Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027478 (Dnmt3b)
Chromosomal location
Chr 2: 153475186 - 153513466 (+)
Description
DNA methyltransferase 3B Gene [Source:MGI (curated);Acc:Dnmt3b-003]
RefSeq_dna
NM_001003960 NM_001003963 NM_001003961 NM_010068 
RefSeq_peptide
NP_001116469.1 NP_001003961.2 NP_001003960.2 NP_001003963.2 NP_034198.3 
UniGene
Mm.398574 Mm.89772 
MGI
MGI:1261819 
Uniprot/SWISSPROT
O88509 
Uniprot/SPTREMBL
Q3KR45 A2AU58 A2AU59 Q541E5 A2AU57 
Human Ortholog
ENSG00000088305 (DNMT3B)
Omim 242860 - IMMUNODEFICIENCY-CENTROMERIC INSTABILITY-FACIAL ANOMALIES SYNDROME  
UniTrap UNI14517
Vector Insertion
Chr 2: 153476636 - 153487160
Public Clones (sanger) P117C12 (ggtc) E036E11 (ggtc) FHCRC-GT-S9-11E1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18009
Vector Insertion
Chr 2: 153487160 - 153487339
Public Clones not available
Private Clones OST432180 (lexicon) OST222861 (lexicon) OST172872 (lexicon) OST145902 (lexicon)
OST63166 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4871
Vector Insertion
Chr 2: 153493399 - 153495483
Public Clones AE0149 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056495
Sequence
ACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTAGCCC

GGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGCCGGA

GATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG GCCCGCTGAGGC

TTGTGCCAGACCTTGGAAACCTCAGGTATATACCTTTCCAGACGCGGGATCTCCCCTCCCCCATCCATAGTGCCTTGGGACCAAATCCAGGGCCTTCTTT

CAG - UNI14517 - - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTA

TCGTTAATGGGAACTTCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGA

GACCAGAG - UNI18009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGAT

GGAGACAGAGATGATGAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCC

CGGCT GTCCGAACCCGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGC

AGGAGTACCCTGTGGAGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCA

TGGAAGAAGTGACACCTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAG

CAGAGATGGAGACAGCACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCAT

GGTGGTGTCCTGGAAAGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 -

 ATCTCTGCTGACAAACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCAC

ACTCTGGAG AAAGCCAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCAC

GGTGGCTTCAAGCCTACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG TGGTTAATAAGTCGAAGGTGCGTCGTTCAGACAGTAGGAACTTA

GAACCCAGGAGACGCG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCTGAGTCCCCCCCACCCAAGCGCCTCAAGACAAATAGCTAT

GGCGGGAAGGACCGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACCAACAACAAGGGCAATCTGGAAG ACCGCTGTTTGTCCTG

TGGAAAGAAGAACCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGCCGG GATCGCTTCCTAGAGCTCTTCTACATGTATGATGA

GGACGGCTATCAGTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGTAACACAAGCTGCTGCAG ATGCTTCTGTGTGGAGTGTCT

GGAGGTGCTGGTGGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGCTATATGTGCCTCCCTCAGCGCTGCCATGGGGTCCTCCGA

CGCAGGAAAGATTGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAGAATTT CAGGAGCCACCCAAGTTGTACCCAGCAATTCCT

GCAGCCAAAAGGAGGCCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTGGTGCTCAAGGAGTTGGGTATTAAAGTGGAAAAGTAC

ATTGCCTCCGAAGTCTGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCAAATATGTCAATGACGTCCGGAAAATCACCAAGAAAA

AT ATTGAAGAGTGGGGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTAACGTCAATCCTGCCCGCAAAGGTTTATATG AGGGC

ACAGGAAGGCTCTTCTTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACAACCGTCCATTCTTCTGGATGTTCGAGAATGTTGTGG

CCATGAAAGTGAATGACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCGATGCCATCAAGGTGTCTGCTGCTCACAGGGCCCGGT

ACTTCTGGGGTAACCTACCCGGAATGAACAG GCCCGTGATGGCTTCAAAGAATGATAAGCTCGAGCTGCAGGACTGCCTGGAGTTCAGTAGGACAGCAA

AG TTAAAGAAAGTGCAGACAATAACCACCAAGTCGAACTCCATCAGACAGGGCAAAAACCAGCTTTTCCCTGTAGTCATGAATGGCAAGGACGACGTTT

TGTGGTGCACTGAGCTCGAAAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACATGGGCCGCGGCGCCCGTCAGAAGCTGCTGGGCAGGT

CCTGGAGTGTACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATAGTTCTACCCAGGACTGGGGAGCTCTCGGTCAGAGCC

AGTGCCCAGAGTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGGGGCCTCACATCACTGTACCTCAGCTTTCTCCTGCTC

AGTGGGAGCAGAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTCAGACCTGGCTGCTTAGAGTAGCCCGGCATGGTGCTC

ATGTTCTCTTACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTCCTGAGTTTATCACTCAGAAGTGATGGCTAAGATACC

AAAAAAACAAACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTCAGGTTCATGCTGCAAAATCACTTGAGATTTTGTTTT

TAAGTAACCCGTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAGGTCAAGGGGCCAAAAAAAATTCCCCCTCTCCCCCCA

GGAGTATTTGAAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACAAGGGCTGAAGTCCTGTTGGTCTTGTAGCATTTCCCA

GGATGATGATGTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATGTGGCTAGTCCTCACGAAGACTGGAGTAGAATGTTTG

GAGCTCAGGAAGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTTAGGGAAATCCATTCCCCACTCCCTCTTGCCAAATGA

GGGGCCCAGTCCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACCAGAAGCACATCGTTCCCCTTATCTGAGCAGTGTTTG

GGGAACTACAGTGAAAACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAGATTGTGTTTTTAAGGGGTGCTTTTTTTAGGGGCATCACTGGAGAT

AAGAAAGCTGCATTTCAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCTAATTACAGGTGCTATTTTATAGAAGCAGACAACACTTCTTTTTAT

GACTCTCAGACTTCTATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTGGGCTTTTGTAACTTCACAGGTGTGGGGAGAGACTGCCTTGTTTCA

ACAGTTTGTCTCCACTGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAGAGTTTACCTTTCTGGTTGATTAAAGTTGTATTTCTCT
Translation
  - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - 

GRRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVE

FPATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSW

KATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPM

LEWAHGGFKPTGIEGLKPNKKQPV VVNKSKVRRSDSRNLEPRRRE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNK

GNLED DRCLSCGKKNPVSFHPLFEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWS

CYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEF QEPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKH

EGQIKYVNDVRKITKKN IEEWGPFDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA

 CNPVMIDAIKVSAAHRARYFWGNLPGMNR RPVMASKNDKLELQDCLEFSRTAK LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELER RIF

GFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000109774
Sequence
ACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTAGCCC

GGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGCCGGA

GATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG GCCCGCTGAGGC

TTGTGCCAGACCTTGGAAACCTCAGGTATATACCTTTCCAGACGCGGGATCTCCCCTCCCCCATCCATAGTGCCTTGGGACCAAATCCAGGGCCTTCTTT

CAG - UNI14517 - - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTA

TCGTTAATGGGAACTTCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGA

GACCAGAG - UNI18009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGAT

GGAGACAGAGATGATGAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCC

CGGCT GTCCGAACCCGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGC

AGGAGTACCCTGTGGAGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCA

TGGAAGAAGTGACACCTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAG

CAGAGATGGAGACAGCACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCAT

GGTGGTGTCCTGGAAAGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 -

 ATCTCTGCTGACAAACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCAC

ACTCTGGAG AAAGCCAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCAC

GGTGGCTTCAAGCCTACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG TGGTTAATAAGTCGAAGGTGCGTCGTTCAGACAGTAGGAACTTA

GAACCCAGGAGACGCG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCTGAGTCCCCCCCACCCAAGCGCCTCAAGACAAATAGCTAT

GGCGGGAAGGACCGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACCAACAACAAGGGCAATCTGGAAG ACCGCTGTTTGTCCTG

TGGAAAGAAGAACCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGCCGG GATCGCTTCCTAGAGCTCTTCTACATGTATGATGA

GGACGGCTATCAGTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGTAACACAAGCTGCTGCAG ATGCTTCTGTGTGGAGTGTCT

GGAGGTGCTGGTGGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGCTATATGTGCCTCCCTCAGCGCTGCCATGGGGTCCTCCGA

CGCAGGAAAGATTGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAGAATTT GAGCCACCCAAGTTGTACCCAGCAATTCCTGCA

GCCAAAAGGAGGCCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTGGTGCTCAAGGAGTTGGGTATTAAAGTGGAAAAGTACATT

GCCTCCGAAGTCTGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCAAATATGTCAATGACGTCCGGAAAATCACCAAGAAAAAT 

ATTGAAGAGTGGGGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTAACGTCAATCCTGCCCGCAAAGGTTTATATG AGGGCACA

GGAAGGCTCTTCTTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACAACCGTCCATTCTTCTGGATGTTCGAGAATGTTGTGGCCA

TGAAAGTGAATGACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCGATGCCATCAAGGTGTCTGCTGCTCACAGGGCCCGGTACT

TCTGGGGTAACCTACCCGGAATGAACAG GCCCGTGATGGCTTCAAAGAATGATAAGCTCGAGCTGCAGGACTGCCTGGAGTTCAGTAGGACAGCAAAG 

TTAAAGAAAGTGCAGACAATAACCACCAAGTCGAACTCCATCAGACAGGGCAAAAACCAGCTTTTCCCTGTAGTCATGAATGGCAAGGACGACGTTTTGT

GGTGCACTGAGCTCGAAAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACATGGGCCGCGGCGCCCGTCAGAAGCTGCTGGGCAGGTCCT

GGAGTGTACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATAGTTCTACCCAGGACTGGGGAGCTCTCGGTCAGAGCCAGT

GCCCAGAGTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGGGGCCTCACATCACTGTACCTCAGCTTTCTCCTGCTCAGT

GGGAGCAGAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTCAGACCTGGCTGCTTAGAGTAGCCCGGCATGGTGCTCATG

TTCTCTTACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTCCTGAGTTTATCACTCAGAAGTGATGGCTAAGATACCAAA

AAAACAAACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTCAGGTTCATGCTGCAAAATCACTTGAGATTTTGTTTTTAA

GTAACCCGTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAGGTCAAGGGGCCAAAAAAAATTCCCCCTCTCCCCCCAGGA

GTATTTGAAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACAAGGGCTGAAGTCCTGTTGGTCTTGTAGCATTTCCCAGGA

TGATGATGTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATGTGGCTAGTCCTCACGAAGACTGGAGTAGAATGTTTGGAG

CTCAGGAAGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTTAGGGAAATCCATTCCCCACTCCCTCTTGCCAAATGAGGG

GCCCAGTCCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACCAGAAGCACATCGTTCCCCTTATCTGAGCAGTGTTTGGGG

AACTACAGTGAAAACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAGATTGTGTTTTTAAGGGGTGCTTTTTTTAGGGGCATCACTGGAGATAAG

AAAGCTGCATTTCAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCTAATTACAGGTGCTATTTTATAGAAGCAGACAACACTTCTTTTTATGAC

TCTCAGACTTCTATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTGGGCTTTTGTAACTTCACAGGTGTGGGGAGAGACTGCCTTGTTTCAACA

GTTTGTCTCCACTGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAGAGTTTACCTTTCTGGTTGATTAAAGTTGTATTTCTCT
Translation
  - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - 

GRRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVE

FPATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSW

KATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPM

LEWAHGGFKPTGIEGLKPNKKQPV VVNKSKVRRSDSRNLEPRRRE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNK

GNLED DRCLSCGKKNPVSFHPLFEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWS

CYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEF EPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHE

GQIKYVNDVRKITKKN IEEWGPFDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA 

CNPVMIDAIKVSAAHRARYFWGNLPGMNR RPVMASKNDKLELQDCLEFSRTAK LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELER RIFG

FPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000081628
Sequence
ACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTAGCCC

GGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGCCGGA

GATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG GCCCGCTGAGGC

TTGTGCCAGACCTTGGAAACCTCAGGTATATACCTTTCCAGACGCGGGATCTCCCCTCCCCCATCCATAGTGCCTTGGGACCAAATCCAGGGCCTTCTTT

CAG - UNI14517 - - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTA

TCGTTAATGGGAACTTCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGA

GACCAGAG - UNI18009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGAT

GGAGACAGAGATGATGAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCC

CGGCT GTCCGAACCCGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGC

AGGAGTACCCTGTGGAGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCA

TGGAAGAAGTGACACCTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAG

CAGAGATGGAGACAGCACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCAT

GGTGGTGTCCTGGAAAGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 -

 ATCTCTGCTGACAAACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCAC

ACTCTGGAG AAAGCCAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCAC

GGTGGCTTCAAGCCTACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCT

GAGTCCCCCCCACCCAAGCGCCTCAAGACAAATAGCTATGGCGGGAAGGACCGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACC

AACAACAAGGGCAATCTGGAAG ACCGCTGTTTGTCCTGTGGAAAGAAGAACCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGC

CGG GATCGCTTCCTAGAGCTCTTCTACATGTATGATGAGGACGGCTATCAGTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGT

AACACAAGCTGCTGCAG ATGCTTCTGTGTGGAGTGTCTGGAGGTGCTGGTGGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGC

TATATGTGCCTCCCTCAGCGCTGCCATGGGGTCCTCCGACGCAGGAAAGATTGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAG

AATTT GAGCCACCCAAGTTGTACCCAGCAATTCCTGCAGCCAAAAGGAGGCCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTG

GTGCTCAAGGAGTTGGGTATTAAAGTGGAAAAGTACATTGCCTCCGAAGTCTGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCA

AATATGTCAATGACGTCCGGAAAATCACCAAGAAAAAT ATTGAAGAGTGGGGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTA

ACGTCAATCCTGCCCGCAAAGGTTTATATG AGGGCACAGGAAGGCTCTTCTTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACA

ACCGTCCATTCTTCTGGATGTTCGAGAATGTTGTGGCCATGAAAGTGAATGACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCG

ATGCCATCAAGGTGTCTGCTGCTCACAGGGCCCGGTACTTCTGGGGTAACCTACCCGGAATGAACAG GCCCGTGATGGCTTCAAAGAATGATAAGCTCG

AGCTGCAGGACTGCCTGGAGTTCAGTAGGACAGCAAAG TTAAAGAAAGTGCAGACAATAACCACCAAGTCGAACTCCATCAGACAGGGCAAAAACCAGC

TTTTCCCTGTAGTCATGAATGGCAAGGACGACGTTTTGTGGTGCACTGAGCTCGAAAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACA

TGGGCCGCGGCGCCCGTCAGAAGCTGCTGGGCAGGTCCTGGAGTGTACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATA

GTTCTACCCAGGACTGGGGAGCTCTCGGTCAGAGCCAGTGCCCAGAGTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGG

GGCCTCACATCACTGTACCTCAGCTTTCTCCTGCTCAGTGGGAGCAGAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTC

AGACCTGGCTGCTTAGAGTAGCCCGGCATGGTGCTCATGTTCTCTTACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTC

CTGAGTTTATCACTCAGAAGTGATGGCTAAGATACCAAAAAAACAAACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTC

AGGTTCATGCTGCAAAATCACTTGAGATTTTGTTTTTAAGTAACCCGTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAG

GTCAAGGGGCCAAAAAAAATTCCCCCTCTCCCCCCAGGAGTATTTGAAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACA

AGGGCTGAAGTCCTGTTGGTCTTGTAGCATTTCCCAGGATGATGATGTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATG

TGGCTAGTCCTCACGAAGACTGGAGTAGAATGTTTGGAGCTCAGGAAGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTT

AGGGAAATCCATTCCCCACTCCCTCTTGCCAAATGAGGGGCCCAGTCCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACC

AGAAGCACATCGTTCCCCTTATCTGAGCAGTGTTTGGGGAACTACAGTGAAAACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAGATTGTGTTT

TTAAGGGGTGCTTTTTTTAGGGGCATCACTGGAGATAAGAAAGCTGCATTTCAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCTAATTACAGG

TGCTATTTTATAGAAGCAGACAACACTTCTTTTTATGACTCTCAGACTTCTATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTGGGCTTTTGT

AACTTCACAGGTGTGGGGAGAGACTGCCTTGTTTCAACAGTTTGTCTCCACTGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAGAGTTTACCT

TTCTGGTTGATTAAAGTTGTATTTCTCT
Translation
  - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - 

GRRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVE

FPATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSW

KATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPM

LEWAHGGFKPTGIEGLKPNKKQPE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNKGNLED DRCLSCGKKNPVSFHP

LFEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMR

LQDFFTTDPDLEEF EPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKN IEEWG

PFDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA CNPVMIDAIKVSAAHRARYFWG

NLPGMNR RPVMASKNDKLELQDCLEFSRTAK LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELER RIFGFPAHYTDVSNMGRGARQKLLGR

SWSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000088976
Sequence
ACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTAGCCC

GGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGCCGGA

GATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG GCCCGCTGAGGC

TTGTGCCAGACCTTGGAAACCTCAGGTATATACCTTTCCAGACGCGGGATCTCCCCTCCCCCATCCATAGTGCCTTGGGACCAAATCCAGGGCCTTCTTT

CAG - UNI14517 - - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTA

TCGTTAATGGGAACTTCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGA

GACCAGAG - UNI18009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGAT

GGAGACAGAGATGATGAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCC

CGGCT GTCCGAACCCGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGC

AGGAGTACCCTGTGGAGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCA

TGGAAGAAGTGACACCTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAG

CAGAGATGGAGACAGCACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCAT

GGTGGTGTCCTGGAAAGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 -

 ATCTCTGCTGACAAACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCAC

ACTCTGGAG AAAGCCAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCAC

GGTGGCTTCAAGCCTACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG TGGTTAATAAGTCGAAGGTGCGTCGTTCAGACAGTAGGAACTTA

GAACCCAGGAGACGCG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCTGAGTCCCCCCCACCCAAGCGCCTCAAGACAAATAGCTAT

GGCGGGAAGGACCGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACCAACAACAAGGGCAATCTGGAAG ACCGCTGTTTGTCCTG

TGGAAAGAAGAACCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGCCGG GATCGCTTCCTAGAGCTCTTCTACATGTATGATGA

GGACGGCTATCAGTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGTAACACAAGCTGCTGCAG ATGCTTCTGTGTGGAGTGTCT

GGAGGTGCTGGTGGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGCTATATGTGCCTCCCTCAGCGCTGCCATGGGGTCCTCCGA

CGCAGGAAAGATTGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAGAATTT GAGCCACCCAAGTTGTACCCAGCAATTCCTGCA

GCCAAAAGGAGGCCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTGGTGCTCAAGGAGTTGGGTATTAAAGTGGAAAAGTACATT

GCCTCCGAAGTCTGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCAAATATGTCAATGACGTCCGGAAAATCACCAAGAAAAAT 

ATTGAAGAGTGGGGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTAACGTCAATCCTGCCCGCAAAGGTTTATATG AGGGCACA

GGAAGGCTCTTCTTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACAACCGTCCATTCTTCTGGATGTTCGAGAATGTTGTGGCCA

TGAAAGTGAATGACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCGATGCCATCAAGGTGTCTGCTGCTCACAGGGCCCGGTACT

TCTGGGGTAACCTACCCGGAATGAACAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACATGGGCCGCGGCGCCCGTCAGAAGCTGCTGG

GCAGGTCCTGGAGTGTACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATAGTTCTACCCAGGACTGGGGAGCTCTCGGTC

AGAGCCAGTGCCCAGAGTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGGGGCCTCACATCACTGTACCTCAGCTTTCTC

CTGCTCAGTGGGAGCAGAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTCAGACCTGGCTGCTTAGAGTAGCCCGGCATG

GTGCTCATGTTCTCTTACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTCCTGAGTTTATCACTCAGAAGTGATGGCTAA

GATACCAAAAAAACAAACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTCAGGTTCATGCTGCAAAATCACTTGAGATTT

TGTTTTTAAGTAACCCGTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAGGTCAAGGGGCCAAAAAAAATTCCCCCTCTC

CCCCCAGGAGTATTTGAAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACAAGGGCTGAAGTCCTGTTGGTCTTGTAGCAT

TTCCCAGGATGATGATGTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATGTGGCTAGTCCTCACGAAGACTGGAGTAGAA

TGTTTGGAGCTCAGGAAGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTTAGGGAAATCCATTCCCCACTCCCTCTTGCC

AAATGAGGGGCCCAGTCCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACCAGAAGCACATCGTTCCCCTTATCTGAGCAG

TGTTTGGGGAACTACAGTGAAAACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAGATTGTGTTTTTAAGGGGTGCTTTTTTTAGGGGCATCACT

GGAGATAAGAAAGCTGCATTTCAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCTAATTACAGGTGCTATTTTATAGAAGCAGACAACACTTCT

TTTTATGACTCTCAGACTTCTATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTGGGCTTTTGTAACTTCACAGGTGTGGGGAGAGACTGCCTT

GTTTCAACAGTTTGTCTCCACTGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAGAGTTTACCTTTCTGGTTGATTAAAGTTGTATTTCTCT
Translation
  - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - 

GRRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVE

FPATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSW

KATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPM

LEWAHGGFKPTGIEGLKPNKKQPV VVNKSKVRRSDSRNLEPRRRE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNK

GNLED DRCLSCGKKNPVSFHPLFEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWS

CYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEF EPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHE

GQIKYVNDVRKITKKN IEEWGPFDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA 

CNPVMIDAIKVSAAHRARYFWGNLPGMNR RIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000103150
Sequence
ACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTAGCCC

GGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGCCGGA

GATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG GCCCGCTGAGGC

TTGTGCCAGACCTTGGAAACCTCAGGTATATACCTTTCCAGACGCGGGATCTCCCCTCCCCCATCCATAGTGCCTTGGGACCAAATCCAGGGCCTTCTTT

CAG - UNI14517 - - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTA

TCGTTAATGGGAACTTCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGA

GACCAGAG - UNI18009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGAT

GGAGACAGAGATGATGAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCC

CGGCT GTCCGAACCCGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGC

AGGAGTACCCTGTGGAGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCA

TGGAAGAAGTGACACCTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAG

CAGAGATGGAGACAGCACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCAT

GGTGGTGTCCTGGAAAGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 -

 ATCTCTGCTGACAAACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCAC

ACTCTGGAG AAAGCCAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCAC

GGTGGCTTCAAGCCTACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCT

GAGTCCCCCCCACCCAAGCGCCTCAAGACAAATAGCTATGGCGGGAAGGACCGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACC

AACAACAAGGGCAATCTGGAAG ACCGCTGTTTGTCCTGTGGAAAGAAGAACCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGC

CGG GATCGCTTCCTAGAGCTCTTCTACATGTATGATGAGGACGGCTATCAGTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGT

AACACAAGCTGCTGCAG ATGCTTCTGTGTGGAGTGTCTGGAGGTGCTGGTGGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGC

TATATGTGCCTCCCTCAGCGCTGCCATGGGGTCCTCCGACGCAGGAAAGATTGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAG

AATTT GAGCCACCCAAGTTGTACCCAGCAATTCCTGCAGCCAAAAGGAGGCCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTG

GTGCTCAAGGAGTTGGGTATTAAAGTGGAAAAGTACATTGCCTCCGAAGTCTGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCA

AATATGTCAATGACGTCCGGAAAATCACCAAGAAAAAT ATTGAAGAGTGGGGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTA

ACGTCAATCCTGCCCGCAAAGGTTTATATG AGGGCACAGGAAGGCTCTTCTTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACA

ACCGTCCATTCTTCTGGATGTTCGAGAATGTTGTGGCCATGAAAGTGAATGACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCG

ATGCCATCAAGGTGTCTGCTGCTCACAGGGCCCGGTACTTCTGGGGTAACCTACCCGGAATGAACAG GATCTTCGGCTTCCCTGCTCACTACACGGACG

TGTCCAACATGGGCCGCGGCGCCCGTCAGAAGCTGCTGGGCAGGTCCTGGAGTGTACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGC

CTGTGAATAGTTCTACCCAGGACTGGGGAGCTCTCGGTCAGAGCCAGTGCCCAGAGTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCA

CCTGTGTGGGGCCTCACATCACTGTACCTCAGCTTTCTCCTGCTCAGTGGGAGCAGAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGT

GCACAGCTCAGACCTGGCTGCTTAGAGTAGCCCGGCATGGTGCTCATGTTCTCTTACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCT

TTTACCCTCCTGAGTTTATCACTCAGAAGTGATGGCTAAGATACCAAAAAAACAAACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTC

TTAGTACTCAGGTTCATGCTGCAAAATCACTTGAGATTTTGTTTTTAAGTAACCCGTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAG

ATGAGCAAGGTCAAGGGGCCAAAAAAAATTCCCCCTCTCCCCCCAGGAGTATTTGAAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGC

TTTGGTACAAGGGCTGAAGTCCTGTTGGTCTTGTAGCATTTCCCAGGATGATGATGTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAG

GGGCCCATGTGGCTAGTCCTCACGAAGACTGGAGTAGAATGTTTGGAGCTCAGGAAGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGG

AGGAAGCTTAGGGAAATCCATTCCCCACTCCCTCTTGCCAAATGAGGGGCCCAGTCCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAA

GCTAGGACCAGAAGCACATCGTTCCCCTTATCTGAGCAGTGTTTGGGGAACTACAGTGAAAACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAG

ATTGTGTTTTTAAGGGGTGCTTTTTTTAGGGGCATCACTGGAGATAAGAAAGCTGCATTTCAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCT

AATTACAGGTGCTATTTTATAGAAGCAGACAACACTTCTTTTTATGACTCTCAGACTTCTATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTG

GGCTTTTGTAACTTCACAGGTGTGGGGAGAGACTGCCTTGTTTCAACAGTTTGTCTCCACTGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAG

AGTTTACCTTTCTGGTTGATTAAAGTTGTATTTCTCT
Translation
  - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - 

GRRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVE

FPATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSW

KATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPM

LEWAHGGFKPTGIEGLKPNKKQPE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNKGNLED DRCLSCGKKNPVSFHP

LFEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMR

LQDFFTTDPDLEEF EPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKN IEEWG

PFDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA CNPVMIDAIKVSAAHRARYFWG

NLPGMNR RIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000072997
Sequence
ACCCACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTA

GCCCGGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGC

CGGAGATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG - UNI145

17 - - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTATCGTTAATGGGA

ACTTCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGAGACCAGAG - U

NI18009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGATGGAGACAGAGAT

GATGAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCCCGGCT GTCCGA

ACCCGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGCAGGAGTACCCTG

TGGAGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCATGGAAGAAGTGA

CACCTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAGCAGAGATGGAGA

CAGCACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCATGGTGGTGTCCTG

GAAAGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 - ATCTCTGCTGA

CAAACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCACACTCTGGAG AA

AGCCAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCACGGTGGCTTCAAG

CCTACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG TGGTTAATAAGTCGAAGGTGCGTCGTTCAGACAGTAGGAACTTAGAACCCAGGAGA

CGCG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCTGAGTCCCCCCCACCCAAGCGCCTCAAGACAAATAGCTATGGCGGGAAGGAC

CGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACCAACAACAAGGGCAATCTGGAAG ACCGCTGTTTGTCCTGTGGAAAGAAGAA

CCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGCCGG GATCGCTTCCTAGAGCTCTTCTACATGTATGATGAGGACGGCTATCA

GTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGTAACACAAGCTGCTGCAG ATGCTTCTGTGTGGAGTGTCTGGAGGTGCTGGT

GGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGCTATATGTGCCTCCCTCAGCGCTGCCATGGGGTCCTCCGACGCAGGAAAGAT

TGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAGAATTT GAGCCACCCAAGTTGTACCCAGCAATTCCTGCAGCCAAAAGGAGG

CCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTGGTGCTCAAGGAGTTGGGTATTAAAGTGGAAAAGTACATTGCCTCCGAAGTC

TGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCAAATATGTCAATGACGTCCGGAAAATCACCAAGAAAAAT ATTGAAGAGTGG

GGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTAACGTCAATCCTGCCCGCAAAGGTTTATATG AGGGCACAGGAAGGCTCTTC

TTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACAACCGTCCATTCTTCTGGATGTTCGAGAATGTTGTGGCCATGAAAGTGAATG

ACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCGATGCCATCAAGGTGTCTGCTGCTCACAGGGCCCGGTACTTCTGGGGTAACC

TACCCGGAATGAACAG GCCCGTGATGGCTTCAAAGAATGATAAGCTCGAGCTGCAGGACTGCCTGGAGTTCAGTAGGACAGCAAAG TTAAAGAAAGTG

CAGACAATAACCACCAAGTCGAACTCCATCAGACAGGGCAAAAACCAGCTTTTCCCTGTAGTCATGAATGGCAAGGACGACGTTTTGTGGTGCACTGAGC

TCGAAAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACATGGGCCGCGGCGCCCGTCAGAAGCTGCTGGGCAGGTCCTGGAGTGTACCGG

TCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATAGTTCTACCCAGGACTGGGGAGCTCTCGGTCAGAGCCAGTGCCCAGAGTCAC

CCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGGGGCCTCACATCACTGTACCTCAGCTTTCTCCTGCTCAGTGGGAGCAGAGCC

TCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTCAGACCTGGCTGCTTAGAGTAGCCCGGCATGGTGCTCATGTTCTCTTACCCT

GAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTCCTGAGTTTATCACTCAGAAGTGATGGCTAAGATACCAAAAAAACAAACAAA

AACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTCAGGTTCATGCTGCAAAATCACTTGAGATTTTGTTTTTAAGTAACCCGTGCT

CCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAGGTCAAGGGGCCAAAAAAAATTCCCCCTCTCCCCCCAGGAGTATTTGAAGAT

GATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACAAGGGCTGAAGTCCTGTTGGTCTTGTAGCATTTCCCAGGATGATGATGTCAG

CAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATGTGGCTAGTCCTCACGAAGACTGGAGTAGAATGTTTGGAGCTCAGGAAGGGT

GGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTTAGGGAAATCCATTCCCCACTCCCTCTTGCCAAATGAGGGGCCCAGTCCCCA

ACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACCAGAAGCACATCGTTCCCCTTATCTGAGCAGTGTTTGGGGAACTACAGTGAA

AACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAGATTGTGTTTTTAAGGGGTGCTTTTTTTAGGGGCATCACTGGAGATAAGAAAGCTGCATTT

CAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCTAATTACAGGTGCTATTTTATAGAAGCAGACAACACTTCTTTTTATGACTCTCAGACTTCT

ATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTGGGCTTTTGTAACTTCACAGGTGTGGGGAGAGACTGCCTTGTTTCAACAGTTTGTCTCCAC

TGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAGAGTTTACCTTTCTGGTTGATTAAAGTTGTATTTCTCTATAA
Translation
 - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - G

RRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEF

PATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSWK

ATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPML

EWAHGGFKPTGIEGLKPNKKQPV VVNKSKVRRSDSRNLEPRRRE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNKG

NLED DRCLSCGKKNPVSFHPLFEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWSC

YMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEF EPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHEG

QIKYVNDVRKITKKN IEEWGPFDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA C

NPVMIDAIKVSAAHRARYFWGNLPGMNR RPVMASKNDKLELQDCLEFSRTAK LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELER RIFGF

PAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000109773
Sequence
ACCCACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTA

GCCCGGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGC

CGGAGATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG - UNI145

17 - - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTATCGTTAATGGGA

ACTTCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGAGACCAGAG - U

NI18009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGATGGAGACAGAGAT

GATGAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCCCGGCT GTCCGA

ACCCGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGCAGGAGTACCCTG

TGGAGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCATGGAAGAAGTGA

CACCTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAGCAGAGATGGAGA

CAGCACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCATGGTGGTGTCCTG

GAAAGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 - ATCTCTGCTGA

CAAACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCACACTCTGGAG AA

AGCCAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCACGGTGGCTTCAAG

CCTACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCTGAGTCCCCCCCA

CCCAAGCGCCTCAAGACAAATAGCTATGGCGGGAAGGACCGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACCAACAACAAGGGC

AATCTGGAAG ACCGCTGTTTGTCCTGTGGAAAGAAGAACCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGCCGG GATCGCTT

CCTAGAGCTCTTCTACATGTATGATGAGGACGGCTATCAGTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGTAACACAAGCTGC

TGCAG ATGCTTCTGTGTGGAGTGTCTGGAGGTGCTGGTGGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGCTATATGTGCCTC

CCTCAGCGCTGCCATGGGGTCCTCCGACGCAGGAAAGATTGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAGAATTT GAGCCA

CCCAAGTTGTACCCAGCAATTCCTGCAGCCAAAAGGAGGCCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTGGTGCTCAAGGAG

TTGGGTATTAAAGTGGAAAAGTACATTGCCTCCGAAGTCTGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCAAATATGTCAATG

ACGTCCGGAAAATCACCAAGAAAAAT ATTGAAGAGTGGGGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTAACGTCAATCCTG

CCCGCAAAGGTTTATATG AGGGCACAGGAAGGCTCTTCTTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACAACCGTCCATTCT

TCTGGATGTTCGAGAATGTTGTGGCCATGAAAGTGAATGACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCGATGCCATCAAGG

TGTCTGCTGCTCACAGGGCCCGGTACTTCTGGGGTAACCTACCCGGAATGAACAG GCCCGTGATGGCTTCAAAGAATGATAAGCTCGAGCTGCAGGACT

GCCTGGAGTTCAGTAGGACAGCAAAG TTAAAGAAAGTGCAGACAATAACCACCAAGTCGAACTCCATCAGACAGGGCAAAAACCAGCTTTTCCCTGTAG

TCATGAATGGCAAGGACGACGTTTTGTGGTGCACTGAGCTCGAAAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACATGGGCCGCGGCG

CCCGTCAGAAGCTGCTGGGCAGGTCCTGGAGTGTACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATAGTTCTACCCAGG

ACTGGGGAGCTCTCGGTCAGAGCCAGTGCCCAGAGTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGGGGCCTCACATCA

CTGTACCTCAGCTTTCTCCTGCTCAGTGGGAGCAGAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTCAGACCTGGCTGC

TTAGAGTAGCCCGGCATGGTGCTCATGTTCTCTTACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTCCTGAGTTTATCA

CTCAGAAGTGATGGCTAAGATACCAAAAAAACAAACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTCAGGTTCATGCTG

CAAAATCACTTGAGATTTTGTTTTTAAGTAACCCGTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAGGTCAAGGGGCCA

AAAAAAATTCCCCCTCTCCCCCCAGGAGTATTTGAAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACAAGGGCTGAAGTC

CTGTTGGTCTTGTAGCATTTCCCAGGATGATGATGTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATGTGGCTAGTCCTC

ACGAAGACTGGAGTAGAATGTTTGGAGCTCAGGAAGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTTAGGGAAATCCAT

TCCCCACTCCCTCTTGCCAAATGAGGGGCCCAGTCCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACCAGAAGCACATCG

TTCCCCTTATCTGAGCAGTGTTTGGGGAACTACAGTGAAAACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAGATTGTGTTTTTAAGGGGTGCT

TTTTTTAGGGGCATCACTGGAGATAAGAAAGCTGCATTTCAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCTAATTACAGGTGCTATTTTATA

GAAGCAGACAACACTTCTTTTTATGACTCTCAGACTTCTATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTGGGCTTTTGTAACTTCACAGGT

GTGGGGAGAGACTGCCTTGTTTCAACAGTTTGTCTCCACTGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAGAGTTTACCTTTCTGGTTGATT

AAAGTTGTATTTCTCTATAA
Translation
 - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - G

RRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEF

PATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSWK

ATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPML

EWAHGGFKPTGIEGLKPNKKQPE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNKGNLED DRCLSCGKKNPVSFHPL

FEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRL

QDFFTTDPDLEEF EPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKN IEEWGP

FDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA CNPVMIDAIKVSAAHRARYFWGN

LPGMNR RPVMASKNDKLELQDCLEFSRTAK LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELER RIFGFPAHYTDVSNMGRGARQKLLGRS

WSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000103151
Sequence
CACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTAGCC

CGGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGCCGG

AGATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG - UNI14517 

- - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTATCGTTAATGGGAACT

TCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGAGACCAGAG - UNI1

8009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGATGGAGACAGAGATGAT

GAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCCCGGCT GTCCGAACC

CGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGCAGGAGTACCCTGTGG

AGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCATGGAAGAAGTGACAC

CTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAGCAGAGATGGAGACAG

CACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCATGGTGGTGTCCTGGAA

AGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 - ATCTCTGCTGACAA

ACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCACACTCTGGAG AAAGC

CAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCACGGTGGCTTCAAGCCT

ACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCTGAGTCCCCCCCACCC

AAGCGCCTCAAGACAAATAGCTATGGCGGGAAGGACCGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACCAACAACAAGGGCAAT

CTGGAAG ACCGCTGTTTGTCCTGTGGAAAGAAGAACCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGCCGG GATCGCTTCCT

AGAGCTCTTCTACATGTATGATGAGGACGGCTATCAGTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGTAACACAAGCTGCTGC

AG ATGCTTCTGTGTGGAGTGTCTGGAGGTGCTGGTGGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGCTATATGTGCCTCCCT

CAGCGCTGCCATGGGGTCCTCCGACGCAGGAAAGATTGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAGAATTT GAGCCACCC

AAGTTGTACCCAGCAATTCCTGCAGCCAAAAGGAGGCCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTGGTGCTCAAGGAGTTG

GGTATTAAAGTGGAAAAGTACATTGCCTCCGAAGTCTGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCAAATATGTCAATGACG

TCCGGAAAATCACCAAGAAAAAT ATTGAAGAGTGGGGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTAACGTCAATCCTGCCC

GCAAAGGTTTATATG AGGGCACAGGAAGGCTCTTCTTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACAACCGTCCATTCTTCT

GGATGTTCGAGAATGTTGTGGCCATGAAAGTGAATGACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCGATGCCATCAAGGTGT

CTGCTGCTCACAGGGCCCGGTACTTCTGGGGTAACCTACCCGGAATGAACAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACATGGGCC

GCGGCGCCCGTCAGAAGCTGCTGGGCAGGTCCTGGAGTGTACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATAGTTCTA

CCCAGGACTGGGGAGCTCTCGGTCAGAGCCAGTGCCCAGAGTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGGGGCCTC

ACATCACTGTACCTCAGCTTTCTCCTGCTCAGTGGGAGCAGAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTCAGACCT

GGCTGCTTAGAGTAGCCCGGCATGGTGCTCATGTTCTCTTACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTCCTGAGT

TTATCACTCAGAAGTGATGGCTAAGATACCAAAAAAACAAACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTCAGGTTC

ATGCTGCAAAATCACTTGAGATTTTGTTTTTAAGTAACCCGTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAGGTCAAG

GGGCCAAAAAAAATTCCCCCTCTCCCCCCAGGAGTATTTGAAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACAAGGGCT

GAAGTCCTGTTGGTCTTGTAGCATTTCCCAGGATGATGATGTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATGTGGCTA

GTCCTCACGAAGACTGGAGTAGAATGTTTGGAGCTCAGGAAGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTTAGGGAA

ATCCATTCCCCACTCCCTCTTGCCAAATGAGGGGCCCAGTCCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACCAGAAGC

ACATCGTTCCCCTTATCTGAGCAGTGTTTGGGGAACTACAGTGAAAACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAGATTGTGTTTTTAAGG

GGTGCTTTTTTTAGGGGCATCACTGGAGATAAGAAAGCTGCATTTCAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCTAATTACAGGTGCTAT

TTTATAGAAGCAGACAACACTTCTTTTTATGACTCTCAGACTTCTATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTGGGCTTTTGTAACTTC

ACAGGTGTGGGGAGAGACTGCCTTGTTTCAACAGTTTGTCTCCACTGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAGAGTTTACCTTTCTGG

TTGATTAAAGTTGTATTTCTCTATAA
Translation
 - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - G

RRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEF

PATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSWK

ATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPML

EWAHGGFKPTGIEGLKPNKKQPE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNKGNLED DRCLSCGKKNPVSFHPL

FEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRL

QDFFTTDPDLEEF EPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKN IEEWGP

FDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA CNPVMIDAIKVSAAHRARYFWGN

LPGMNR RIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000109772
Sequence
ACTCCCGTGCGCGCCCGGCCCGTAGCGTCCTCGTCGCCGCCCCTCGTCTCGCAGCCGCAGCCCGCGTGGACGCTCTCGCCTGAGCGCCGCGGACTAGCCC

GGGTGGCCCACTGGCGCGCGGGCGAGCGCACGGGCGCTCCAGTCCGGCAGCGCCGGGGTTAAGCGGCCCAAGTAAACGTAGCGCAGCGATCGGCGCCGGA

GATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCCGCGCTACAGCCAGCCTCACGACAG - UNI14517 -

 - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCAGCGGGTATGAGGAGTGCATTATCGTTAATGGGAACTT

CAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCACAGAGCCAGTCTGCACACCAGAGACCAGAG - UNI18

009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACACGCAG GACATGACAGGAGATGGAGACAGAGATGATG

AAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACACCAGGACGCGCTCTGAAAGCCCGGCT GTCCGAACCC

GACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTCGGCAGGGCCGCCACCATGTGCAGGAGTACCCTGTGGA

GTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCATCCCCTGCCAGCGTCGACTTCATGGAAGAAGTGACACC

TAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATACCACACAGGTGGATGCAGAGAGCAGAGATGGAGACAGC

ACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCTGCCATGGTGGTGTCCTGGAAA

GCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAGTTTTCTGAG - UNI4871 - ATCTCTGCTGACAAA

CTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCTTATAGGAAGGCCATGTACCACACTCTGGAG AAAGCC

AGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAGCCCATGCTGGAGTGGGCCCACGGTGGCTTCAAGCCTA

CTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG TGGTTAATAAGTCGAAGGTGCGTCGTTCAGACAGTAGGAACTTAGAACCCAGGAGACGCG

 AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCTGAGTCCCCCCCACCCAAGCGCCTCAAGACAAATAGCTATGGCGGGAAGGACCGAG

GGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACCAACAACAAGGGCAATCTGGAAG ACCGCTGTTTGTCCTGTGGAAAGAAGAACCCT

GTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGCCGG GATCGCTTCCTAGAGCTCTTCTACATGTATGATGAGGACGGCTATCAGTCC

TACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGTAACACAAGCTGCTGCAG ATGCTTCTGTGTGGAGTGTCTGGAGGTGCTGGTGGGC

GCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGCTATATGTGCCTCCCTCAGCGCTGCCATGGGGTCCTCCGACGCAGGAAAGATTGGA

ACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAGAATTT GAGCCACCCAAGTTGTACCCAGCAATTCCTGCAGCCAAAAGGAGGCCCA

TTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTGGTGCTCAAGGAGTTGGGTATTAAAGTGGAAAAGTACATTGCCTCCGAAGTCTGTG

CAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCAAATATGTCAATGACGTCCGGAAAATCACCAAGAAAAAT ATTGAAGAGTGGGGCC

CGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTAACGTCAATCCTGCCCGCAAAGGTTTATATG AGGGCACAGGAAGGCTCTTCTTCG

AGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACAACCGTCCATTCTTCTGGATGTTCGAGAATGTTGTGGCCATGAAAGTGAATGACAA

GAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCGATGCCATCAAGGTGTCTGCTGCTCACAGGGCCCGGTACTTCTGGGGTAACCTACC

CGGAATGAACAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACATGGGCCGCGGCGCCCGTCAGAAGCTGCTGGGCAGGTCCTGGAGTGT

ACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATAGTTCTACCCAGGACTGGGGAGCTCTCGGTCAGAGCCAGTGCCCAGA

GTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGGGGCCTCACATCACTGTACCTCAGCTTTCTCCTGCTCAGTGGGAGCA

GAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTCAGACCTGGCTGCTTAGAGTAGCCCGGCATGGTGCTCATGTTCTCTT

ACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTCCTGAGTTTATCACTCAGAAGTGATGGCTAAGATACCAAAAAAACAA

ACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTCAGGTTCATGCTGCAAAATCACTTGAGATTTTGTTTTTAAGTAACCC

GTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAGGTCAAGGGGCCAAAAAAAATTCCCCCTCTCCCCCCAGGAGTATTTG

AAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACAAGGGCTGAAGTCCTGTTGGTCTTGTAGCATTTCCCAGGATGATGAT

GTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATGTGGCTAGTCCTCACGAAGACTGGAGTAGAATGTTTGGAGCTCAGGA

AGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTTAGGGAAATCCATTCCCCACTCCCTCTTGCCAAATGAGGGGCCCAGT

CCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACCAGAAGCACATCGTTCCCCTTATCTGAGCAGTGTTTGGGGAACTACA

GTGAAAACCTTCTGGAGATGTTAAAAGCTTTTTACCCCACGATAGATTGTGTTTTTAAGGGGTGCTTTTTTTAGGGGCATCACTGGAGATAAGAAAGCTG

CATTTCAGAAATGCCATCGTAATGGTTTTTAAACACCTTTTACCTAATTACAGGTGCTATTTTATAGAAGCAGACAACACTTCTTTTTATGACTCTCAGA

CTTCTATTTTCATGTTACCATTTTTTTTGTAACTCGCAAGGTGTGGGCTTTTGTAACTTCACAGGTGTGGGGAGAGACTGCCTTGTTTCAACAGTTTGTC

TCCACTGGTTTCTAATTTTTAGGTGCAAAGATGACAGATGCCCAGAGTTTACCTTTCTGGTTGATTAAAGTTGTATTTCTCTATAA
Translation
 - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - G

RRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEF

PATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSWK

ATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPML

EWAHGGFKPTGIEGLKPNKKQPV VVNKSKVRRSDSRNLEPRRRE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNKG

NLED DRCLSCGKKNPVSFHPLFEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWSC

YMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEF EPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHEG

QIKYVNDVRKITKKN IEEWGPFDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA C

NPVMIDAIKVSAAHRARYFWGNLPGMNR RIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Transcript ENSMUST00000109771
Sequence
CGGCCCAAGTAAACGTAGCGCAGCGATCGGCGCCGGAGATTCGCGAACCCGACACTCCGCGCCGCCCGCCGGCCAGGACCCGCGGCGCGATCGCGGCGCC

GCGCTACAGCCAGCCTCACGACAG - UNI14517 - - UNI18009 - GAAACAATGAAGGGAGACAGCAGACATCTGAATGAAGAAGAGGGTGCCA

GCGGGTATGAGGAGTGCATTATCGTTAATGGGAACTTCAGTGACCAGTCCTCAGACACGAAGGATGCTCCCTCACCCCCAGTCTTGGAGGCAATCTGCAC

AGAGCCAGTCTGCACACCAGAGACCAGAG - UNI18009 - GCCGCAGGTCAAGCTCCCGGCTGTCTAAGAGGGAGGTCTCCAGCCTTCTGAATTACA

CGCAG GACATGACAGGAGATGGAGACAGAGATGATGAAGTAGATGATGGGAATGGCTCTGATATTCTAATGCCAAAGCTCACCCGTGAGACCAAGGACA

CCAGGACGCGCTCTGAAAGCCCGGCT GTCCGAACCCGACATAGCAATGGGACCTCCAGCTTGGAGAGGCAAAGAGCCTCCCCCAGAATCACCCGAGGTC

GGCAGGGCCGCCACCATGTGCAGGAGTACCCTGTGGAGTTTCCGGCTACCAGG TCTCGGAGACGTCGAGCATCATCTTCAGCAAGCACGCCATGGTCAT

CCCCTGCCAGCGTCGACTTCATGGAAGAAGTGACACCTAAGAGCGTCAGTACCCCATCAGTTGACTTGAGCCAGGATGGAGATCAGGAGGGTATGGATAC

CACACAGGTGGATGCAGAGAGCAGAGATGGAGACAGCACAGAGTATCAG GATGATAAAGAGTTTGGAATAGGTGACCTCGTGTGGGGAAAGATCAAGGG

CTTCTCCTGGTGGCCTGCCATGGTGGTGTCCTGGAAAGCCACCTCCAAGCGACAGGCCATGCCCGGAATGCGCTGGGTACAGTGGTTTGGTGATGGCAAG

TTTTCTGAG - UNI4871 - ATCTCTGCTGACAAACTGGTGGCTCTGGGGCTGTTCAGCCAGCACTTTAATCTGGCTACCTTCAATAAGCTGGTTTCT

TATAGGAAGGCCATGTACCACACTCTGGAG AAAGCCAGGGTTCGAGCTGGCAAGACCTTCTCCAGCAGTCCTGGAGAGTCACTGGAGGACCAGCTGAAG

CCCATGCTGGAGTGGGCCCACGGTGGCTTCAAGCCTACTGGGATCGAGGGCCTCAAACCCAACAAGAAGCAACCAG TGGTTAATAAGTCGAAGGTGCGT

CGTTCAGACAGTAGGAACTTAGAACCCAGGAGACGCG AGAACAAAAGTCGAAGACGCACAACCAATGACTCTGCTGCTTCTGAGTCCCCCCCACCCAAG

CGCCTCAAGACAAATAGCTATGGCGGGAAGGACCGAGGGGAGGATGAGGAGAGCCGAG AACGGATGGCTTCTGAAGTCACCAACAACAAGGGCAATCTG

GAAG ACCGCTGTTTGTCCTGTGGAAAGAAGAACCCTGTGTCCTTCCACCCCCTCTTTGAGGGTGGGCTCTGTCAGAGTTGCCGG GATCGCTTCCTAGA

GCTCTTCTACATGTATGATGAGGACGGCTATCAGTCCTACTGCACCGTGTGCTGTGAGGGCCGTGAACTGCTGCTGTGCAGTAACACAAGCTGCTGCAG 

ATGCTTCTGTGTGGAGTGTCTGGAGGTGCTGGTGGGCGCAGGCACAGCTGAGGATGCCAAGCTGCAGGAACCCTGGAGCTGCTATATGTGCCTCCCTCAG

CGCTGCCATGGGGTCCTCCGACGCAGGAAAGATTGGAACATGCGCCTGCAAGACTTCTTCACTACTGATCCTGACCTGGAAGAATTT CAGGAGCCACCC

AAGTTGTACCCAGCAATTCCTGCAGCCAAAAGGAGGCCCATTAGAGTCCTGTCTCTGTTTGATGGAATTGCAACGG GGTACTTGGTGCTCAAGGAGTTG

GGTATTAAAGTGGAAAAGTACATTGCCTCCGAAGTCTGTGCAGAGTCCATCGCTGTGGGAACTGTTAAGCATGAAGGCCAGATCAAATATGTCAATGACG

TCCGGAAAATCACCAAGAAAAAT ATTGAAGAGTGGGGCCCGTTCGACTTGGTGATTGGTGGAAGCCCATGCAATGATCTCTCTAACGTCAATCCTGCCC

GCAAAGGTTTATATG AGGGCACAGGAAGGCTCTTCTTCGAGTTTTACCACTTGCTGAATTATACCCGCCCCAAGGAGGGCGACAACCGTCCATTCTTCT

GGATGTTCGAGAATGTTGTGGCCATGAAAGTGAATGACAAGAAAGACATCTCAAGATTCCTGGCA TGTAACCCAGTGATGATCGATGCCATCAAGGTGT

CTGCTGCTCACAGGGCCCGGTACTTCTGGGGTAACCTACCCGGAATGAACAG GCCCGTGATGGCTTCAAAGAATGATAAGCTCGAGCTGCAGGACTGCC

TGGAGTTCAGTAGGACAGCAAAG TTAAAGAAAGTGCAGACAATAACCACCAAGTCGAACTCCATCAGACAGGGCAAAAACCAGCTTTTCCCTGTAGTCA

TGAATGGCAAGGACGACGTTTTGTGGTGCACTGAGCTCGAAAG GATCTTCGGCTTCCCTGCTCACTACACGGACGTGTCCAACATGGGCCGCGGCGCCC

GTCAGAAGCTGCTGGGCAGGTCCTGGAGTGTACCGGTCATCAGACACCTGTTTGCCCCCTTGAAGGACTACTTTGCCTGTGAATAGTTCTACCCAGGACT

GGGGAGCTCTCGGTCAGAGCCAGTGCCCAGAGTCACCCCTCCCTGAAGGCACCTCACCTGTCCCCTTTTTAGCTCACCTGTGTGGGGCCTCACATCACTG

TACCTCAGCTTTCTCCTGCTCAGTGGGAGCAGAGCCTCCTGGCCCTTGCAGGGGAGCCCCGGTGCTCCCTCCGTGTGCACAGCTCAGACCTGGCTGCTTA

GAGTAGCCCGGCATGGTGCTCATGTTCTCTTACCCTGAAACTTTAAAACTTGAAGTAGGTAGTAAGATGGCTTTCTTTTACCCTCCTGAGTTTATCACTC

AGAAGTGATGGCTAAGATACCAAAAAAACAAACAAAAACAGAAACAAAAAACAAAAAAAAAACCTCAACAGCTCTCTTAGTACTCAGGTTCATGCTGCAA

AATCACTTGAGATTTTGTTTTTAAGTAACCCGTGCTCCACATTTGCTGGAGGATGCTATTGTGAATGTGGGCTCAGATGAGCAAGGTCAAGGGGCCAAAA

AAAATTCCCCCTCTCCCCCCAGGAGTATTTGAAGATGATGTTTATGGTTTAAGTCTTCCTGGCACCTTCCCCTTGCTTTGGTACAAGGGCTGAAGTCCTG

TTGGTCTTGTAGCATTTCCCAGGATGATGATGTCAGCAGGGATGACATCATCACCTTTAGGGCTTTTCCCTGGCAGGGGCCCATGTGGCTAGTCCTCACG

AAGACTGGAGTAGAATGTTTGGAGCTCAGGAAGGGTGGGTGGAGTGGCCCTCTTCCAGGTGTGAGGGATACGAAGGAGGAAGCTTAGGGAAATCCATTCC

CCACTCCCTCTTGCCAAATGAGGGGCCCAGTCCCCAACAGCTCAGGTCCCCAGAACCCCCTAGTTCCTCATGAGAAGCTAGGACCAGAAGCACATCGTTC

CCC
Translation
 - UNI14517 - - UNI18009 - MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRG - UNI18009 - G

RRSSSRLSKREVSSLLNYTQ DMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPA VRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEF

PATR SRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQ DDKEFGIGDLVWGKIKGFSWWPAMVVSWK

ATSKRQAMPGMRWVQWFGDGKFSE - UNI4871 - ISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLE KARVRAGKTFSSSPGESLEDQLKPML

EWAHGGFKPTGIEGLKPNKKQPV VVNKSKVRRSDSRNLEPRRRE ENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRE ERMASEVTNNKG

NLED DRCLSCGKKNPVSFHPLFEGGLCQSCR DRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCR RCFCVECLEVLVGAGTAEDAKLQEPWSC

YMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEF QEPPKLYPAIPAAKRRPIRVLSLFDGIATG GYLVLKELGIKVEKYIASEVCAESIAVGTVKHE

GQIKYVNDVRKITKKN IEEWGPFDLVIGGSPCNDLSNVNPARKGLYE EGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLA 

CNPVMIDAIKVSAAHRARYFWGNLPGMNR RPVMASKNDKLELQDCLEFSRTAK LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELER RIFG

FPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE

For any suggestions or comments, please send an email to unitrap@crg.es