACTGCTGCAGACAACAAGTCTTTCCCTTTCAGACTAGCTGTGTTACTCTGTT

ATGATGCCGTCTCGTACCAACCTGGCAACTGGACTCCCCAGCAGTAAAGTCAAATATTCAAGGCTTGCCAGCACAGACGATGGCTACATTGACCTTCAG 

- UNI30072 - TTTAAAAAAAGCCCTCCTAAGATCCCTTATAAGGCCATTGCCCTTGCTACCGTGCTGTTTTTGATTGGCACCTTTCTCATAATCATA

GGCTCTCTCCTGCTGTCGGGCTACATCAGCAAAGGG - UNI22693 - GGGGCAGACCGAGCCGTTCCTGTCCTCATCATAGGCATTTTGGTGTTCCT

ACCGGGATTTTACCATTTGCGCATCGCCTATTATGCATCCAAGGGCTACCGGGGTTACTCCTACGATGACATTCCAGACTTTGATGACTAGCCTTCGCCT

CAGCCTTGAGAAGAGTCGCACACAGTGCAACCACTTTAAGACATCAAGCAAGAACTCTGGCTAAGGGCTGAAGAAGTCTACAATTTGCAGATGTTTAGCA

AAACAATGGCCAGATTGTATGAGTCCTTCTCCAAAACGCTCCTGCTTTATAATTAGCTAATTAGGACATGGTATGTTTTCATCTCCTGGCCCTGGCTAAA

CTTGACAAGTTTTTCCACATGAGTGTGCATCATGTAAGAGTTGTGAAGCTAACTGTCTGGGAAGGCAGCCTGTTCTATAGTGGAAGGTGTTACCCTCCTT

AGAGCTGAACCTTTCTTTTGTCTTCCATTGTCTGCTTGGTTTTGTAGCATAATGGGAAATGTATTGTCTAGTTTCTTATTACTAAGTAATTTATTTTTAA

AATTACCTATCTTATCTCTCACCCTCTCCTCTACCATTATATCCTAGTAAAATTAAAGTATCTGTCTTACCTTCATATGCTCCTCCACCTTCATATCCCA

GTAAAACCAAATATCTGTAGATCCATCTCTAATTGGCTTTTTTTACATTGACAGCAACCTGGAATTTTTAAACCATGAAGCTGGGTATTATGATCCCAGT

ACTTGGGAGGCAGAGCCAGGTGGATCTCTATGAGTTCAAGGCCAGCCTGGTCTACATAGAGTTTTACGACAACTAGGGCTACCTAGTGAGACCCTGTCTC

AAGAAAAGGGAAACTTCCTCTGGTTTCTCCATAGTTTGCCTACTACAAAACTCAGGTGAATCTGTCCTTTGTAGGTCAAGAGATTGTGTGAATCATACCT

CAAGGACTAGACTTTGGCTGTTTCTTCGTAAAACTGTAGATAAGTGTACTTAGAGTTTATAGCCCTACTGCTGGCTGGTACTATGATATCATTCTGCTAA

AGATTACAAGACTTGGCCAAGATCCCTGAAAATGTATTAAGTCAAATCTGGTTCTCAGCTTATAAAAAGTGACAATTTTTTCTAA
Translation
MMPSRTNLATGLPSSKVKYSRLASTDDGYIDLQ - UNI30072 - FKKSPPKIPYKAIALATVLFLIGTFLIIIGSLLLSGYISKG - UNI22693 

- GADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD

For any suggestions or comments, please send an email to unitrap@crg.es