Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027361 (Gabpb1)
Chromosomal location
Chr 2: 126453178 - 126502073 (-)
Description
GA repeat binding protein, beta 1 Gene [Source:MGI (curated);Acc:Gabpb1-003]
RefSeq_dna
NM_207669 NM_010249 
RefSeq_peptide
NP_997552.1 NP_034379.1 
UniGene
Mm.474903 Mm.446933 
MGI
MGI:95611 
Uniprot/SWISSPROT
Q00420 
Uniprot/SPTREMBL
A2AQ71 A2AQ72 Q3US22 Q6WJ10 A2AQ66 Q3UJN3 Q6WJ09 Q6WJ08 Q6WJ11 A2AQ68 Q3UT69 A2AQ70 Q6WJ07 Q6WJ06 
Human Ortholog
ENSG00000104064 (GABPB1)
Omim not available
UniTrap UNI37932
Vector Insertion
Chr 2: 126501091 - 126501281
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29634
Vector Insertion
Chr 2: 126488726 - 126501192
Public Clones (sanger) E054G05 (ggtc) D081A11 (ggtc) D144B12 (ggtc) D001C03 (ggtc)
E132A06 (ggtc) D131A06 (ggtc) IST11261C1 (tigm) IST14557G6 (tigm)
IST14233D6 (tigm) IST13573G1 (tigm) IST14175C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16680
Vector Insertion
Chr 2: 126484205 - 126484314
Public Clones not available
Private Clones OST455959 (lexicon) OST442436 (lexicon) OST419248 (lexicon) OST341181 (lexicon)
OST316601 (lexicon) OST302692 (lexicon) OST289758 (lexicon) OST267994 (lexicon)
OST250574 (lexicon) OST211694 (lexicon) OST208378 (lexicon) OST170598 (lexicon)
OST113328 (lexicon) OST111625 (lexicon) OST103805 (lexicon) OST66309 (lexicon)
OST48916 (lexicon) OST35445 (lexicon) OST31011 (lexicon) OST30401 (lexicon)
OST30061 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18488
Vector Insertion
Chr 2: 126479459 - 126484205
Public Clones IST14005H5 (tigm)
Private Clones OST422605 (lexicon) OST237068 (lexicon) OST59271 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24883
Vector Insertion
Chr 2: 126478164 - 126479290
Public Clones not available
Private Clones OST202398 (lexicon) OST79960 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18163
Vector Insertion
Chr 2: 126476357 - 126477968
Public Clones not available
Private Clones OST428600 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4310
Vector Insertion
Chr 2: 126464916 - 126465081
Public Clones AG0132 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110425
Sequence
GGAGCTCGGCCGCCGTGTCCCTCCGCGCCGACGGGGACTTTTCGGTGGGGATTTTGGGCGCCGAGCAGACGCGGCATTTTCGGAAAATAGCGCCCTGTGC

AGCGAAGCGCTCTGTGTGTGGCGGGGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCCCGCTGCTCCCCCGCCGCCGCTCCC

GAAGCTTTTCCAG - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGATGAT

GAAGTTCGCATTTTGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATCTGG

CCGCACAGTATGGGCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACATGGC

GGCTTCTGAGGGCCATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI24883 - CATGGTGCTGACGTCAATGCAAAGGATATGTTAAAGATGACAG

CTCTGCATTGGGCAACAGAACATAATCATCAAGAGGTGGTGGAGCTTTTAATCAAATATGGTGCTGATGTACACACGCAGAGTAAATTTTGTAAAACTGC

ATTTGATATTTCAATAGACAATGGAAATGAAGATTTAGCAGAGATATTACAG - UNI18163 - ATTGCTATGCAGAACCAAATCAACACCAACCCGG

AGAGTCCTGACACTGTGACAATACACGCTGCCACACCACAGTTCATCATTGGACCCGGAGGGGTGGTGAACCTCACAG ATGAAACAGGAGTATCTGCTG

TTCAGTTTGGAAACTCCTCTACGTCAGTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAATTCTTCAGAAACTCCAG TGGCCA

CAGAGGAAGTGGTTACCGCAGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGCTCAGGGGGTCAGCAAGTCATCACGATAGTTACAGATGGAATCCA

GCTGGGGAATTTGCACTCCATACCAACCAGTGGGATGGGTCAGCCCATCATTGTGACGATGCCCGATGGACAGCAAG - UNI4310 - TATTGACAGT

ACCAGCAACAGACATTGCTGAAGAAACTGTCATCAGTGAAGAGCCACCAGCTAAGAGACAGTGTATGGAAATAATTGAGAGCCGGGTGGAATGTGCAGAA

ATTGAA - UNI4310 - GAGAGAGAAGCGCTTCAGAAACAGCTGGATGAAGCCAACCGAGAGGCCCAGAAATACCGACAGCAGCTGCTTAAGAAGGAG

CAGGAGGCAGAGGCCTACAGGCAGAAGCTGGAGGCCATGACACGCATCCAGACCAACAAAGAAGCCGTTTAGCTGCCATGAACACCAGTTTGCTTTTACC

TTTTGTCCAGAAAGAATATAGTCTTGAACTGTACACAGTAAGGACACAGCCATGGGAATACCGAATAATAGAAAATACTACAGCTTGATAACGGGACTTA

AGCCATGAGCTCTCAATTCTTGTAATATAAAACTTTAGAACTTGTGAAATGTATTTAAAACTGAATTCTGTAAATAGTTTTTTGGTTGTTTCTTTTTTTA

CTGTTATAAATGAGTTGATGAAGCTTGTTGCTGAGATCCAGAGGCCACAGCAAGCCACTGTTACGGGGAATTCTTTTTGATTTCGGTGCAGACTTAATTT

CTCAGAAACAGAAGTTGTAAGCGTGGTTGTTGTCTCTTAGACCAAATGTGGAACAATTATGGTGGACTGATGCTGGAAATACTCTGCAAAGAGATTTCGC

CCAGGAACTTTTGTACAGCTTTTAAGTTGTCTCAGGTTCTCTGAAAACATTTTTTAGGAAGCAGAAATTTTATATTTGTTCTATTTCAGCTACATGCAAG

TAGATTTACATGTATATGAAGCAAATATTTTTAAAATTTTGTTTGTACATATCCTGCATGTTTTATGATTTTAAAACACATCCCTTGCTTAGGTATGTCT

CCTACAAAGACGATGAAAGTTACCAAGAAAAAAACCAAGGCACCACTGTCGTTCTGCCGGTCGTTGAGAGTGAGTAAGCTCACAGCTGGTTTTACTGGCG

ACCATGACAATGTTCTTGGAGCAGCTTGCAAGAGAACTCGAATCTGCAAAATATATGCTTTTCTGACAATTGTATTGTGAGGATGTGAGACTGCTCTGTG

CCTTCCTTCCATCATGACTTCCACACGAGCACTTTGAGGCGCTGGATTTTAAGATAATGTTTTTGGCAAACTCAGTGCATTTGGGTTTCTGAAATATTTC

ATGGACTTACTCCCCTCCCCTAAGAAATTAAATTATTCTTATGGAAATTGCTTTTGTATGCAGAGCAGGACCTTTTGTACTCAGTGAGGCTATGGGTGTG

TCTAACGTAACTTTCGGTATTCCCTGTGAACGCGCTCCGGGCCTGTGCTGCGACTCTCTCACAATATTGTCAATTCTGAAATGTATGGACATTTGACAGA

CTATTCCATTCTCTTTTGTAAAATGTAACTTCAAGCTCTTTATTATTTTGTTTTGTTCTATTGCTTTATGAAAACGTTTGCCCCTCCCCCACCCCAGGCT

CCTCTAGCTTATCTGTATAAAGAACCAGTTACCTGCGAGACTGTACTCTGGCCTCATTTTCTATTTTACAATTAAATAACTTTCCACATAGCTCCATGCA

GACTCATGTTTTGACTGCACATTCATAAAATGTGGACCATAGAGCTCGGTGGTGGAGCAGGTCCTTGACGCTTTGAGACTCTGGCTCAAATCCTGTCGCA

CATACAATCTGAGACACGTTCTGCCATATGAAACCAATTAGACTCCTCATGCCTTGAAAAGCCCCAGAGTGGCTGCCTGGAAATGTGCTGGTTCGTGCCT

GGGGTAACTTTACAGGAGTTAGTGAGGGTAAGAAAGGGTCCGTGTCCCAGCCTCTCTCACTTGCCTTTCTGGGGACCACAAGGAGCCTCTATAGCAGTGC

TCCTCAGCCTCCCTGAGGCTGCAACTCTAGTCCAGTGCATGTTGTAGTGAGGAACTGTATTAAAATGTTTTTGTTGCTACTTCAGAACGGATATAAACTG

TAATGTAAATTTCTGATATTCAGGATGTCGGATCTGGGACCCCTGGGGAAGAGTATATGACCCTCCAGTGGTTGTGACCCACAGGTTGAGAACCTCTGCT

CTATGACAACCATTTTAAAAAACAAAACTAAGAGAATGCCTTCCAGTTTTTCACTAAATTTGACACTAGATGTATTCATTTTGAGATGCAGCCTCGCTGT

TACAGTCTAGTCTCCAAGTCATGAATTCTAGTGACCTTGCCACCTCAGCCTTCGTAGTTCTGGGGCCATAAGTAAGCCCCTGACACTGCCCTCGGTTTCG

ACCGAGAGAAATCTCTCACTGTGTTGACATAGCTAGTGTTGAACTTTTGAATTCACTTGATCTATGCTTACGCGACCCGGGCTCAGTCTCCAACATGGCC

AAAGCAAAATGCATAACGCTAAGTTTGAAAAACTGCAAGCTACATTTTCAGCATCATGAAGCTGCTTGCCCTTCAGTCACAGGAAGCCGTTGGAGAACAC

GTGGCTTGGGTTTGTGTACTGATTAATATTGAACAGGACGCTGGAGTGCATTTAATGCCTTGGTGGGCAGTGTTGGGAGAGGGGCCACTGTCCGCTCCAC

GGAGTAGCCAGTGCAGTTTGTTCTCACATCAGGTTAGCTCCGCAAAGCCTCAAGGTGGTAACAGAGAAAGCAGCTGCAGGCGCACGTGTGTTGCTTTCAC

TCCCAGTCATGGGTTCTGCTGGAGACCATGTGATACAGGATGTAATTTTGATCTTCAGTAATAACAGCAAGCCAAGTGATTCGAGGAAACAATTGGGTGT

CGTGTAACAAGTATTCGGGCAGCTTCGAGATGTTTACTGTCTCCAGAGCCACATTGGACAGTGTTGTCTCTAAAATCTTCACCTGACTCACTGCTGAGAA

AGCAATCCGTAGACAAGAATCTAAAGGAGATGAGATGTCCTCACCCCTCGTTTATCAGTTCCTTCTAACAGTTTCCACGTAGGCTGGGAAAGCTTCCGTG

CTGTTCTGTACTGAGGACTAGAATAACTGGTGATATGTGAAATAAAAATGTCTAGCAATC
Translation
 - UNI16680 - - UNI29634 - MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDW - UNI16680 - - UNI18488 - LGTSPLHLAA

QYGHFSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHANIVEVLLK - UNI24883 - HGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHT

QSKFCKTAFDISIDNGNEDLAEILQ - UNI18163 - IAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTD DETGVSAVQFGNSSTSVLATLA

ALAEASAPLSNSSETPV VATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGMGQPIIVTMPDGQQV - UNI4310 - VLTVPAT

DIAEETVISEEPPAKRQCMEIIESRVECAEIE - UNI4310 - EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRIQTNKEAV
Transcript ENSMUST00000089743
Sequence
GGAGCTCGGCCGCCGTGTCCCTCCGCGCCGACGGGGACTTTTCGGTGGGGATTTTGGGCGCCGAGCAGACGCGGCATTTTCGGAAAATAGCGCCCTGTGC

AGCGAAGCGCTCTGTGTGTGGCGGGGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCCCGCTGCTCCCCCGCCGCCGCTCCC

GAAGCTTTTCCAG - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGATGAT

GAAGTTCGCATTTTGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATCTGG

CCGCACAGTATGGGCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACATGGC

GGCTTCTGAGGGCCATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI4310 - - UNI18163 - - UNI24883 - GAGAGAGAAGCGCTTCAG

AAACAGCTGGATGAAGCCAACCGAGAGGCCCAGAAATACCGACAGCAGCTGCTTAAGAAGGAGCAGGAGGCAGAGGCCTACAGGCAGAAGCTGGAGGCCA

TGACACGCATCCAGACCAACAAAGAAGCCGTTTAGCTGCCATGAACACCAGTTTGCTTTTACCTTTTGTCCAGAAAGAATATAGTCTTGAACTGTACACA

GTAAGGACACAGCCATGGGAATACCGAATAATAGAAAATACTACAGCTTGATAACGGGACTTAAGCCATGAGCTCTCAATTCTTGTAATATAAAACTTTA

GAACTTGTGAAATGTATTTAAAACTGAATTCTGTAAATAGTTTTTTGGTTGTTTCTTTTTTTACTGTTATAAATGAGTTGATGAAGCTTGTTGCTGAGAT

CCAGAGGCCACAGCAAGCCACTGTTACGGGGAATTCTTTTTGATTTCGGTGCAGACTTAATTTCTCAGAAACAGAAGTTGTAAGCGTGGTTGTTGTCTCT

TAGACCAAATGTGGAACAATTATGGTGGACTGATGCTGGAAATACTCTGCAAAGAGATTTCGCCCAGGAACTTTTGTACAGCTTTTAAGTTGTCTCAGGT

TCTCTGAAAACATTTTTTAGGAAGCAGAAATTTTATATTTGTTCTATTTCAGCTACATGCAAGTAGATTTACATGTATATGAAGCAAATATTTTTAAAAT

TTTGTTTGTACATATCCTGCATGTTTTATGATTTTAAAACACATCCCTTGCTTAGGTATGTCTCCTACAAAGACGATGAAAGTTACCAAGAAAAAAACCA

AGGCACCACTGTCGTTCTGCCGGTCGTTGAGAGTGAGTAAGCTCACAGCTGGTTTTACTGGCGACCATGACAATGTTCTTGGAGCAGCTTGCAAGAGAAC

TCGAATCTGCAAAATATATGCTTTTCTGACAATTGTATTGTGAGGATGTGAGACTGCTCTGTGCCTTCCTTCCATCATGACTTCCACACGAGCACTTTGA

GGCGCTGGATTTTAAGATAATGTTTTTGGCAAACTCAGTGCATTTGGGTTTCTGAAATATTTCATGGACTTACTCCCCTCCCCTAAGAAATTAAATTATT

CTTATGGAAATTGCTTTTGTATGCAGAGCAGGACCTTTTGTACTCAGTGAGGCTATGGGTGTGTCTAACGTAACTTTCGGTATTCCCTGTGAACGCGCTC

CGGGCCTGTGCTGCGACTCTCTCACAATATTGTCAATTCTGAAATGTATGGACATTTGACAGACTATTCCATTCTCTTTTGTAAAATGTAACTTCAAGCT

CTTTATTATTTTGTTTTGTTCTATTGCTTTATGAAAACGTTTGCCCCTCCCCCACCCCAGGCTCCTCTAGCTTATCTGTATAAAGAACCAGTTACCTGCG

AGACTGTACTCTGGCCTCATTTTCTATTTTACAATTAAATAACTTTCCACATAGCTCCATGCAGACTCATGTTTTGACTGCACATTCATAAAATGTGGAC

CATAGAGCTCGGTGGTGGAGCAGGTCCTTGACGCTTTGAGACTCTGGCTCAAATCCTGTCGCACATACAATCTGAGACACGTTCTGCCATATGAAACCAA

TTAGACTCCTCATGCCTTGAAAAGCCCCAGAGTGGCTGCCTGGAAATGTGCTGGTTCGTGCCTGGGGTAACTTTACAGGAGTTAGTGAGGGTAAGAAAGG

GTCCGTGTCCCAGCCTCTCTCACTTGCCTTTCTGGGGACCACAAGGAGCCTCTATAGCAGTGCTCCTCAGCCTCCCTGAGGCTGCAACTCTAGTCCAGTG

CATGTTGTAGTGAGGAACTGTATTAAAATGTTTTTGTTGCTACTTCAGAACGGATATAAACTGTAATGTAAATTTCTGATATTCAGGATGTCGGATCTGG

GACCCCTGGGGAAGAGTATATGACCCTCCAGTGGTTGTGACCCACAGGTTGAGAACCTCTGCTCTATGACAACCATTTTAAAAAACAAAACTAAGAGAAT

GCCTTCCAGTTTTTCACTAAATTTGACACTAGATGTATTCATTTTGAGATGCAGCCTCGCTGTTACAGTCTAGTCTCCAAGTCATGAATTCTAGTGACCT

TGCCACCTCAGCCTTCGTAGTTCTGGGGCCATAAGTAAGCCCCTGACACTGCCCTCGGTTTCGACCGAGAGAAATCTCTCACTGTGTTGACATAGCTAGT

GTTGAACTTTTGAATTCACTTGATCTATGCTTACGCGACCCGGGCTCAGTCTCCAACATGGCCAAAGCAAAATGCATAACGCTAAGTTTGAAAAACTGCA

AGCTACATTTTCAGCATCATGAAGCTGCTTGCCCTTCAGTCACAGGAAGCCGTTGGAGAACACGTGGCTTGGGTTTGTGTACTGATTAATATTGAACAGG

ACGCTGGAGTGCATTTAATGCCTTGGTGGGCAGTGTTGGGAGAGGGGCCACTGTCCGCTCCACGGAGTAGCCAGTGCAGTTTGTTCTCACATCAGGTTAG

CTCCGCAAAGCCTCAAGGTGGTAACAGAGAAAGCAGCTGCAGGCGCACGTGTGTTGCTTTCACTCCCAGTCATGGGTTCTGCTGGAGACCATGTGATACA

GGATGTAATTTTGATCTTCAGTAATAACAGCAAGCCAAGTGATTCGAGGAAACAATTGGGTGTCGTGTAACAAGTATTCGGGCAGCTTCGAGATGTTTAC

TGTCTCCAGAGCCACATTGGACAGTGTTGTCTCTAAAATCTTCACCTGACTCACTGCTGAGAAAGCAATCCGTAGACAAGAATCTAAAGGAGATGAGATG

TCCTCACCCCTCGTTTATCAGTTCCTTCTAACAGTTTCCACGTAGGCTGGGAAAGCTTCCGTGCTGTTCTGTACTGAGGACTAGAATAACTGGTGATATG

TGAAATAAAAATGTCTAGCAATC
Translation
 - UNI16680 - - UNI29634 - MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDW - UNI16680 - - UNI18488 - LGTSPLHLAA

QYGHFSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHANIVEVLLK - UNI4310 - - UNI18163 - - UNI24883 - EREALQKQLDEANRE

AQKYRQQLLKKEQEAEAYRQKLEAMTRIQTNKEAV
Transcript ENSMUST00000110424
Sequence
GGAGCTCGGCCGCCGTGTCCCTCCGCGCCGACGGGGACTTTTCGGTGGGGATTTTGGGCGCCGAGCAGACGCGGCATTTTCGGAAAATAGCGCCCTGTGC

AGCGAAGCGCTCTGTGTGTGGCGGGGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCCCGCTGCTCCCCCGCCGCCGCTCCC

GAAGCTTTTCCAG - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGATGAT

GAAGTTCGCATTTTGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATCTGG

CCGCACAGTATGGGCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACATGGC

GGCTTCTGAGGGCCATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI24883 - CATGGTGCTGACGTCAATGCAAAGGATATGTTAAAGATGACAG

CTCTGCATTGGGCAACAGAACATAATCATCAAGAGGTGGTGGAGCTTTTAATCAAATATGGTGCTGATGTACACACGCAGAGTAAATTTTGTAAAACTGC

ATTTGATATTTCAATAGACAATGGAAATGAAGATTTAGCAGAGATATTACAG - UNI18163 - ATTGCTATGCAGAACCAAATCAACACCAACCCGG

AGAGTCCTGACACTGTGACAATACACGCTGCCACACCACAGTTCATCATTGGACCCGGAGGGGTGGTGAACCTCACAG ATGAAACAGGAGTATCTGCTG

TTCAGTTTGGAAACTCCTCTACGTCAGTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAATTCTTCAGAAACTCCAG TAGTGG

CCACAGAGGAAGTGGTTACCGCAGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGCTCAGGGGGTCAGCAAGTCATCACGATAGTTACAGATGGAAT

CCAGCTGGGGAATTTGCACTCCATACCAACCAGTGGGATGGGTCAGCCCATCATTGTGACGATGCCCGATGGACAGCAAG - UNI4310 - TATTGAC

AGTACCAGCAACAGACATTGCTGAAGAAACTGTCATCAGTGAAGAGCCACCAGCTAAGAGACAGTGTATGGAAATAATTGAGAGCCGGGTGGAATGTGCA

GAAATTGAA - UNI4310 - GAGAGAGAAGCGCTTCAGAAACAGCTGGATGAAGCCAACCGAGAGGCCCAGAAATACCGACAGCAGCTGCTTAAGAAG

GAGCAGGAGGCAGAGGCCTACAGGCAGAAGCTGGAGGCCATGACACGCATCCAGACCAACAAAGAAGCCGTTTAGCTGCCATGAACACCAGTTTGCTTTT

ACCTTTTGTCCAGAAAGAATATAGTCTTGAACTGTACACAGTAAGGACACAGCCATGGGAATACCGAATAATAGAAAATACTACAGCTTGATAACGGGAC

TTAAGCCATGAGCTCTCAATTCTTGTAATATAAAACTTTAGAACTTGTGAAATGTATTTAAAACTGAATTCTGTAAATAGTTTTTTGGTTGTTTCTTTTT

TTACTGTTATAAATGAGTTGATGAAGCTTGTTGCTGAGATCCAGAGGCCACAGCAAGCCACTGTTACGGGGAATTCTTTTTGATTTCGGTGCAGACTTAA

TTTCTCAGAAACAGAAGTTGTAAGCGTGGTTGTTGTCTCTTAGACCAAATGTGGAACAATTATGGTGGACTGATGCTGGAAATACTCTGCAAAGAGATTT

CGCCCAGGAACTTTTGTACAGCTTTTAAGTTGTCTCAGGTTCTCTGAAAACATTTTTTAGGAAGCAGAAATTTTATATTTGTTCTATTTCAGCTACATGC

AAGTAGATTTACATGTATATGAAGCAAATATTTTTAAAATTTTGTTTGTACATATCCTGCATGTTTTATGATTTTAAAACACATCCCTTGCTTAGGTATG

TCTCCTACAAAGACGATGAAAGTTACCAAGAAAAAAACCAAGGCACCACTGTCGTTCTGCCGGTCGTTGAGAGTGAGTAAGCTCACAGCTGGTTTTACTG

GCGACCATGACAATGTTCTTGGAGCAGCTTGCAAGAGAACTCGAATCTGCAAAATATATGCTTTTCTGACAATTGTATTGTGAGGATGTGAGACTGCTCT

GTGCCTTCCTTCCATCATGACTTCCACACGAGCACTTTGAGGCGCTGGATTTTAAGATAATGTTTTTGGCAAACTCAGTGCATTTGGGTTTCTGAAATAT

TTCATGGACTTACTCCCCTCCCCTAAGAAATTAAATTATTCTTATGGAAATTGCTTTTGTATGCAGAGCAGGACCTTTTGTACTCAGTGAGGCTATGGGT

GTGTCTAACGTAACTTTCGGTATTCCCTGTGAACGCGCTCCGGGCCTGTGCTGCGACTCTCTCACAATATTGTCAATTCTGAAATGTATGGACATTTGAC

AGACTATTCCATTCTCTTTTGTAAAATGTAACTTCAAGCTCTTTATTATTTTGTTTTGTTCTATTGCTTTATGAAAACGTTTGCCCCTCCCCCACCCCAG

GCTCCTCTAGCTTATCTGTATAAAGAACCAGTTACCTGCGAGACTGTACTCTGGCCTCATTTTCTATTTTACAATTAAATAACTTTCCACATAGCTCCAT

GCAGACTCATGTTTTGACTGCACATTCATAAAATGTGGACCATAGAGCTCGGTGGTGGAGCAGGTCCTTGACGCTTTGAGACTCTGGCTCAAATCCTGTC

GCACATACAATCTGAGACACGTTCTGCCATATGAAACCAATTAGACTCCTCATGCCTTGAAAAGCCCCAGAGTGGCTGCCTGGAAATGTGCTGGTTCGTG

CCTGGGGTAACTTTACAGGAGTTAGTGAGGGTAAGAAAGGGTCCGTGTCCCAGCCTCTCTCACTTGCCTTTCTGGGGACCACAAGGAGCCTCTATAGCAG

TGCTCCTCAGCCTCCCTGAGGCTGCAACTCTAGTCCAGTGCATGTTGTAGTGAGGAACTGTATTAAAATGTTTTTGTTGCTACTTCAGAACGGATATAAA

CTGTAATGTAAATTTCTGATATTCAGGATGTCGGATCTGGGACCCCTGGGGAAGAGTATATGACCCTCCAGTGGTTGTGACCCACAGGTTGAGAACCTCT

GCTCTATGACAACCATTTTAAAAAACAAAACTAAGAGAATGCCTTCCAGTTTTTCACTAAATTTGACACTAGATGTATTCATTTTGAGATGCAGCCTCGC

TGTTACAGTCTAGTCTCCAAGTCATGAATTCTAGTGACCTTGCCACCTCAGCCTTCGTAGTTCTGGGGCCATAAGTAAGCCCCTGACACTGCCCTCGGTT

TCGACCGAGAGAAATCTCTCACTGTGTTGACATAGCTAGTGTTGAACTTTTGAATTCACTTGATCTATGCTTACGCGACCCGGGCTCAGTCTCCAACATG

GCCAAAGCAAAATGCATAACGCTAAGTTTGAAAAACTGCAAGCTACATTTTCAGCATCATGAAGCTGCTTGCCCTTCAGTCACAGGAAGCCGTTGGAGAA

CACGTGGCTTGGGTTTGTGTACTGATTAATATTGAACAGGACGCTGGAGTGCATTTAATGCCTTGGTGGGCAGTGTTGGGAGAGGGGCCACTGTCCGCTC

CACGGAGTAGCCAGTGCAGTTTGTTCTCACATCAGGTTAGCTCCGCAAAGCCTCAAGGTGGTAACAGAGAAAGCAGCTGCAGGCGCACGTGTGTTGCTTT

CACTCCCAGTCATGGGTTCTGCTGGAGACCATGTGATACAGGATGTAATTTTGATCTTCAGTAATAACAGCAAGCCAAGTGATTCGAGGAAACAATTGGG

TGTCGTGTAACAAGTATTCGGGCAGCTTCGAGATGTTTACTGTCTCCAGAGCCACATTGGACAGTGTTGTCTCTAAAATCTTCACCTGACTCACTGCTGA

GAAAGCAATCCGTAGACAAGAATCTAAAGGAGATGAGATGTCCTCACCCCTCGTTTATCAGTTCCTTCTAACAGTTTCCACGTAGGCTGGGAAAGCTTCC

GTGCTGTTCTGTACTGAGGACTAGAATAACTGGTGATATGTGAAATAAAAATGTCTAGCAATC
Translation
 - UNI16680 - - UNI29634 - MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDW - UNI16680 - - UNI18488 - LGTSPLHLAA

QYGHFSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHANIVEVLLK - UNI24883 - HGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHT

QSKFCKTAFDISIDNGNEDLAEILQ - UNI18163 - IAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTD DETGVSAVQFGNSSTSVLATLA

ALAEASAPLSNSSETPV VVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGMGQPIIVTMPDGQQV - UNI4310 - VLTVPA

TDIAEETVISEEPPAKRQCMEIIESRVECAEIE - UNI4310 - EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRIQTNKEAV
Transcript ENSMUST00000103227
Sequence
GCGCCGACGGGGACTTTTCGGTGGGGATTTTGGGCGCCGAGCAGACGCGGCATTTTCGGAAAATAGCGCCCTGTGCAGCGAAGCGCTCTGTGTGTGGCGG

GGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCCCGCTGCTCCCCCGCCGCCGCTCCCGAAGCTTTTCCAG - UNI29634

 - CAGCCCTCCTACCTGCTGACCAGCTCCCAGACTCTTGGGCATTTTCATTGTCTGGATGCAACTGAATTTCTCCCAGTCAGAATTCATTGTGTTTTCA

G - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGATGATGAAGTTCGCATT

TTGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATCTGGCCGCACAGTATG

GGCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACATGGCGGCTTCTGAGGG

CCATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI24883 - CATGGTGCTGACGTCAATGCAAAGGATATGTTAAAGATGACAGCTCTGCATTGGG

CAACAGAACATAATCATCAAGAGGTGGTGGAGCTTTTAATCAAATATGGTGCTGATGTACACACGCAGAGTAAATTTTGTAAAACTGCATTTGATATTTC

AATAGACAATGGAAATGAAGATTTAGCAGAGATATTACAG - UNI18163 - ATTGCTATGCAGAACCAAATCAACACCAACCCGGAGAGTCCTGACA

CTGTGACAATACACGCTGCCACACCACAGTTCATCATTGGACCCGGAGGGGTGGTGAACCTCACAG ATGAAACAGGAGTATCTGCTGTTCAGTTTGGAA

ACTCCTCTACGTCAGTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAATTCTTCAGAAACTCCAG TGGCCACAGAGGAAGTGG

TTACCGCAGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGCTCAGGGGGTCAGCAAGTCATCACGATAGTTACAGATGGAATCCAGCTGGGGAATTT

GCACTCCATACCAACCAGTGGGATGGGTCAGCCCATCATTGTGACGATGCCCGATGGACAGCAAG - UNI4310 - TATTGACAGTACCAGCAACAGA

CATTGCTGAAGAAACTGTCATCAGTGAAGAGCCACCAGCTAAGAGACAGTGTATGGAAATAATTGAGAGCCGGGTGGAATGTGCAGAAATTGAA - UNI

4310 - GAGAGAGAAGCGCTTCAGAAACAGCTGGATGAAGCCAACCGAGAGGCCCAGAAATACCGACAGCAGCTGCTTAAGAAGGAGCAGGAGGCAGAG

GCCTACAGGCAGAAGCTGGAGGCCATGACACGCATCCAGACCAACAAAGAAGCCGTTTAGCTGCCATGAACACCAGTTTGCTTTTACCTTTTGTCCAGAA

AGAATATAGTCTTGAACTGTACACAGTAAGGACACAGCCATGGGAATACCGAATAATAGAAAATACTACAGCTTGATAACGGGACTTAAGCCATGAGCTC

TCAATTCTTGTAATATAAAACTTTAGAACTTGTGAAATGTATTTAAAACTGAATTCTGTAAATAGTTTTTTGGTTGTTTCTTTTTTTACTGTTATAAATG

AGTTGATGAAGCTTGTTGCTGAGATCCAGAGGCCACAGCAAGCCACTGTTACGGGGAATTCTTTTTGATTTCGGTGCAGACTTAATTTCTCAGAAACAGA

AGTTGTAAGCGTGGTTGTTGTCTCTTAGACCAAATGTGGAACAATTATGGTGGACTGATGCTGGAAATACTCTGCAAAGAGATTTCGCCCAGGAACTTTT

GTACAGCTTTTAAGTTGTCTCAGGTTCTCTGAAAACATTTTTTAGGAAGCAGAAATTTTATATTTGTTCTATTTCAGCTACATGCAAGTAGATTTACATG

TATATGAAGCAAATATTTTTAAAATTTTGTTTGTACATATCCTGCATGTTTTATGATTTTAAAACACATCCCTTGCTTAGGTATGTCTCCTACAAAGACG

ATGAAAGTTACCAAGAAAAAAACCAAGGCACCACTGTCGTTCTGCCGGTCGTTGAGAGTGAGTAAGCTCACAGCTGGTTTTACTGGCGACCATGACAATG

TTCTTGGAGCAGCTTGCAAGAGAACTCGAATCTGCAAAATATATGCTTTTCTGACAATTGTATTGTGAGGATGTGAGACTGCTCTGTGCCTTCCTTCCAT

CATGACTTCCACACGAGCACTTTGAGGCGCTGGATTTTAAGATAATGTTTTTGGCAAACTCAGTGCATTTGGGTTTCTGAAATATTTCATGGACTTACTC

CCCTCCCCTAAGAAATTAAATTATTCTTATGGAAATTGCTTTTGTATGCAGAGCAGGACCTTTTGTACTCAGTGAGGCTATGGGTGTGTCTAACGTAACT

TTCGGTATTCCCTGTGAACGCGCTCCGGGCCTGTGCTGCGACTCTCTCACAATATTGTCAATTCTGAAATGTATGGACATTTGACAGACTATTCCATTCT

CTTTTGTAAAATGTAACTTCAAGCTCTTTATTATTTTGTTTTGTTCTATTGCTTTATGAAAACGTTTGCCCCTCCCCCACCCCAGGCTCCTCTAGCTTAT

CTGTATAAAGAACCAGTTACCTGCGAGACTGTACTCTGGCCTCATTTTCTATTTTACAATTAAATAACTTTCCAC
Translation
 - UNI29634 -  - UNI16680 - - UNI29634 - MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDW - UNI16680 - - UNI1848

8 - LGTSPLHLAAQYGHFSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHANIVEVLLK - UNI24883 - HGADVNAKDMLKMTALHWATEHNHQE

VVELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQ - UNI18163 - IAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTD DETGVSAV

QFGNSSTSVLATLAALAEASAPLSNSSETPV VATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGMGQPIIVTMPDGQQV - UNI

4310 - VLTVPATDIAEETVISEEPPAKRQCMEIIESRVECAEIE - UNI4310 - EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMT

RIQTNKEAV
Transcript ENSMUST00000028839
Sequence
GGAGCTCGGCCGCCGTGTCCCTCCGCGCCGACGGGGACTTTTCGGTGGGGATTTTGGGCGCCGAGCAGACGCGGCATTTTCGGAAAATAGCGCCCTGTGC

AGCGAAGCGCTCTGTGTGTGGCGGGGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCCCGCTGCTCCCCCGCCGCCGCTCCC

GAAGCTTTTCCAG - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGATGAT

GAAGTTCGCATTTTGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATCTGG

CCGCACAGTATGGGCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACATGGC

GGCTTCTGAGGGCCATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI18163 - - UNI24883 - ATTGCTATGCAGAACCAAATCAACACCAAC

CCGGAGAGTCCTGACACTGTGACAATACACGCTGCCACACCACAGTTCATCATTGGACCCGGAGGGGTGGTGAACCTCACAG ATGAAACAGGAGTATCT

GCTGTTCAGTTTGGAAACTCCTCTACGTCAGTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAATTCTTCAGAAACTCCAG TA

GTGGCCACAGAGGAAGTGGTTACCGCAGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGCTCAGGGGGTCAGCAAGTCATCACGATAGTTACAGATG

GAATCCAGCTGGGGAATTTGCACTCCATACCAACCAGTGGGATGGGTCAGCCCATCATTGTGACGATGCCCGATGGACAGCAAG - UNI4310 - TAT

TGACAGTACCAGCAACAGACATTGCTGAAGAAACTGTCATCAGTGAAGAGCCACCAGCTAAGAGACAGTGTATGGAAATAATTGAGAGCCGGGTGGAATG

TGCAGAAATTGAA - UNI4310 - GAGAGAGAAGCGCTTCAGAAACAGCTGGATGAAGCCAACCGAGAGGCCCAGAAATACCGACAGCAGCTGCTTAA

GAAGGAGCAGGAGGCAGAGGCCTACAGGCAGAAGCTGGAGGCCATGACACGCATCCAGACCAACAAAGAAGCCGTTTAGCTGCCATGAACACCAGTTTGC

TTTTACCTTTTGTCCAGAAAGAATATAGTCTTGAACTGTACACAGTAAGGACACAGCCATGGGAATACCGAATAATAGAAAATACTACAGCTTGATAACG

GGACTTAAGCCATGAGCTCTCAATTCTTGTAATATAAAACTTTAGAACTTGTGAAATGTATTTAAAACTGAATTCTGTAAATAGTTTTTTGGTTGTTTCT

TTTTTTACTGTTATAAATGAGTTGATGAAGCTTGTTGCTGAGATCCAGAGGCCACAGCAAGCCACTGTTACGGGGAATTCTTTTTGATTTCGGTGCAGAC

TTAATTTCTCAGAAACAGAAGTTGTAAGCGTGGTTGTTGTCTCTTAGACCAAATGTGGAACAATTATGGTGGACTGATGCTGGAAATACTCTGCAAAGAG

ATTTCGCCCAGGAACTTTTGTACAGCTTTTAAGTTGTCTCAGGTTCTCTGAAAACATTTTTTAGGAAGCAGAAATTTTATATTTGTTCTATTTCAGCTAC

ATGCAAGTAGATTTACATGTATATGAAGCAAATATTTTTAAAATTTTGTTTGTACATATCCTGCATGTTTTATGATTTTAAAACACATCCCTTGCTTAGG

TATGTCTCCTACAAAGACGATGAAAGTTACCAAGAAAAAAACCAAGGCACCACTGTCGTTCTGCCGGTCGTTGAGAGTGAGTAAGCTCACAGCTGGTTTT

ACTGGCGACCATGACAATGTTCTTGGAGCAGCTTGCAAGAGAACTCGAATCTGCAAAATATATGCTTTTCTGACAATTGTATTGTGAGGATGTGAGACTG

CTCTGTGCCTTCCTTCCATCATGACTTCCACACGAGCACTTTGAGGCGCTGGATTTTAAGATAATGTTTTTGGCAAACTCAGTGCATTTGGGTTTCTGAA

ATATTTCATGGACTTACTCCCCTCCCCTAAGAAATTAAATTATTCTTATGGAAATTGCTTTTGTATGCAGAGCAGGACCTTTTGTACTCAGTGAGGCTAT

GGGTGTGTCTAACGTAACTTTCGGTATTCCCTGTGAACGCGCTCCGGGCCTGTGCTGCGACTCTCTCACAATATTGTCAATTCTGAAATGTATGGACATT

TGACAGACTATTCCATTCTCTTTTGTAAAATGTAACTTCAAGCTCTTTATTATTTTGTTTTGTTCTATTGCTTTATGAAAACGTTTGCCCCTCCCCCACC

CCAGGCTCCTCTAGCTTATCTGTATAAAGAACCAGTTACCTGCGAGACTGTACTCTGGCCTCATTTTCTATTTTACAATTAAATAACTTTCCACATAGCT

CCATGCAGACTCATGTTTTGACTGCACATTCATAAAATGTGGACCATAGAGCTCGGTGGTGGAGCAGGTCCTTGACGCTTTGAGACTCTGGCTCAAATCC

TGTCGCACATACAATCTGAGACACGTTCTGCCATATGAAACCAATTAGACTCCTCATGCCTTGAAAAGCCCCAGAGTGGCTGCCTGGAAATGTGCTGGTT

CGTGCCTGGGGTAACTTTACAGGAGTTAGTGAGGGTAAGAAAGGGTCCGTGTCCCAGCCTCTCTCACTTGCCTTTCTGGGGACCACAAGGAGCCTCTATA

GCAGTGCTCCTCAGCCTCCCTGAGGCTGCAACTCTAGTCCAGTGCATGTTGTAGTGAGGAACTGTATTAAAATGTTTTTGTTGCTACTTCAGAACGGATA

TAAACTGTAATGTAAATTTCTGATATTCAGGATGTCGGATCTGGGACCCCTGGGGAAGAGTATATGACCCTCCAGTGGTTGTGACCCACAGGTTGAGAAC

CTCTGCTCTATGACAACCATTTTAAAAAACAAAACTAAGAGAATGCCTTCCAGTTTTTCACTAAATTTGACACTAGATGTATTCATTTTGAGATGCAGCC

TCGCTGTTACAGTCTAGTCTCCAAGTCATGAATTCTAGTGACCTTGCCACCTCAGCCTTCGTAGTTCTGGGGCCATAAGTAAGCCCCTGACACTGCCCTC

GGTTTCGACCGAGAGAAATCTCTCACTGTGTTGACATAGCTAGTGTTGAACTTTTGAATTCACTTGATCTATGCTTACGCGACCCGGGCTCAGTCTCCAA

CATGGCCAAAGCAAAATGCATAACGCTAAGTTTGAAAAACTGCAAGCTACATTTTCAGCATCATGAAGCTGCTTGCCCTTCAGTCACAGGAAGCCGTTGG

AGAACACGTGGCTTGGGTTTGTGTACTGATTAATATTGAACAGGACGCTGGAGTGCATTTAATGCCTTGGTGGGCAGTGTTGGGAGAGGGGCCACTGTCC

GCTCCACGGAGTAGCCAGTGCAGTTTGTTCTCACATCAGGTTAGCTCCGCAAAGCCTCAAGGTGGTAACAGAGAAAGCAGCTGCAGGCGCACGTGTGTTG

CTTTCACTCCCAGTCATGGGTTCTGCTGGAGACCATGTGATACAGGATGTAATTTTGATCTTCAGTAATAACAGCAAGCCAAGTGATTCGAGGAAACAAT

TGGGTGTCGTGTAACAAGTATTCGGGCAGCTTCGAGATGTTTACTGTCTCCAGAGCCACATTGGACAGTGTTGTCTCTAAAATCTTCACCTGACTCACTG

CTGAGAAAGCAATCCGTAGACAAGAATCTAAAGGAGATGAGATGTCCTCACCCCTCGTTTATCAGTTCCTTCTAACAGTTTCCACGTAGGCTGGGAAAGC

TTCCGTGCTGTTCTGTACTGAGGACTAGAATAACTGGTGATATGTGAAATAAAAATGTCTAGCAATC
Translation
 - UNI16680 - - UNI29634 - MANGAPFTTDW - UNI16680 - - UNI18488 - LGTSPLHLAAQYGHFSTTEVLLRAGVSRDARTKVD

RTPLHMAASEGHANIVEVLLK - UNI18163 - - UNI24883 - IAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTD DETGVSAVQFGNS

STSVLATLAALAEASAPLSNSSETPV VVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGMGQPIIVTMPDGQQV - UNI4310

 - VLTVPATDIAEETVISEEPPAKRQCMEIIESRVECAEIE - UNI4310 - EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRIQT

NKEAV
Transcript ENSMUST00000103226
Sequence
GGAGCTCGGCCGCCGTGTCCCTCCGCGCCGACGGGGACTTTTCGGTGGGGATTTTGGGCGCCGAGCAGACGCGGCATTTTCGGAAAATAGCGCCCTGTGC

AGCGAAGCGCTCTGTGTGTGGCGGGGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCCCGCTGCTCCCCCGCCGCCGCTCCC

GAAGCTTTTCCAG - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGATGAT

GAAGTTCGCATTTTGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATCTGG

CCGCACAGTATGGGCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACATGGC

GGCTTCTGAGGGCCATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI24883 - CATGGTGCTGACGTCAATGCAAAGGATATGTTAAAGATGACAG

CTCTGCATTGGGCAACAGAACATAATCATCAAGAGGTGGTGGAGCTTTTAATCAAATATGGTGCTGATGTACACACGCAGAGTAAATTTTGTAAAACTGC

ATTTGATATTTCAATAGACAATGGAAATGAAGATTTAGCAGAGATATTACAG - UNI18163 - ATTGCTATGCAGAACCAAATCAACACCAACCCGG

AGAGTCCTGACACTGTGACAATACACGCTGCCACACCACAGTTCATCATTGGACCCGGAGGGGTGGTGAACCTCACAG ATGAAACAGGAGTATCTGCTG

TTCAGTTTGGAAACTCCTCTACGTCAGTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAATTCTTCAGAAACTCCAG TAGTGG

CCACAGAGGAAGTGGTTACCGCAGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGCTCAGGGGGTCAGCAAGTCATCACGATAGTTACAGATGGAAT

CCAGCTGGGGAATTTGCACTCCATACCAACCAGTGGGATGGGTCAGCCCATCATTGTGACGATGCCCGATGGACAGCAAG - UNI4310 - TATTGAC

AGTACCAGCAACAGACATTGCTGAAGAAACTGTCATCAGTGAAGAGCCACCAGCTAAGAGACAGTGTATGGAAATAATTGAGAGCCGGGTGGAATGTGCA

GAAATTGAAGTAAGGAGCCTTATACCCGGTGTGTTTTGCTGCAGCCATCCAAAATAA
Translation
 - UNI16680 - - UNI29634 - MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDW - UNI16680 - - UNI18488 - LGTSPLHLAA

QYGHFSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHANIVEVLLK - UNI24883 - HGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHT

QSKFCKTAFDISIDNGNEDLAEILQ - UNI18163 - IAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTD DETGVSAVQFGNSSTSVLATLA

ALAEASAPLSNSSETPV VVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGMGQPIIVTMPDGQQV - UNI4310 - VLTVPA

TDIAEETVISEEPPAKRQCMEIIESRVECAEIEVRSLIPGVFCCSHPK
Transcript ENSMUST00000039978
Sequence
AATCCCAACAATTGAGAGGCAGAGGCAGGCGGATTCTTTTGAGTTTGAGGCCACCCTGGTCTACAAAGCCAGTTCCAGGTCAGGCAGGGCTGTTACAGAG

AAACCTTGCCTCGAAAACAAATCAACAAAAATCCTGACAATACAGACAGGAGAAAAGCGTCACTATTACAACATTAAAAAAAAAAAAAGCCACAGAAACA

TCCACGTCACACACGACCAGTTTACACCAGGTGAAGAGGACAGGCATCCTTTGTTCCCGCACAGGCCCCACAACCAGCGATTCCGGGTACCTTCCAGGAC

CACG - UNI29634 - CAGCCCTCCTACCTGCTGACCAGCTCCCAGACTCTTGGGCATTTTCATTGTCTGGATGCAACTGAATTTCTCCCAGTCAGAA

TTCATTGTGTTTTCAG - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGAT

GATGAAGTTCGCATTTTGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATC

TGGCCGCACAGTATGGGCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACAT

GGCGGCTTCTGAGGGCCATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI24883 - CATGGTGCTGACGTCAATGCAAAGGATATGTTAAAGATGA

CAGCTCTGCATTGGGCAACAGAACATAATCATCAAGAGGTGGTGGAGCTTTTAATCAAATATGGTGCTGATGTACACACGCAGAGTAAATTTTGTAAAAC

TGCATTTGATATTTCAATAGACAATGGAAATGAAGATTTAGCAGAGATATTACAG - UNI18163 - ATTGCTATGCAGAACCAAATCAACACCAACC

CGGAGAGTCCTGACACTGTGACAATACACGCTGCCACACCACAGTTCATCATTGGACCCGGAGGGGTGGTGAACCTCACAG ATGAAACAGGAGTATCTG

CTGTTCAGTTTGGAAACTCCTCTACGTCAGTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAATTCTTCAGAAACTCCAG TGG

CCACAGAGGAAGTGGTTACCGCAGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGCTCAGGGGGTCAGCAAGTCATCACGATAGTTACAGATGGAAT

CCAGCTGGGGAATTTGCACTCCATACCAACCAGTGGGATGGGTCAGCCCATCATTGTGACGATGCCCGATGGACAGCAAG - UNI4310 - TATTGAC

AGTACCAGCAACAGACATTGCTGAAGAAACTGTCATCAGTGAAGAGCCACCAGCTAAGAGACAGTGTATGGAAATAATTGAGAGCCGGGTGGAATGTGCA

GAAATTGAAGTAAGGAGCCTTATACCCGGTGTGTTTTGCTGCAGCCATCCAAAATAAATTTTGTTTCATTATTATTATTATTATCACTATTATTATATTA

ATTTGTTGTTTATATTTATTACTGGCCATGTTTTGATAAAGAATGAAAGTGAATAGTGTCATCATTTTGTTTTGGCCTTAAACATATGGCAAGCCCTCAA

TAAATAAATATTGAATGAATGATTGAATGAGTGCAGAATTTGTTTGTAACAAAGTTTGTTAACCTGGTAACACTTGGACTGTCTTTGGTTTTTAAATTCC

ATCTCTGATTTTTTTGTTAAACTTATGCATACCATCCTCACAAGTCACTGAAAATTCTTTTCTTTCAAAAGAATTTGAAATTGGCCTGGAAATTCTCTTA

CAGAAAGCTGATGTTTGCTAAACAGGTTATGTTTGTAAATGCAAAAGATAATTGCTTATTTTACTATTTCCTCCTTTGAGGAACTGAATTCATTTAGAGT

ATTGCTAACACCATCCTCCTTCCTCTTCCACACTCATTTGTTGGTGTAACAAAGCACTATCTCTTAGTTTTTTCTTACATGACTGTAAATAAAATTCCAT

CT
Translation
 - UNI29634 -  - UNI16680 - - UNI29634 - MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDW - UNI16680 - - UNI1848

8 - LGTSPLHLAAQYGHFSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHANIVEVLLK - UNI24883 - HGADVNAKDMLKMTALHWATEHNHQE

VVELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQ - UNI18163 - IAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTD DETGVSAV

QFGNSSTSVLATLAALAEASAPLSNSSETPV VATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGMGQPIIVTMPDGQQV - UNI

4310 - VLTVPATDIAEETVISEEPPAKRQCMEIIESRVECAEIEVRSLIPGVFCCSHPK
Transcript ENSMUST00000089745
Sequence
GGCGAGGCCGCCGCAGGCATGCTGGGAGCTCGGCCGCCGTGTCCCTCCGCGCCGACGGGGACTTTTCGGTGGGGATTTTGGGCGCCGAGCAGACGCGGCA

TTTTCGGAAAATAGCGCCCTGTGCAGCGAAGCGCTCTGTGTGTGGCGGGGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCC

CGCTGCTCCCCCGCCGCCGCTCCCGAAGCTTTTCCAG - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAA

GCGGCACGAGCCGGTCAAGATGATGAAGTTCGCATTTTGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - T

TGGGAACTTCTCCACTTCATCTGGCCGCACAGTATGGGCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGT

GGACCGGACACCACTGCACATGGCGGCTTCTGAGGGCCATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI24883 - CATGGTGCTGACGTCAATG

CAAAGGATATGTTAAAGATGACAGCTCTGCATTGGGCAACAGAACATAATCATCAAGAGGTGGTGGAGCTTTTAATCAAATATGGTGCTGATGTACACAC

GCAGAGTAAATTTTGTAAAACTGCATTTGATATTTCAATAGACAATGGAAATGAAGATTTAGCAGAGATATTACAG - UNI18163 - ATTGCTATGC

AGAACCAAATCAACACCAACCCGGAGAGTCCTGACACTGTGACAATACACGCTGCCACACCACAGTTCATCATTGGACCCGGAGGGGTGGTGAACCTCAC

AG ATGAAACAGGAGTATCTGCTGTTCAGTTTGGAAACTCCTCTACGTCAGTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAA

TTCTTCAGAAACTCCAGGTTAGAGAACAAGGGAGGTTTCTGCATTGACTCTTTCACTCTGTCGAGCCCTCTGGGCTTAGTACTTTTGAATCCTGTTTAAG

AAATCTGTTCAGAGTTTATTGCAGTGTTTTGTTTTCTTCAAGAGTCCTACTTATAATTTGTGTTCACCTCTGCAGTTCTTTCAGAATTGGTTGGCTACAC

TTCCTGTTACTTGCTTATATCTTATTAATTAAAGTTACTATTTCTGATTTTTATTTTTGTGTCAGCCACCAGAAAGAGGCAAAGTGCTGATCCCATCCTT

AATAAGGAAACTGCAGGTCGCAGTGCTCACAGAGGCTGAAAGATAACAGGGCTAGAGTGGAATGAAATGGTGCTCACCTCACGTGAGGTAGGGTGGAGCA

CCCACTGCTCAGCATCCCCTGAGTGTGGTCGTGTGTCCCACCTTGCCAGATCATGGGTTTACAAGGGCAAGAGCAATCCAATATGAACGGAGCGGAAGGT

CAGGTCAGGAGGTATGCTCCTGAGGTACATACCAGGTAAAGAAATAACAGCCTCAGATTTAGTTGGTACATGCTCAGTTTGTTTTTTTGAGGTATGGGGT

TTTCGTGGGCTACCTCCTTGGGTAAGAGCATTTGTTCTGCAAACACGAGGACCTGAGTTTGAAGCCTCAGCACCCATATAAAAAGCCAGGTAGGGCTGCA

TAGACCTGTAACCCAGCATTGGGAGGGCAGATATAGGTAGATTCCTGTAGCTGACTTTCCAGCCAGTCTAGCAAAAGGGTAAACTTCAGGTCAGTGAGAG

GCCTTGTTTTAAGCCAATAAGGTAGACACATACACCTTACAACCTGCCTTAGCATCTTCCTTGGGGTGCAGACATGTGAGTGTGCACACGCATGCACCAC

ACACAGCACCCCAATAGCTTTTCAGAAAGCGTTTATTTTGTAGCTCTAGCCTGTAAACCTACAACTTTTCTTTGCTTAGTTGTATTCTTCTCTGTGACCC

AATTATATGTATAATCAAATAGAAATCTATAATTTTCCTTCTTTTTGTATTTAAAAACTTGTGTTAGATGTATTTGAAAGATATGAAGTGTCTAGTGGTG

GTTGAAAATTCTGTTTCTCAAAGTGAAGTTTTCACTAGGAAACTTTTATATATTATATTTTTGGTCTGTTCAAAAATAGGGTAATGAGACTTCAGTCTTA

GGGAGAAGTGACTGGGTCAAGTCTCTTTTGGTTTTGCTTTTTTTGTTCTTAATCTCAGGTTAGATTATAGGATTCTACCTTCAAACTGCTAGGTTTTTCT

GTGACGTCATTTCTGTTTCTTGTAACTATTTCTACATGAAAGTGTTCAGTCTTGGCACTTTGTGAGGGATGTTTTCTTCTAACCTTCCTTCAGCTTGTGG

CATGGTGACTTAGCCTCAAAGGCACTACCACTGTCTGCCTTCCCTCATTTCAGCCTGACGTTTACAGTGCACTAATGAGAAGTTAGGATGCTACAGCTAC

TTTTTATTAAGTCCATTTGTCCACACATGCACACAATTTATATCTGCAATCTTGTAAAGTTTTAAGGTTGCTTTTTTCTTAGCTATTCCAACATTTGGCT

ATTAGATTGTTCTTTAGCTTTGGTGTGTGTACTTTGTCTTCTATAATTGTCTTCCTATTAATTTTTTCATAAATATTTTACCATCACACAACTTAAAAGA

GCTTTTTAGATGAAAGGCAGGAACTATTATCTTAATGGCAGCCACTGCTAACAGTGCAGAGATCAAAGTTCCTGGGTTGAGCCTTGACTATGTGATCTCA

GAAGTGTCTTATGTATGCCAAAGCTTTTAAATAGTAGTACTTGTAGTTAGTATTCAACCAGTGAGTGTTTCTTTTTCATATGGATATTTAAAAAGAAATC

AAAGCAATAGTGTACTGAAGGCTTTCATAATTATTTTATTAAATATATTGCTATTTTGTGCTCTCTATTTTGTTTTATGACTAGTTTCCTGAAATCATCT

TAATGTGCTTGGTAACAAAGCATAATTATTGCTTAAGGCAAACAAAATCATGAGAACACTCAAAGGTTTGTTTGCATTTTGGGTTTTCCTGGGTTTATTT

TGTAACCCTGTGAGCCAGTAACACCATTGTAGGATTGAAGCCAGGCCTTTTGTCGGATCTGCTTTGAAAACCAGTTGTGGACAGATGCATCTCTCATTTC

ATGCTAGGAATCTTTGATGTGATACTTTGGGAACACATCGATATCCTGATCGCCAAAACAGTTTACCAGTGCATTTGCCACCTACTAGTGACACTTGTTT

GAGTCAGCTATTAAAATTGTGATTGCTTAGTCCTTCC
Translation
 - UNI16680 - - UNI29634 - MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDW - UNI16680 - - UNI18488 - LGTSPLHLAA

QYGHFSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHANIVEVLLK - UNI24883 - HGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHT

QSKFCKTAFDISIDNGNEDLAEILQ - UNI18163 - IAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTD DETGVSAVQFGNSSTSVLATLA

ALAEASAPLSNSSETPG
Transcript ENSMUST00000103228
Sequence
GTGTGTGGCGGGGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCCCGCTGCTCCCCCGCCGCCGCTCCCGAAGCTTTTCCAG

 - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGATGATGAAGTTCGCATTT

TGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATCTGGCCGCACAGTATGG

GCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACATGGCGGCTTCTGAGGGC

CATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI18163 - - UNI24883 - ATGAAACAGGAGTATCTGCTGTTCAGTTTGGAAACTCCTCTAC

GTCAGTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAATTCTTCAGAAACTCCAG TAGTGGCCACAGAGGAAGTGGTTACCGC

AGAATCTGTGGATGGTGCAATTCAGCAAGTAGTTAGCTCAGGGGGTCAGCAAGTCATCACGATAGTTACAGATGGAATCCAGCTGGGGAATTTGCACTCC

ATACCAACCAGTGGGATGGGTCAGCCCATCATTGTGACGATGCCCGATGGACAGCAAG - UNI4310 - TATTGACAGTACCAGCAACAGACATTGCT

GAAGAAACTGTCATCAGTGAAGAGCCACCAGCTAAGAGACAGTGTATGGAAATAATTGAGAGCCGGGTGGAATGTGCAGAAATTGAA - UNI4310 - 

GAGAGAGAAGCGCTTCAGAAACAGCTGGATGAAGCCAACCGAGAGGCCCAGAAATACCGACAGCAGCTGCTTAAGAAGGAGCAGGAGGCAGAGGCCTACA

GGCAGAAGCTGGAGGCCATGACACGCATCCAGACCAACAAAGAAGCCGTTTAGCTGCCATGAACACCAGTTTGCTTTTACCTTTTGTCCAGAAAGAATAT

AGTCTTGAACTGTACACAGTAAGGACACAGCCATGGGAATACCGAATAATAGAAAATACTACAGCTTGATAACGGGACTTAAGCCATGAGCTCTCAATTC

TTGTAATATAAAACTTTAGAACTTGTGAAATGTATTTAAAACTGAATTCTGTAAATAGTTTTTTGGTTGTTTCTTTTTTTACTGTTATAAATGAGTTGAT

GAAGCTTGTTGCTGAGATCCAGAGGCCACAGCAAGCCACTGTTACGGGGAATTCTTTTTGATTTCGGTGCAGACTTAATTTCTCAGAAACAGAAGTTGTA

AGCGTGGTTGTTGTCTCTTAGACCAAATGTGGAACAATTATGGTGGACTGATGCTGGAAATACTCTGCAAAGAGATTTCGCCCAGGAACTTTTGTACAGC

TTTTAAGTTGTCTCAGGTTCTCTGAAAACATTTTTTAGGAAGCAGAAATTTTATATTTGTTCTATTTCAGCTACATGCAAGTAGATTTACATGTATATGA

AGCAAATATTTTTAAAATTTTGTTTGTACATATCCTGCATGTTTTATGATTTTAAAACACATCCCTTGCTTAGGTATGTCTCCTACAAAGACGATGAAAG

TTACCAAGAAAAAAACCAAGGCACCACTGTCGTTCTGCCGGTCGTTGAGAGTGAGTAAGCTCACAGCTGGTTTTACTGGCGACCATGACAATGTTCTTGG

AGCAGCTTGCAAGAGAACTCGAATCTGCAAAATATATGCTTTTCTGACAATTGTATTGTGAGGATGTGAGACTGCTCTGTGCCTTCCTTCCATCATGACT

TCCACACGAGCACTTTGAGGCGCTGGATTTTAAGATAATGTTTTTGGCAAACTCAGTGCATTTGGGTTTCTGAAATATTTCATGGACTTACTCCCCTCCC

CTAAGAAATTAAATTATTCTTATGGAAATTGCTTTTGTATGCAGAGCAGGACCTTTTGTACTCAGTGAGGCTATGGGTGTGTCTAACGTAACTTTCGGTA

TTCCCTGTGAACGCGCTCCGGGCCTGTGCTGCGACTCTCTCACAATATTGTCAATTCTGAAATGTATGGACATTTGACAGACTATTCCATTCTCTTTTGT

AAAATGTAACTTCAAGCTCTTTATTATTTTGTTTTGTTCTATTGCTTTATGAAAACGTTTGCCCCTCCCCCACCCCAGGCTCCTCTAGCTTATCTGTATA

AAGAACCAGTTACCTGCGAGACTGTACTCTGGCCTCATTTTCTATTTTACAATTAAATAACTTTCCACAT
Translation
 - UNI16680 - - UNI29634 - MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDW - UNI16680 - - UNI18488 - LGTSPLHLAA

QYGHFSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHANIVEVLLK - UNI18163 - - UNI24883 - MKQEYLLFSLETPLRQY  - UNI431

0 -  - UNI4310 - 
Transcript ENSMUST00000089741
Sequence
GTGTGTGGCGGGGCCGCGTCTGCCCTGACGGCTCCGAGGCGCCGCGGTCCCCGCACCTCCTCCCGCTGCTCCCCCGCCGCCGCTCCCGAAGCTTTTCCAG

 - UNI16680 - - UNI29634 - ATGTCCCTGGTAGATTTGGGGAAGAAGCTTTTAGAAGCGGCACGAGCCGGTCAAGATGATGAAGTTCGCATTT

TGATGGCAAATGGAGCTCCTTTTACTACAGACTGG - UNI16680 - - UNI18488 - TTGGGAACTTCTCCACTTCATCTGGCCGCACAGTATGG

GCATTTCTCTACCACAGAGGTTCTTCTCCGAGCCGGTGTAAGTAGAGATGCCAGGACCAAAGTGGACCGGACACCACTGCACATGGCGGCTTCTGAGGGC

CATGCCAACATAGTAGAAGTTTTGCTTAAG - UNI24883 - CATGGTGCTGACGTCAATGCAAAGGATATGTTAAAGATGACAGCTCTGCATTGGGC

AACAGAACATAATCATCAAGAGGTGGTGGAGCTTTTAATCAAATATGGTGCTGATGTACACACGCAGAGTAAATTTTGTAAAACTGCATTTGATATTTCA

ATAGACAATGGAAATGAAGATTTAGCAGAGATATTACAG - UNI18163 - ATGAAACAGGAGTATCTGCTGTTCAGTTTGGAAACTCCTCTACGTCA

GTATTAGCTACGTTAGCTGCCTTAGCTGAAGCTTCTGCCCCATTGTCCAATTCTTCAGAAACTCCAG TAGTGGCCACAGAGGAAGTGGTTACCGCAGAA

TCTGTGGATGGTGCAATTCAGCAAGTAGTTAGCTCAGGGGGTCAGCAAGTCATCACGATAGTTACAGATGGAATCCAGCTGGGGAATTTGCACTCCATAC

CAACCAGTGGGATGGGTCAGCCCATCATTGTGACGATGCCCGATGGACAGCAAG - UNI4310 - TATTGACAGTACCAGCAACAGACATTGCTGAAG

AAACTGTCATCAGTGAAGAGCCACCAGCTAAGAGACAGTGTATGGAAATAATTGAGAGCCGGGTGGAATGTGCAGAAATTGAA - UNI4310 - GAGA

GAGAAGCGCTTCAGAAACAGCTGGATGAAGCCAACCGAGAGGCCCAGAAATACCGACAGCAGCTGCTTAAGAAGGAGCAGGAGGCAGAGGCCTACAGGCA

GAAGCTGGAGGCCATGACACGCATCCAGACCAACAAAGAAGCCGTTTAGCTGCCATGAACACCAGTTTGCTTTTACCTTTTGTCCAGAAAGAATATAGTC

TTGAACTGTACACAGTAAGGACACAGCCATGGGAATACCGAATAATAGAAAATACTACAGCTTGATAACGGGACTTAAGCCATGAGCTCTCAATTCTTGT

AATATAAAACTTTAGAACTTGTGAAATGTATTTAAAACTGAATTCTGTAAATAGTTTTTTGGTTGTTTCTTTTTTTACTGTTATAAATGAGTTGATGAAG

CTTGTTGCTGAGATCCAGAGGCCACAGCAAGCCACTGTTACGGGGAATTCTTTTTGATTTCGGTGCAGACTTAATTTCTCAGAAACAGAAGTTGTAAGCG

TGGTTGTTGTCTCTTAGACCAAATGTGGAACAATTATGGTGGACTGATGCTGGAAATACTCTGCAAAGAGATTTCGCCCAGGAACTTTTGTACAGCTTTT

AAGTTGTCTCAGGTTCTCTGAAAACATTTTTTAGGAAGCAGAAATTTTATATTTGTTCTATTTCAGCTACATGCAAGTAGATTTACATGTATATGAAGCA

AATATTTTTAAAATTTTGTTTGTACATATCCTGCATGTTTTATGATTTTAAAACACATCCCTTGCTTAGGTATGTCTCCTACAAAGACGATGAAAGTTAC

CAAGAAAAAAACCAAGGCACCACTGTCGTTCTGCCGGTCGTTGAGAGTGAGTAAGCTCACAGCTGGTTTTACTGGCGACCATGACAATGTTCTTGGAGCA

GCTTGCAAGAGAACTCGAATCTGCAAAATATATGCTTTTCTGACAATTGTATTGTGAGGATGTGAGACTGCTCTGTGCCTTCCTTCCATCATGACTTCCA

CACGAGCACTTTGAGGCGCTGGATTTTAAGATAATGTTTTTGGCAAACTCAGTGCATTTGGGTTTCTGAAATATTTCATGGACTTACTCCCCTCCCCTAA

GAAATTAAATTATTCTTATGGAAATTGCTTTTGTATGCAGAGCAGGACCTTTTGTACTCAGTGAGGCTATGGGTGTGTCTAACGTAACTTTCGGTATTCC

CTGTGAACGCGCTCCGGGCCTGTGCTGCGACTCTCTCACAATATTGTCAATTCTGAAATGTATGGACATTTGACAGACTATTCCATTCTCTTTTGTAAAA

TGTAACTTCAAGCTCTTTATTATTTTGTTTTGTTCTATTGCTTTATGAAAACGTTTGCCCCTCCCCCACCCCAGGCTCCTCTAGCTTATCTGTATAAAGA

ACCAGTTACCTGCGAGACTGTACTCTGGCCTCATTTTCTATTTTACAATTAAATAACTTTCCACAT
Translation
 - UNI16680 - - UNI29634 - MANGAPFTTDW - UNI16680 - - UNI18488 - LGTSPLHLAAQYGHFSTTEVLLRAGVSRDARTKVD

RTPLHMAASEGHANIVEVLLK - UNI24883 - HGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQ

 - UNI18163 - MKQEYLLFSLETPLRQY  - UNI4310 -  - UNI4310 - 

For any suggestions or comments, please send an email to unitrap@crg.es