Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027466 (Rbck1)
Chromosomal location
Chr 2: 152142074 - 152158371 (-)
Description
RanBP-type and C3HC4-type zinc finger containing 1 Gene [Source:MGI (curated);Acc:Rbck1-002]
RefSeq_dna
NM_001083921 NM_019705 
RefSeq_peptide
NP_062679.2 NP_001077390.1 
UniGene
Mm.472312 Mm.182145 
MGI
MGI:1344372 
Uniprot/SWISSPROT
Q9WUB0 
Human Ortholog
ENSG00000125826 (RBCK1)
Omim not available
UniTrap UNI709
Vector Insertion
Chr 2: 152157769 - 152157859
Public Clones DB0191 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29748
Vector Insertion
Chr 2: 152156695 - 152157859
Public Clones E085G11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI163
Vector Insertion
Chr 2: 152150377 - 152151951
Public Clones GC0159 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18258
Vector Insertion
Chr 2: 152145040 - 152147895
Public Clones not available
Private Clones OST426851 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028964
Sequence
GGAGTCGGCCGGGTGGGGGAGAGGGGGGGGATCATGGGTCCCTAGACCAAGTGACTCTGGTCCGCCCAACCAAGTGTGGCGCGAAAGTGCCAGGAGCAGT

CTAGAGGTCTGCCCCAGTTGGTGACCCTGCAGAGTCTCGG - UNI709 - - UNI29748 - GTTACCTCAAAGTAGCGTTTTCCGGAAGCAGCAGC

CCTTTCTGAGGGGATGGGCGCAGCCAGGCCAGATGGACGAGAAGACCAAGAAAG - UNI709 - - UNI29748 - CAGAGGAGATGGCCCTGAGCC

TTGCCCGGGCAGTGGCTGGCGGAGATGAACAGGCTGCTATCAAGTATGCCACCTGGCTGGCAGAGCAGAGGGTGCCCCTCAGGGTGCAAGTAAAACCCGA

GGTCTCCCCAACACAGGACATCAG - UNI29748 - GCTCTGTGTGAGTGTGGAGGATGCGTACATGCACACCGTCACCATTTGGCTCACAGTACGCC

CGGATATGACAGTGGCCTCCCTTAAGGACATG GTATTCCTGGACTATGGCTTCCCACCTAGCCTGCAGCAGTGGGTGGTTGGACAGAGGCTGGCACGAG

ACCAGGAGACCTTGCATTCACACGGCATTCGGCGGAATGGAGACGGTGCCTATCTCTACCTGCTGTCAGCCCGCAACACGTCACTCAACCCACAAGAGCT

GCAGCGGCAGCGGCAACTGCGAATGTTGGAAG - UNI163 - ATTTGGGCTTCAAGGACCTCACCCTTCAGTCACGGGGGCCCTTGGAACCTGTCCTT

CCGAAGCCCAGGACCAACCAGGAGCCGGGACAGCCAGATGCAGCACCGGAGTCACCACCG GTGGGCTGGCAGTGCCCTGGCTGCACTTTCATCAACAAA

CCCACACGGCCTGGGTGTGAGATGTGCTGTCGTGCAAGGCCTGAGACCTACCAGATACCTGCTTCATACCAGCCTGACGAGGAAGAGCGAGCACGCCTGG

CCGGCGAGGAGGAGGCGCTGCGCCAGTACCAGCAG CGGAAACAGCAGCAGCAGGAGGGGAACTACCTGCAGCACGTGCAGCTGGAGCAGAGGAGCCTGG

TGCTGAACACCGAACCTACTGAGTGCCCTGTGTGCTACTCAGTGCTGGCACCCGGCGAGGCCGTGGTGCTGCGTGAGTGTCTGCACACCTTCTGCAG GG

AGTGCCTGCAGGGCACCATCCGAAACAGCCAGGAGGCGGAGGTGGCTTGCCCCTTCATTGACAGCACCTACTCATGCCCCGGCAAGCTGCTGGAGAGAGA

GATCCGGGCG - UNI18258 - CTCCTGTCCCCTGAGGACTACCAGCGTTTCCTGGATCTGGGTGTGTCCATCGCAGAGAACCGAAGCACCTTGAGCT

ACCACTGCAAGACCCCCGACTGCAGGGGTTGGTGCTTCTTTGAGGATGATGTCAACGAGTTCACCTGTCCTGTGTGCACCCGTGTCAACTGCCTGCTCTG

CAAG GCCATCCATGAGCACATGAATTGCAGGGAGTACCAAGACGACCTGGCCCTGCGGGCTCAGAATGATGTGGCTGCCCGGCAGACGACAGAGATGCT

AAAG GTAATGCTGCAGCAGGGCGAGGCCATGCACTGCCCACAGTGCCGGATTGTGGTGCAGAAGAAGGACGGCTGTGACTGGATCCGCTGTACAGTCTG

CCACACTGAGATCTGCTGGGTCACCAAGGGCCCACGCTGGGGCCCAGGG GGCCCAGGGGACACCAGTGGTGGCTGCCGCTGCCGGGTCAATGGGATTCC

ATGCCACCCAAGCTGTCAAAACTGCCACTAAGTCGACGATGGTGGCTCTCATACTGACCCAGCCCCACATGTATAGCAGTGAACAGCAGGGCTAGGCAAG

GGACTGGCCTGGTTTGGCCCCATACCTTTAGGCTTGGTAAGGGAGAAAGCCCGAGCTGTACTGCAGTCTGATTGCTGTGTTACAAGGACCCAGCTGAGCT

GATGTCATTCGCACTGCCTCTGTTGCTTCTGGCTGACCAGACCTCATGGCCCTGCACTAGACACCCGACCCTTACTAGCCACCAGCCTTAATTAAACACG

GCCTTGGCCTAAGGCCTGGCTGGCTAGTGCTCTGAGTGACTCTATTTTCCCTGAGCTTGCTCCCTGAGGACCCACCACAGCCTCATCCTTTGCCTTGCTG

GCTTTCTGGGCACGTCTTAAAGCTGATGTGAATCCATCCAGGGCCTAGGTAGATTGGTAAGTCAGGAAACAGCCCATGGGGTTCAGCTCTGCATCCTCCT

CTTTAAGTGAATTAAAGTGGTTTTCCC
Translation
 - UNI709 - - UNI29748 - MDEKTKKA - UNI709 - - UNI29748 - AEEMALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEV

SPTQDIR - UNI29748 - RLCVSVEDAYMHTVTIWLTVRPDMTVASLKDM VFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDGAYLYLLSA

RNTSLNPQELQRQRQLRMLED - UNI163 - DLGFKDLTLQSRGPLEPVLPKPRTNQEPGQPDAAPESPP VGWQCPGCTFINKPTRPGCEMCCRARP

ETYQIPASYQPDEEERARLAGEEEALRQYQQ RKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCR RECLQGTIRNSQE

AEVACPFIDSTYSCPGKLLEREIRA - UNI18258 - LLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCK 

AIHEHMNCREYQDDLALRAQNDVAARQTTEMLK VMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPG GPGDTSGGCRCRVNGIP

CHPSCQNCH
Transcript ENSMUST00000109847
Sequence
GTCTTCCGGGTAGCGCGAGCCTCCGGGCTGGGGTTCCGGACGCTAGGGCGCCCGCGCCGGCTGGCTGGCCGGCCTCCCTCCGTCCCTCGCTTTTGGGTCG

TGGTTACTCATCGCCCTTTGCAGACTTGGCTCGGGGCCTCCTTCGCTGTCCGTGTCCCTCGCGGGGCCCCATTGGTTCCCAGTGCCCGGCCTCGGGCCCT

GGGCAGTGTGATGCTGCCCGAGTGCGGACTGGAACACACGCACGAGGCCGGCTAGGGCAGAGTTGCTTCTACCTTCCCGCTCTCTCCCAGGTTACCTCAA

AGTAGCGTTTTCCGGAAGCAGCAGCCCTTTCTGAGGGGATGGGCGCAGCCAGGCCAGATGGACGAGAAGACCAAGAAAG - UNI709 - - UNI2974

8 - CAGAGGAGATGGCCCTGAGCCTTGCCCGGGCAGTGGCTGGCGGAGATGAACAGGCTGCTATCAAGTATGCCACCTGGCTGGCAGAGCAGAGGGTGC

CCCTCAGGGTGCAAGTAAAACCCGAGGTCTCCCCAACACAGGACATCAG - UNI29748 - GCTCTGTGTGAGTGTGGAGGATGCGTACATGCACACC

GTCACCATTTGGCTCACAGTACGCCCGGATATGACAGTGGCCTCCCTTAAGGACATG GTATTCCTGGACTATGGCTTCCCACCTAGCCTGCAGCAGTGG

GTGGTTGGACAGAGGCTGGCACGAGACCAGGAGACCTTGCATTCACACGGCATTCGGCGGAATGGAGACGGTGCCTATCTCTACCTGCTGTCAGCCCGCA

ACACGTCACTCAACCCACAAGAGCTGCAGCGGCAGCGGCAACTGCGAATGTTGGAAG - UNI163 - ATTTGGGCTTCAAGGACCTCACCCTTCAGTC

ACGGGGGCCCTTGGAACCTGTCCTTCCGAAGCCCAGGACCAACCAGGAGCCGGGACAGCCAGATGCAGCACCGGAGTCACCACCG GTGGGCTGGCAGTG

CCCTGGCTGCACTTTCATCAACAAACCCACACGGCCTGGGTGTGAGATGTGCTGTCGTGCAAGGCCTGAGACCTACCAGATACCTGCTTCATACCAGCCT

GACGAGGAAGAGCGAGCACGCCTGGCCGGCGAGGAGGAGGCGCTGCGCCAGTACCAGCAG CGGAAACAGCAGCAGCAGGAGGGGAACTACCTGCAGCAC

GTGCAGCTGGAGCAGAGGAGCCTGGTGCTGAACACCGAACCTACTGAGTGCCCTGTGTGCTACTCAGTGCTGGCACCCGGCGAGGCCGTGGTGCTGCGTG

AGTGTCTGCACACCTTCTGCAG GGAGTGCCTGCAGGGCACCATCCGAAACAGCCAGGAGGCGGAGGTGGCTTGCCCCTTCATTGACAGCACCTACTCAT

GCCCCGGCAAGCTGCTGGAGAGAGAGATCCGGGCG - UNI18258 - CTCCTGTCCCCTGAGGACTACCAGCGTTTCCTGGATCTGGGTGTGTCCATC

GCAGAGAACCGAAGCACCTTGAGCTACCACTGCAAGACCCCCGACTGCAGGGGTTGGTGCTTCTTTGAGGATGATGTCAACGAGTTCACCTGTCCTGTGT

GCACCCGTGTCAACTGCCTGCTCTGCAAG GCCATCCATGAGCACATGAATTGCAGGGAGTACCAAGACGACCTGGCCCTGCGGGCTCAGAATGATGTGG

CTGCCCGGCAGACGACAGAGATGCTAAAG GTAATGCTGCAGCAGGGCGAGGCCATGCACTGCCCACAGTGCCGGATTGTGGTGCAGAAGAAGGACGGCT

GTGACTGGATCCGCTGTACAGTCTGCCACACTGAGATCTGCTGGGTCACCAAGGGCCCACGCTGGGGCCCAGGG GGCCCAGGGGACACCAGTGGTGGCT

GCCGCTGCCGGGTCAATGGGATTCCATGCCACCCAAGCTGTCAAAACTGCCACTAAGTCGACGATGGTGGCTCTCATACTGACCCAGCCCCACATGTATA

GCAGTGAACAGCAGGGCTAGGCAAGGGACTGGCCTGGTTTGGCCCCATACCTTTAGGCTTGGTAAGGGAGAAAGCCCGAGCTGTACTGCAGTCTGATTGC

TGTGTTACAAGGACCCAGCTGAGCTGATGTCATTCGCACTGCCTCTGTTGCTTCTGGCTGACCAGACCTCATGGCCCTGCACTAGACACCCGACCCTTAC

TAGCCACCAGCCTTAATTAAACACGGCCTTGGCCTAAGGCCTGGCTGGCTAGTGCTCTGAGTGACTCTATTTTCCCTGAGCTTGCTCCCTGAGGACCCAC

CACAGCCTCATCCTTTGCCTTGCTGGCTTTCTGGGCACGTCTTAAAGCTGATGTGAATCCATCCAGGGCCTAGGTAGATTGGTAAGTCAGGAAACAGCCC

ATGGGGTTCAGCTCTGCATCCTCCTCTTTAAGTGAATTAAAGTGGTTTTCCC
Translation
MDEKTKKA - UNI709 - - UNI29748 - AEEMALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEVSPTQDIR - UNI29748 - RLCV

SVEDAYMHTVTIWLTVRPDMTVASLKDM VFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLED - U

NI163 - DLGFKDLTLQSRGPLEPVLPKPRTNQEPGQPDAAPESPP VGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEA

LRQYQQ RKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCR RECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRA

 - UNI18258 - LLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCK AIHEHMNCREYQDDLALRAQNDVAA

RQTTEMLK VMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPG GPGDTSGGCRCRVNGIPCHPSCQNCH

For any suggestions or comments, please send an email to unitrap@crg.es