Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027499 (Pkia)
Chromosomal location
Chr 3: 7366604 - 7445366 (+)
Description
protein kinase inhibitor, alpha Gene [Source:MGI Symbol;Acc:MGI:104747]
RefSeq_dna
NM_008862 
RefSeq_peptide
NP_032888.1 
UniGene
Mm.3193 Mm.396663 
MGI
MGI:104747 
Uniprot/SWISSPROT
P63248 
Uniprot/SPTREMBL
Q3UTL0 
Human Ortholog
ENSG00000171033 (PKIA)
Omim not available
UniTrap UNI34179
Vector Insertion
Chr 3: 7366753 - 7437337
Public Clones IST10465H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000028999
Sequence
GATGACTTCATGCAGCCAGCCTGGAGTAGCCAGCGGCCGCTGCAGCTGCAGGTGGGGCGGGGGCCTTGCGAGCCCAGAGCCCAGCACACGCGGCCAGGCG

GGCAGGACTGCAGCCAGGGGCAGCCGGGACGCGTCTCTCCATCCTGAAG - UNI34179 - TCCCTGCTATGTGGATATTTGTTAGCAATGACTGATG

TGGAAACTACGTATGCAGATTTCATTGCTTCAGGAAGAACAGGTAGAAGAAATGCAATACATGATATCCTGGTTTCCTCTGCAAGTGGCAACAGCAATGA

ATTAGCCTTAAAACTAGCAGGCCTTGATATCAACAAGACAG AAGGTGAAGATGATGGACAGAGAAGCTCCACCGAACAAAGTGGAGAAGCCCAGGGAGA

AGCAGCCAAGTCTGAAAGCTAACACTCCATTCTGACGGTCATCAACATCTGACAATGTGGCAAATATCCTGGCGATGCTCGGATGTATTCGCAGCCACGG

GTGAAACGGAGGGGAAGAAAATGGCTGCGCTGCACAGCAAGACACTGTTGGTTGCCATGTCACAAGTGGGGATGGAGCCTGTGTCTGCACACAGCCTTTT

CCCCACCTCTGTCATTAGCAATGGTTGAAATCACCTGGGCTGTGCTTGGATCTCCTTCGTGTATGGGTCCTTCCACTTGACCGTATAATGAAATGCTTGT

AGAGAGTAGCACTGCCTAGCTGATGATTCCTGTGGCATCTGGCCCCTCATGATGTCAGAGGATTTAATTGTGTCTAATTGAAAAGAGTTGGTTGAACCCC

AGAGTTTCAGTATCTCTGGCTGGAGTATTGACTCACAAAAAGAACCATCCAGAGAGCACAGTTAGCATTATGTCCCTGTGTGTGAGTGCTGTTACTTACG

CCGTTTTGTATCGTACAGTACACCTGCTCTGCACTGCCCTTTGATTGCTTACATAAAACAAAATGATGTACATGACTGTGAATTTTTATACCGCTCATTT

TTTAAAGGGCTGCCTTTTTAATTTCCCATAGTGTTGTGGCGTGAACAGGGCAGAACCTTCTTTTGTAAAACACAACTTTCCTCTTGATAACTGCCGAGGG

TTACATCCACTAGACTCACTGAGCCCACTTTGCTTTATTATACAGGCATGTGGAAATATCCATGAATGTGAATATTGCCTGAGTTCAGTCTTAGTATCTA

CACAGACCAGCGTTCTGTCTTTCAATATTGATTTTATTTCCAAATAAGTACTTTCAACTGATACTTTAATTTTTCATTATAAGAATTTTTTTAAGAATCA

ACAAAATAAACAAAGAATGCCAGATAATGCAAAGAGCTAGAAATGTTGTGCTGTGAGGATCACTTTTCTCACACTGCTGGGTGCCACTGTTTAACGCAGG

AGGACAACTTGTGAAGGAAGTGTTTTCCTCAAAGCCTGTGGGCACCCATCTCAAAAGTAAAGCCCTTGTGCTGTGGCCCCTCTCAGCCCTTTCATACCCA

AATGTTGTTATGCACTTTTTAATGTTTGTAAAATTTTACTAATAATTTGTGTGAATTGCATTCAGATATAAAAATTATCACCCAACTACACTTTTACTGA

TGCTGTTGATGGTCTACGCTGTGTTTTGACATCACAATTCTTGTATGGGGAGTTTCTGTGGCCTGTATAACCCTCTCTGGTCAGTATTATGAAACCAACT

ATCTTTGGTAATAAATGAGGATCCAGTTAGATGCCCAAGGTTCACCTGGTGCATCATAGGAGGCAAATAACAGATGAAAGAAGACTTTCTCAACAGAAGA

GCCTCTAAGTGTCCTGGAGCACTAGCATAGCTACAGTTCCAGGTTAAGTAGGTAGAGGTGTTTCAACAGGCAGACCTGGGTACGGTAGGAACTCGACCTG

AGTCTGTAGTTACAGACAAGGTAGACAAGGAAGTCTGCCTATATCTTCCCATAGAGTGCTTTCATTACTGACTGGGAATATATGAATCTCATTTAGTCCC

CAACTGGATGTTTTCCAGAAAAACAAGCACTGTTAAGTATGCCTTTCTGGATATAGAACAGTAAATACATTCAATATGAGAGGCCTTGCTTTGATCTAAG

TCATTGGAGGCTAGCTAAAATTGAAACAAATCTACCTATTGATAGACTCAAAGTTGTGAACCTATGGCCTATTTGAGACAATCTCCGATAATCTATTTAC

AACATCCAACAGTTTCAATGTCCTTGTTTAACTATGCTGATAGCTTTCTTGTGAATAGGAAGATCATTCTTAAAGTTGTGTAATTCCACACTGGTTTCAC

ATGCATTTTGTAAAGTGTTGAACCAGTGCTAAGACTGTGTGGAAGGGTTATACCCCTGTGTCATATACTATTACTAATGCATGCGGTGCCATGCTTGTCT

TTAAATATATAAGTAGTGCTAAATGCAGAAGTCATAGGGAGGTTCTGATTTCATTTGATTTCTTACTGCTACTTGGTGTCCTGTATTCAATCCTAGAGGG

ATTCTGTGGCTGGTAAGGGAAAAGAGATAAACATTCTGAATTTGTCACATCACATAAATTTTAATTGGCAAAAGTGCATAGAATCTCCTGGTTTTCATTT

AATACTTATCATTTGCAAGTAAATAATACTACATAGGGAATGAATCTGTAAATGCAGATGGAAGTGTGGGCAGCCCAAGGAAAGGGGTGTTAGTTAACTA

CCCCAGCTAAGTCACTTCAGAACCAAATGTACCATTCAGTTTCATCTTATGCCCCTTTCACAAATTACAATGTGAACATGAATAAGGACTAATTTTTGCA

AAACTAAAAAGCTAATTTGAGCCCATGTTTATCAACAGAATTTTGAATCCACATTTCATAAAATTTAAGCTAATTACACAGTGTGTTTCTCTGTATGGAA

AACTATAGATAATACACTCAGTCAGCTTGCATTTTACAGAGAAAGAATTTAAGTTACTAAATAGACTAGCCTTTCTTGGGTTTGTACACATGTCTTTGGG

ACAAAGACACATGTGGTTGAGCCTACCTTTTTTTGTTGTTGTTGTTGTTTTAATACTCAATTATAGCTTATTTTGAATTTATTTAAGACATGTAAACTGT

AAATTTACATGCTATGTTCATGCTATGTATGTGAACAAATATTCTTGCTTTTTATTTAATAACCTAGAAACACAAAATTTTCCATTTTAACACATTAACA

ATGAATGAGAAGCTGTAGAATTTGTTGAGCTTAACTTTTTTAAACTAAGAACATTTTATGTTAGTACATATTCATCCTGAATTCACAGAAATGCTTTCTG

CTCTATAACAGAAAATCATGACCTTTATTTTTCAGGAAATACTGACATAGTAGCCCACTGTTCACACCCTACCACTGAGTCTTCCTTAAATGTGACATCA

AGGATCCAATGTAGAATAAAATGACATTTTTATCTCTTCTCAGAGGAATACGAAAAAAATGTAACTGTTGGGCAGCAAACTTCTAAATGAATTCTGCAGT

AGTAAGGGAAAAAAATGTATAGTCATTAAATTAAACGAAGAAAGGATCCATAATTGATTGTGTCTTAGAAGCCTGGAAATGTTCTTTCACTGACTTGTGG

CAGCCTGGGAAGTCATCTGTGAGCTTCTATGACTTTTGTATTTAGCAATGTTGCATGCTCACATAACTGATATTAAAAGCAGCACTTGTTTTCTGAAA
Translation
 - UNI34179 - MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTE EGEDDGQRSSTEQSGEAQGEAAKSES

For any suggestions or comments, please send an email to unitrap@crg.es