Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027357 (Crls1)
Chromosomal location
Chr 2: 132672424 - 132692521 (+)
Description
cardiolipin synthase 1 Gene [Source:MGI (curated);Acc:Crls1-001]
RefSeq_dna
NM_001024385 NM_025646 
RefSeq_peptide
NP_079922.2 NP_001019556.1 
MGI
MGI:1913836 
Uniprot/SWISSPROT
Q80ZM8 
Uniprot/SPTREMBL
A2AVN0 
Human Ortholog
ENSG00000088766 (CRLS1)
Omim not available
UniTrap UNI24509
Vector Insertion
Chr 2: 132673617 - 132675601
Public Clones not available
Private Clones OST217089 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028835
Sequence
AGAGTGTAGAAATTAGTATGGAGCTGTCCATACGGCCTCGGCACCGCTCGACTTCTCTAGAGAAGCTGGCAGCCGGTGCCAGGGGCGTCTGAGTTCTCGA

CTCTTGGACTCCGTGGAGGCCACACGGCCATGTTGGCTTGGCGCGTGGCGCGCGGCGCGTGGGGCCCTCTTCGCGTGGCCCTCCGGCCTCCGGGGGCGCG

GCTCGGCAGGGGCGGCTCCCGCAGGGCCCTGCTGCCGCCCGCGGCCTGCTGCCTCGGCTGCCTGGCTGAGCGCTGGCGGCTGCGGCCGGCCGCGTTCGCC

TTGCGGCTGCCCGGCGCCGGCCCGCGGACCCACTGCTCGGGCGCGGGGAAGGCAGCCCCGGAGCCCGCCGCCGGAGGAGGAGGTGCCGCCGCGCAGGCCC

CCAGCGCCCGATGGGTCCCGGCGAGCGCCGCCAGCTCG - UNI24509 - TATGAAAATCCATGGACAATCCCAAATTTGTTGTCAATGACAAGAATT

GGCCTGGCCCCCGTGTTGGGCTACCTGATTCTTGAAGAAGACTTTAATGTTGCACTAGGTGTTTTTGCTTTAGCCGGGCTAACGGATTTG TTGGATGGA

TTTATTGCTCGAAACTGGGCCAACCAAAAATCAGCTTTGGGAAGTGCTCTTGATCCACTTGCTGATAAAGTTCTTATCAGCATCTTATATATTAGCTTGA

CCTATGCAGATCTTATTCCAG TCCCACTCACTTACATGATAATTTCAAGAGATGTAATGTTGATCGCTGCTGTGTTTTATGTCAGATACCGAACTCTGC

CAACACCG CGAACACTAGCTAAGTACTTCAATCCTTGCTATGCCACGGCTAGGTTAAAACCAACATTCATCAGCAAG GTAAATACAGCAGTCCAGTTA

ATTTTGGTGGCAGCTTCTTTGGCAGCTCCAGTTTTCAATTATGCTGACAGCATTTATCTTCAGATACTATG GTGTTGCACAGCATTCACTACAGCTGCA

TCAGCATACAGTTATTATCACTATGGTCGGAAAACTGTTCAGGTGATAAAGGGCAAATGAGAAGCACCCAGATCCAGCAGCAAGGAAGCAACTTCGTCAT

CGGCAGCAGCGCCAGCGAAAGCTACAGGACTTTCCTGATCTTGGTGTTCAGCTTGCGAAAGGTCTTGTCAGACAAACCATGTCTTCAAAACTGAAGAAAT

GTACGGCGAAAATAAGCTCGATCATGGGCCTATACAGAATTTCCAGTGTATTTTTAAATACAAATAAAACTATAATGTAGAATTTTTAATCTTAGGTTTT

TGATTAATTTGTGAGATGAATTATTCTTGTTTTTTTTTTTTTTTATGTTTTTTAAAAACATAGTTGGTAACATGGAAACAAAGGAAAGCAGGAGGGAATT

TCCTAAGATTGGATACACACCATACACAGCATGTCTATACATTTTTATGCTTGAATTTTAAATCTATAAATACATTAACAGTTCATGTGATTAATACTTG

ATCATTTGAAAACTGAGAATAAACTTAGCTGTGGGTACTGTAAAGGTGTACAGAGCTTTAAAATGCAGTACATTTTGAAAACAAAAAAGAACAAATAAAA

CAGAAGGCATTGAAGTTCACGAGTAGTCTTCCAGCCTCTCAGGTACCAAATAGTTTATGTATCAGGATAACAGATAACGCAGGAGTCAGAGGGAGAACAC

ATGTATTACGCTTTGCATCTTACAGGCAAAGCATGACATCATGCCTTCTCCCTGTTTGTAATGGGATGTTTGATACTGGAACCAGTGCTCATATGTCATG

TAAATAGGATGAAACTTTCTATTTTTCAAAGTTTTTTTTTTTTTTTTTAACTTTGGGGAATCTTCTATTGTTAACATGATAAAAAAGAAATAAAAGAGCT

GGAAAAAAATCCATGCCTTGC
Translation
MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRLPGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASA

ASS - UNI24509 - YENPWTIPNLLSMTRIGLAPVLGYLILEEDFNVALGVFALAGLTDL LDGFIARNWANQKSALGSALDPLADKVLISILYISL

TYADLIPV VPLTYMIISRDVMLIAAVFYVRYRTLPTP RTLAKYFNPCYATARLKPTFISK VNTAVQLILVAASLAAPVFNYADSIYLQILW WCCTA

FTTAASAYSYYHYGRKTVQVIKGK
Transcript ENSMUST00000110122
Sequence
AGTTACACAGCATGGGCTGAGGTGGCCACACCCCGGCAGGGGTCACAGCTTCAGGCCTAGCTTTAAAACTCTTGGAGATTGAACGCCGCCGGATGCTTTG

AAGTTGCCCTCAACCTGGCTGAAGCCCTTCCCAGCACAGTTGGCCGA - UNI24509 - TATGAAAATCCATGGACAATCCCAAATTTGTTGTCAATG

ACAAGAATTGGCCTGGCCCCCGTGTTGGGCTACCTGATTCTTGAAGAAGACTTTAATGTTGCACTAGGTGTTTTTGCTTTAGCCGGGCTAACGGATTTG 

TTGGATGGATTTATTGCTCGAAACTGGGCCAACCAAAAATCAGCTTTGGGAAGTGCTCTTGATCCACTTGCTGATAAAGTTCTTATCAGCATCTTATATA

TTAGCTTGACCTATGCAGATCTTATTCCAG TCCCACTCACTTACATGATAATTTCAAGAGATGTAATGTTGATCGCTGCTGTGTTTTATGTCAGATACC

GAACTCTGCCAACACCG CGAACACTAGCTAAGTACTTCAATCCTTGCTATGCCACGGCTAGGTTAAAACCAACATTCATCAGCAAG GTAAATACAGCA

GTCCAGTTAATTTTGGTGGCAGCTTCTTTGGCAGCTCCAGTTTTCAATTATGCTGACAGCATTTATCTTCAGATACTATG GTGTTGCACAGCATTCACT

ACAGCTGCATCAGCATACAGTTATTATCACTATGGTCGGAAAACTGTTCAGGTGATAAAGGGCAAATGAGAAGCACCCAGATCCAGCAGCAAGGAAGCAA

CTTCGTCATCGGCAGCAGCGCCAGCGAAAGCTACAGGACTTTCCTGATCTTGGTGTTCAGCTTGCGAAAGGTCTTGTCAGACAAACCATGTCTTCAAAAC

TGAAGAAATGTACGGCGAAAATAAGCTCGATCATGGGCCTATACAGAATTTCCAGTGTATTTTTAAATACAAATAAAACTATAATGTAGAATTTTTAATC

TTAGGTTTTTGATTAATTTGTGAGATGAATTATTCTTGTTTTTTTTTTTTTTTATGTTTTTTAAAAACATAGTTGGTAACATGGAAACAAAGGAAAGCAG

GAGGGAATTTCCTAAGATTGGATACACACCATACACAGCATGTCTATACATTTTTATGCTTGAATTTTAAATCTATAAATACATTAACAGTTCATGTGAT

TAATACTTGATCATTTGAAAACTGAGAATAAACTTAGCTGTGGGTACTGTAAAGGTGTACAGAGCTTTAAAATGCAGTACATTTTGAAAACAAAAAAGAA

CAAATAAAACAGAAGGCATTGAAGTTCACGAGTAGTCTTCCAGCCTCTCAGGTACCAAATAGTTTATGTATCAGGATAACAGATAACGCAGGAGTCAGAG

GGAGAACACATGTATTACGCTTTGCATCTTACAGGCAAAGCATGACATCATGCCTTCTCCCTGTTTGTAATGGGATGTTTGATACTGGAACCAGTGCTCA

TATGTCATGTAAATAGGATGAAACTTTCTATTTTTCAAAGTTTTTTTTTTTTTTTTTAACTTTGGGGAATCTTCTATTGTTAACATGATAAAAAAGAAAT

AAAAGAGCTGG
Translation
 - UNI24509 - MTRIGLAPVLGYLILEEDFNVALGVFALAGLTDL LDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPV VPLTYM

IISRDVMLIAAVFYVRYRTLPTP RTLAKYFNPCYATARLKPTFISK VNTAVQLILVAASLAAPVFNYADSIYLQILW WCCTAFTTAASAYSYYHYGR

KTVQVIKGK

For any suggestions or comments, please send an email to unitrap@crg.es