Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027487 (Cdk5rap1)
Chromosomal location
Chr 2: 154161116 - 154198746 (-)
Description
CDK5 regulatory subunit associated protein 1 Gene [Source:MGI (curated);Acc:Cdk5rap1-001]
RefSeq_dna
NM_025876 
RefSeq_peptide
NP_080152.1 
UniGene
Mm.289427 
MGI
MGI:1914221 
Uniprot/SWISSPROT
Q8BTW8 
Uniprot/SPTREMBL
A2AJD2 Q3UW67 
Human Ortholog
ENSG00000101391 (CDK5RAP1)
Omim not available
UniTrap UNI19581
Vector Insertion
Chr 2: 154196371 - 154196692
Public Clones not available
Private Clones OST388559 (lexicon) OST302571 (lexicon) OST219373 (lexicon) OST177034 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34276
Vector Insertion
Chr 2: 154178925 - 154179947
Public Clones IST11996C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31714
Vector Insertion
Chr 2: 154174386 - 154176610
Public Clones IST10954F12 (tigm) IST12856D1 (tigm) IST14196C9 (tigm) IST14174A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36468
Vector Insertion
Chr 2: 154171601 - 154174518
Public Clones IST12495F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11485
Vector Insertion
Chr 2: 154168178 - 154171601
Public Clones M110C01 (ggtc) M110E04 (ggtc) G049F10 (ggtc) M110D04 (ggtc) IST10224A12 (tigm)
IST11147B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11490
Vector Insertion
Chr 2: 154161354 - 154168036
Public Clones (sanger) P073H02 (ggtc) P075G01 (ggtc) CMHD-GT_259A5-3 (cmhd) CMHD-GT_297B12-3 (cmhd)
CMHD-GT_138D4-3 (cmhd) CMHD-GT_412G8-3 (cmhd) CMHD-GT_542D1-5S (cmhd) CMHD-GT_114E2-3 (cmhd)
CMHD-GT_384H8-3 (cmhd) CMHD-GT_143H2-3 (cmhd) CMHD-GT_112D9-3 (cmhd) CMHD-GT_119.1E2-3 (cmhd)
CMHD-GT_392A1-3 (cmhd) CMHD-GT_461D8-3 (cmhd) CMHD-GT_368B6-3 (cmhd) CMHD-GT_139D8-3 (cmhd)
CMHD-GT_542D1-3 (cmhd) CMHD-GT_107A8-3 (cmhd) CMHD-GT_389A9-3 (cmhd) CMHD-GT_451B7-3 (cmhd)
PSTVUpb15c12 (vanderbilt) PSTVUpb15c11 (vanderbilt) PSTVUpb15g6 (vanderbilt)
PSTVUpb8a5&a6 (vanderbilt) IST12332C8 (tigm) IST12605D3 (tigm) IST13545D11 (tigm)
IST10219C1 (tigm) IST12380E1 (tigm) IST10980C5 (tigm) IST12264H12 (tigm)
IST10718E12 (tigm) IST11208G8 (tigm) IST10374B6 (tigm) IST14707H1 (tigm)
IST11853C2 (tigm) IST10222A10 (tigm) IST11978A11 (tigm) IST12235G5 (tigm)
IST12101B1 (tigm) IST14808A10 (tigm) IST11806D12 (tigm) IST11865E6 (tigm)
IST14961C1 (tigm) IST10896A5 (tigm) IST11207E8 (tigm) IST11842G7 (tigm)
IST10718E5 (tigm)
Private Clones OST464831 (lexicon) OST447926 (lexicon) OST433335 (lexicon) OST431191 (lexicon)
OST424382 (lexicon) OST418171 (lexicon) OST416116 (lexicon) OST405534 (lexicon)
OST401465 (lexicon) OST372172 (lexicon) OST359307 (lexicon) OST356225 (lexicon)
OST352113 (lexicon) OST352106 (lexicon) OST347887 (lexicon) OST336796 (lexicon)
OST334434 (lexicon) OST333491 (lexicon) OST320853 (lexicon) OST294944 (lexicon)
OST285056 (lexicon) OST274314 (lexicon) OST257891 (lexicon) OST256373 (lexicon)
OST247827 (lexicon) OST241228 (lexicon) OST238752 (lexicon) OST217988 (lexicon)
OST208776 (lexicon) OST190764 (lexicon) OST189408 (lexicon) OST182267 (lexicon)
OST172788 (lexicon) OST148116 (lexicon) OST142429 (lexicon) OST136591 (lexicon)
OST111805 (lexicon) OST104436 (lexicon) OST103765 (lexicon) OST103740 (lexicon)
OST85317 (lexicon) OST61707 (lexicon) OST56766 (lexicon) OST48169 (lexicon)
OST38431 (lexicon) OST38150 (lexicon) OST35408 (lexicon) OST31664 (lexicon)
OST29199 (lexicon) OST27466 (lexicon) OST27270 (lexicon) OST26998 (lexicon)
OST26914 (lexicon) OST26060 (lexicon) OST25548 (lexicon) OST20842 (lexicon)
OST19689 (lexicon) OST16953 (lexicon) OST15458 (lexicon) OST15356 (lexicon)
OST13182 (lexicon) OST10320 (lexicon) OST10319 (lexicon) OST9297 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028990
Sequence
AGATCGACAGTTTCCGGTTTCGGACGCGGACCTTGCAGTTGTGGGAG - UNI19581 - ATTTGGGGCTGCAGGTGCCATGCATCCTTTACGGTGTGT

CCTCCAAGTACAGAGGTTGTCAGCACCATTCACCTCCATGTGCTGGGTGTTGCTTAGGACCTGCAGAGCACAAAGCAGTGTGTCCAGCACTCCTTGTCCC

AGTCCAGAGGCGAAGAGCTCAGAAGCTCAGAAGGACTTCAGCTCCAGGCTAGCCACTGGACCGACTTTTCAGCATTTTTTAAGAAGTGCTTCAGTTCCTC

AAGAGAAACCATCTTCTCCAGAGGTGGAGGACCCACCTCCCTATCTCTCGGGGGATGAACTTCTAGGAAGGCAGAGAAAAG - UNI19581 - TCTAC

CTCGAGACCTATGGCTGTCAGATGAACGTGAACGACACAGAGATAGCCTGGTCCATCTTACAGAAGAGTGGCTACCTTCGGACCAGCAACCTCCAAGAG 

GCTGATGTGATCCTTCTTGTCACGTGTTCTATCAG GGAGAAGGCCGAGCAGACCATCTGGAACCGCTTACATCAGCTCAAAGTCCTGAAGACAAAGCGG

CCACGCTCTCGAGTACCTCTGAGGATTGGGATTCTAG GCTGCATGGCTGAGAGGCTGAAGGGAGAGATCCTCAACAGGGAGAAGATGGTAGATCTCTTG

GCTGGTCCAGACGCCTACCGAGACCTTCCCCGGCTGCTGGCTGTGGTGGAGTCAGGTCAGCAAGCAGCAAATGTGCTTCTCTCTCTGGATGAGACCTACG

CAGATATCATGCCAGTCCAGACGAGCCCCAGTGCCACTTCTGCCTTTGT - UNI34276 - ATCCATTATGCGGGGCTGCGACAACATGTGCAGTTAC

TGTATCGTGCCGTTCACGCGTGGCCGGGAGAGGAGCCGGCCAGTTGCCTCCATTCTCGATGAAGTGAGGAAGCTGTCCGAGCAG - UNI34276 - GG

CCTAAAAGAAGTGACACTTCTTGGTCAGAATGTTAATAGTTTTCGGGACAATTCGGAAGTCCAGTTCAATAATGCAGGGTCTGCTAACCTCAGCCGTGGC

TTTACCACCAACTATAAACCCAAACAAGGAGGGCTTCGTTTTTCTCACCTTCTGGATCAGGTTTCAAGAATCGATCCTGAAATGAGGATCCGATTCACCT

CTCCTCACCCCAAGGATTTTCCTGATGAG - UNI34276 - GTTCTTCAGCTGATTCGTGAGAGACACAACATCTGTAAGCAGATCCACCTGCCAGCC

CAGAGTGGAAGCAGCCGTGTACTGGATGCCATGCGGAGAGG - UNI31714 - ATATTCAAGAGAAGCATATGTGGCATTAGTTCATCATGTCAGAGA

GACTATCCCAG - UNI31714 - - UNI36468 - GTGTGAGCCTTAGCAGCGACTTCATCACTGGCTTTTGTGGAGAGACAGAGGATGATCACCGG

CAGACAGTGTCTTTACTTAGAGAAGTGCAGTATAATACCGGTTTTCTCTTTGCATACAGCATGAGGCAA - UNI31714 - - UNI36468 - AAGA

CACGAGCATATCACAGGCTGAAGGATGATGTTCCAGAAGAAGTAAAATTAAGGCGTTTGGAGGAACTCATTACTGTCTTCAGAGAAGAAGCTTCAAAAGC

CAATAAGACCTCAGTGGGTTGTAGCCAGCTGGTACTGGTTGAAGGG - UNI11485 - - UNI36468 - TTCAGCAAACGTTCTACCACAGACCTT

TGTGGCCGGAATGATGCAAACCTTAAGGTGATTTTCCCTGACGCAGAGGTGGAGGATATCACTAACCCTGGGCTCAAGGTCAGAGCTCAACCTGGGGACT

ATGTGCTGGTGAAG - UNI11490 - ATCACCTCTGCCAGCTCTCAGACCCTGAAAGGACACATTCTCTGCAGGACCACTATGAAAGACTCATTGACG

TATTGCACGACCTGAGCTGCTGGATTAGGAGTGGACTTGGGCAGGTTTTTCTCATGCTTTGGAGACATGTAATAGTCTTGAAGCACCTTTGCACCAAATG

GAAGAGTACATTTCTTTGTTGTCGATAGAACAACTGTTACAATAATAAATTTCATAAATTAATGGC
Translation
 - UNI19581 - MHPLRCVLQVQRLSAPFTSMCWVLLRTCRAQSSVSSTPCPSPEAKSSEAQKDFSSRLATGPTFQHFLRSASVPQEKPSSPEVEDPP

PYLSGDELLGRQRKV - UNI19581 - VYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQE ADVILLVTCSIR REKAEQTIWNRLHQLKVLKTKR

PRSRVPLRIGILG GCMAERLKGEILNREKMVDLLAGPDAYRDLPRLLAVVESGQQAANVLLSLDETYADIMPVQTSPSATSAFV - UNI34276 - V

SIMRGCDNMCSYCIVPFTRGRERSRPVASILDEVRKLSEQ - UNI34276 - GLKEVTLLGQNVNSFRDNSEVQFNNAGSANLSRGFTTNYKPKQGGL

RFSHLLDQVSRIDPEMRIRFTSPHPKDFPDE - UNI34276 - VLQLIRERHNICKQIHLPAQSGSSRVLDAMRRG - UNI31714 - GYSREAYV

ALVHHVRETIPG - UNI31714 - - UNI36468 - GVSLSSDFITGFCGETEDDHRQTVSLLREVQYNTGFLFAYSMRQ - UNI31714 - - U

NI36468 - KTRAYHRLKDDVPEEVKLRRLEELITVFREEASKANKTSVGCSQLVLVEG - UNI11485 - - UNI36468 - FSKRSTTDLCGRN

DANLKVIFPDAEVEDITNPGLKVRAQPGDYVLVK - UNI11490 - ITSASSQTLKGHILCRTTMKDSLTYCTT
Transcript ENSMUST00000109731
Sequence
GCACTCAGTGCTCTTAACCGCTGAACCATCTCTCCAGCCCGCCTACCTG CCAGGGTCCTGGGACTCGAAGCCGGCAGGAAACACTACCATTAGAACACC

GCGGGCGAAAGTCACGGCGGAACAGAAGTTGCACGCCTAGGCGCGCAGCGGAGGACTCCTGAGAAGGGAACCCACGCAGATCGACAGTTTCCGGTTTCGG

ACGCGGACCTTGCAGTTGTGGGAG - UNI19581 - ATTTGGGGCTGCAGGTGCCATGCATCCTTTACGGTGTGTCCTCCAAGTACAGAGGTTGTCAG

CACCATTCACCTCCATGTGCTGGGTGTTGCTTAGGACCTGCAGAGCACAAAGCAGTGTGTCCAGCACTCCTTGTCCCAGTCCAGAGGCGAAGAGCTCAGA

AGCTCAGAAGGACTTCAGCTCCAGGCTAGCCACTGGACCGACTTTTCAGCATTTTTTAAGAAGTGCTTCAGTTCCTCAAGAGAAACCATCTTCTCCAGAG

GTGGAGGACCCACCTCCCTATCTCTCGGGGGATGAACTTCTAGGAAGGCAGAGAAAAG - UNI19581 - TCTACCTCGAGACCTATGGCTGTCAGAT

GAACGTGAACGACACAGAGATAGCCTGGTCCATCTTACAGAAGAGTGGCTACCTTCGGACCAGCAACCTCCAAGAG GCTGATGTGATCCTTCTTGTCAC

GTGTTCTATCAG GGAGAAGGCCGAGCAGACCATCTGGAACCGCTTACATCAGCTCAAAGTCCTGAAGACAAAGCGGCCACGCTCTCGAGTACCTCTGAG

GATTGGGATTCTAG GCTGCATGGCTGAGAGGCTGAAGGGAGAGATCCTCAACAGGGAGAAGATGGTAGATCTCTTGGCTGGTCCAGACGCCTACCGAGA

CCTTCCCCGGCTGCTGGCTGTGGTGGAGTCAGGTCAGCAAGCAGCAAATGTGCTTCTCTCTCTGGATGAGACCTACGCAGATATCATGCCAGTCCAGACG

AGCCCCAGTGCCACTTCTGCCTTTGT - UNI34276 - ATCCATTATGCGGGGCTGCGACAACATGTGCAGTTACTGTATCGTGCCGTTCACGCGTGG

CCGGGAGAGGAGCCGGCCAGTTGCCTCCATTCTCGATGAAGTGAGGAAGCTGTCCGAGCAG - UNI34276 - GGCCTAAAAGAAGTGACACTTCTTG

GTCAGAATGTTAATAGTTTTCGGGACAATTCGGAAGTCCAGTTCAATAATGCAGGGTCTGCTAACCTCAGCCGTGGCTTTACCACCAACTATAAACCCAA

ACAAGGAGGGCTTCGTTTTTCTCACCTTCTGGATCAGGTTTCAAGAATCGATCCTGAAATGAGGATCCGATTCACCTCTCCTCACCCCAAGGATTTTCCT

GATGAG - UNI34276 - GTTCTTCAGCTGATTCGTGAGAGACACAACATCTGTAAGCAGATCCACCTGCCAGCCCAGAGTGGAAGCAGCCGTGTACT

GGATGCCATGCGGAGAGG - UNI31714 - ATATTCAAGAGAAGCATATGTGGCATTAGTTCATCATGTCAGAGAGACTATCCCAG - UNI31714 

- - UNI36468 - GTGTGAGCCTTAGCAGCGACTTCATCACTGGCTTTTGTGGAGAGACAGAGGATGATCACCGGCAGACAGTGTCTTTACTTAGAGA

AGTGCAGTATAATACCGGTTTTCTCTTTGCATACAGCATGAGGCAA - UNI31714 - - UNI36468 - AAGACACGAGCATATCACAGGCTGAAG

GATGATGTTCCAGAAGAAGTAAAATTAAGGCGTTTGGAGGAACTCATTACTGTCTTCAGAGAAGAAGCTTCAAAAGCCAATAAGACCTCAGTGGGTTGTA

GCCAGCTGGTACTGGTTGAAGGG - UNI11485 - - UNI36468 - TTCAGCAAACGTTCTACCACAGACCTTTGTGGCCGGAATGATGCAAACCT

TAAGGTGATTTTCCCTGACGCAGAGGTGGAGGATATCACTAACCCTGGGCTCAAGGTCAGAGCTCAACCTGGGGACTATGTGCTGGTGAAG - UNI114

90 - ATCACCTCTGCCAGCTCTCAGACCCTGAAAGGACACATTCTCTGCAGGACCACTATGAAAGACTCATTGACGTATTGCACGACCTGAGCTGCTGG

ATTAGGAGTGGACTTGGGCAGGTTTTTCTCATGCTTTGGAGACATGTAATAGTCTTGAAGCACCTTTGCACCAAATGGAAGAGTACATTTCTTTGTTGTC

GATAGAACAACTGTTACAATAATAAATTTCATAAATTAATGGC
Translation
  - UNI19581 - MHPLRCVLQVQRLSAPFTSMCWVLLRTCRAQSSVSSTPCPSPEAKSSEAQKDFSSRLATGPTFQHFLRSASVPQEKPSSPEVEDP

PPYLSGDELLGRQRKV - UNI19581 - VYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQE ADVILLVTCSIR REKAEQTIWNRLHQLKVLKTK

RPRSRVPLRIGILG GCMAERLKGEILNREKMVDLLAGPDAYRDLPRLLAVVESGQQAANVLLSLDETYADIMPVQTSPSATSAFV - UNI34276 - 

VSIMRGCDNMCSYCIVPFTRGRERSRPVASILDEVRKLSEQ - UNI34276 - GLKEVTLLGQNVNSFRDNSEVQFNNAGSANLSRGFTTNYKPKQGG

LRFSHLLDQVSRIDPEMRIRFTSPHPKDFPDE - UNI34276 - VLQLIRERHNICKQIHLPAQSGSSRVLDAMRRG - UNI31714 - GYSREAY

VALVHHVRETIPG - UNI31714 - - UNI36468 - GVSLSSDFITGFCGETEDDHRQTVSLLREVQYNTGFLFAYSMRQ - UNI31714 - - 

UNI36468 - KTRAYHRLKDDVPEEVKLRRLEELITVFREEASKANKTSVGCSQLVLVEG - UNI11485 - - UNI36468 - FSKRSTTDLCGR

NDANLKVIFPDAEVEDITNPGLKVRAQPGDYVLVK - UNI11490 - ITSASSQTLKGHILCRTTMKDSLTYCTT
Transcript ENSMUST00000109730
Sequence
AGATCGACAGTTTCCGGTTTCGGACGCGGACCTTGCAGTTGTGGGAG - UNI19581 - ATTTGGGGCTGCAGGTGCCATGCATCCTTTACGGTGTGT

CCTCCAAGTACAGAGGTTGTCAGCACCATTCACCTCCATGTGCTGGGTGTTGCTTAGGACCTGCAGAGCACAAAGCAGTGTGTCCAGCACTCCTTGTCCC

AGTCCAGAGGCGAAGAGCTCAGAAGCTCAGAAGGACTTCAGCTCCAGGCTAGCCACTGGACCGACTTTTCAGCATTTTTTAAGAAGTGCTTCAGTTCCTC

AAGAGAAACCATCTTCTCCAGAGGTGGAGGACCCACCTCCCTATCTCTCGGGGGATGAACTTCTAGGAAGGCAGAGAAAAG - UNI19581 - TCTAC

CTCGAGACCTATGGCTGTCAGATGAACGTGAACGACACAGAGATAGCCTGGTCCATCTTACAGAAGAGTGGCTACCTTCGGACCAGCAACCTCCAAGAG 

GCTGATGTGATCCTTCTTGTCACGTGTTCTATCAG GGAGAAGGCCGAGCAGACCATCTGGAACCGCTTACATCAGCTCAAAGTCCTGAAGACAAAGCGG

CCACGCTCTCGAGTACCTCTGAGGATTGGGATTCTAG GACCTGAGTTGGTTTCAACTCCAGCCTCCTGA
Translation
 - UNI19581 - MHPLRCVLQVQRLSAPFTSMCWVLLRTCRAQSSVSSTPCPSPEAKSSEAQKDFSSRLATGPTFQHFLRSASVPQEKPSSPEVEDPP

PYLSGDELLGRQRKV - UNI19581 - VYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQE ADVILLVTCSIR REKAEQTIWNRLHQLKVLKTKR

PRSRVPLRIGILG GPELVSTPAS

For any suggestions or comments, please send an email to unitrap@crg.es