Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027500 (Stmn2)
Chromosomal location
Chr 3: 8509521 - 8561604 (+)
Description
stathmin-like 2 Gene [Source:MGI Symbol;Acc:MGI:98241]
RefSeq_dna
NM_025285 
RefSeq_peptide
NP_079561.1 
UniGene
Mm.400075 Mm.409993 
MGI
MGI:98241 
Uniprot/SWISSPROT
P55821 
Uniprot/SPTREMBL
Q545S4 
Human Ortholog
ENSG00000104435 (STMN2)
Omim not available
UniTrap UNI12160
Vector Insertion
Chr 3: 8509520 - 8509631
Public Clones W255B05 (ggtc) Ayu21-T264 (egtc) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI81
Vector Insertion
Chr 3: 8509631 - 8541840
Public Clones GC0347 (tigem) RRJ569 (baygenomics) XG803 (baygenomics) HMA310 (baygenomics)
RRT508 (baygenomics) RRA012 (baygenomics) RRJ526 (baygenomics) RRT509 (baygenomics)
A025E05 (ggtc) PST3205-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27652
Vector Insertion
Chr 3: 8509631 - 8541840
Public Clones (sanger) D142G07 (ggtc) IST14773D7 (tigm) IST15050B7 (tigm) IST14705H1 (tigm)
IST14757B9 (tigm) IST12137H5 (tigm)
Private Clones OST54600 (lexicon) OST45085 (lexicon) OST44548 (lexicon) OST42136 (lexicon)
OST38802 (lexicon) OST33316 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12411
Vector Insertion
Chr 3: 8541937 - 8545572
Public Clones W142C08 (ggtc) W130E04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14132
Vector Insertion
Chr 3: 8545746 - 8554791
Public Clones CMHD-GT_110A8-3 (cmhd)
Private Clones OST336540 (lexicon) OST178346 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116348
Sequence
CCTTCTCCTTTGCCTTCGCCACCACTCCGTGCGTGCACATCCCTACAATGGCTAAAACAGCAATGG - UNI81 - - UNI12160 - - UNI27652

 - CCTACAAGGAAAAAATGAAGGAGCTGTCTATGCTGTCACTGATCTGCTCCTGCTTCTACCCGGAGCCGCGCAACATCAACATCTACACCTACGACG 

- UNI12411 - ACATGGAGGTGAAGCAGATCAACAAGCGGGCCTCTGGCCAGGCTTTTGAGCTGATCTTGAAGCCACCATCTCCCATCTCAGAAGCTC

CACGAACTCTAGCTTCTCCAAAGAAGAAAGACCTGTCTCTGGAGGAGATTCAGAAAAAGCTGGAGGCTGCAGAGGAGCGAAGAAAG - UNI14132 - 

TCTCAAGAGGCTCAGGTGCTGAAGCAGTTGGCAGAGAAGAGGGAGCACGAGCGAGAGGTGCTCCAGAAGGCGCTGGAGGAGAACAACAACTTCAGCAAGA

TGGCGGAGGAGAAGCTGATCCTGAAGATGGAACAGATTAAGGAAAACCGTGAGGCTAATCTAGCTGCTATCATTGAACGTCTGCAGGAAAAG GAGAGGC

ATGCTGCAGAGGTTCGCAGGAACAAGGAACTGCAGGTTGAACTGTCTGGCTGAAGCAATGGCGGGTATGGCAAGCCCCTCCCATAGTAAATCCCCCTGCC

TATATTATAATGGATCATGCGATATCAGTATGGGAAGTGTATGACATGGTTTAAAAAGAACTCATTATGAAAAACAAAACAAAAAACAGAATCAAAAATA

AAATAAAAATCAATGCGGTCTCTTTGCAGAATGTTTTGCTTGATGTTTAAAAAAGTACCTTGGATCTTATTTTGTAAATATTTACATTTTTGTTAAAAAA

TACAAGTATTGCATTATGCAAGTTATTTCATGATCTTACATGTCCTGTAACAGGCTTTTGACGTTGTGTCTTTCCACTCAGATGGATTTGCTAGGTCTGT

TCTTTTGGAAGCCCCACTCAGTCCCTGCCCTTTTCATTCCAACCGAAAAATGAGGTCAGTAGACAGTCTATGGTGCTAGAAACCCACCATTGCCTAATGA

CCTAGATGACTCCGTAATCTCTGAGCGTGACCAAGACCACACCTAGATCGTGGGTACTGTGTGTCCATGTGAACCTCCACATTTGCTCGTAATCTGCTTC

CTGCCTAGAAGCGGCAAAGCCAGGCTAAGGGAATCTACCAGTCATAGCACTTATGTCTGCTCCTCATGGATTACGCGCTACACATGTGTTTGGGTTTTAG

AAACAGGTGCATGTGAAGACAAATCTGAGCTCAGTCAGGGTAGAAGCGAAAGGCTGAACCTTCCAACGTGCTGATCACAAACGCAAAGCCAGAGGGTTCA

AGCAGCCATGGGATTGTTCTTCATGAAGTGGGCTTATTTCTCTCATTTTAGTTATTATGATGGGATGAATTAATTGACATGTCGGGTGGCTTATCTGTGG

GTGCCATGGGTGATGATGTTCATTTTAAGCTTTTGCCTGTAGTACAAGCACATAATGCTACTGAACGTTTTTCCACTTGGAGACTGTGAGCTGGTTGCTG

CATTAAAAACACAAACAAAATCACAAGCACTGTGGACTTTTACTCAAGCTGGTCTTTCTTCCCCAGTGTAGGGCAATCCTGCCTATAAACAAGACCAAAC

CACTCCATCTGTGATGCTGACGCAGTGAAGGGGCCAGGCAGGGCATTTGTGCCAAGTATAAGAATCAGCAGACACCCAGCATACGTACCTATTGCAGTTT

TGAAGTTGTTTCTCCCTAACTCCCAACTCCCAACTCCCAAACTGCCTGCATATTTACTCTTCGTCAGTGCTATCTTCTTGTATGTCATTGTGAGCAAGCT

GTGATGAATAAAGAATTGGAGTTCTGTGAACT
Translation
MAKTAMA - UNI81 - - UNI12160 - - UNI27652 - AYKEKMKELSMLSLICSCFYPEPRNINIYTYDD - UNI12411 - DMEVKQINK

RASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRK - UNI14132 - SQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEE

KLILKMEQIKENREANLAAIIERLQEK ERHAAEVRRNKELQVELSG
Transcript ENSMUST00000029002
Sequence
TTACTCAGACTCCTCTCTCGCTCTCTCCGCGGCTACAGCTGGACCCTTCTCCTTTGCCTTCGCCACCACTCCGTGCGTGCACATCCCTACAATGGCTAAA

ACAGCAATGG - UNI81 - - UNI12160 - - UNI27652 - CCTACAAGGAAAAAATGAAGGAGCTGTCTATGCTGTCACTGATCTGCTCCTGC

TTCTACCCGGAGCCGCGCAACATCAACATCTACACCTACGACG - UNI12411 - ACATGGAGGTGAAGCAGATCAACAAGCGGGCCTCTGGCCAGGC

TTTTGAGCTGATCTTGAAGCCACCATCTCCCATCTCAGAAGCTCCACGAACTCTAGCTTCTCCAAAGAAGAAAGACCTGTCTCTGGAGGAGATTCAGAAA

AAGCTGGAGGCTGCAGAGGAGCGAAGAAAG - UNI14132 - TCTCAAGAGGCTCAGGTGCTGAAGCAGTTGGCAGAGAAGAGGGAGCACGAGCGAGA

GGTGCTCCAGAAGGCGCTGGAGGAGAACAACAACTTCAGCAAGATGGCGGAGGAGAAGCTGATCCTGAAGATGGAACAGATTAAGGAAAACCGTGAGGCT

AATCTAGCTGCTATCATTGAACGTCTGCAGGAAAAG GAGAGGCATGCTGCAGAGGTTCGCAGGAACAAGGAACTGCAGGTTGAACTGTCTGGCTGAAGC

AATGGCGGGTATGGCAAGCCCCTCCCATAGTAAATCCCCCTGCCTATATTATAATGGATCATGCGATATCAGTATGGGAAGTGTATGACATGGTTTAAAA

AGAACTCATTATGAAAAACAAAACAAAAAACAGAATCAAAAATAAAATAAAAATCAATGCGGTCTCTTTGCAGAATGTTTTGCTTGATGTTTAAAAAAGT

ACCTTGGATCTTATTTTGTAAATATTTACATTTTTGTTAAAAAATACAAGTATTGCATTATGCAAGTTATTTCATGATCTTACATGTCCTGTAACAGGCT

TTTGACGTTGTGTCTTTCCACTCAGATGGATTTGCTAGGTCTGTTCTTTTGGAAGCCCCACTCAGTCCCTGCCCTTTTCATTCCAACCGAAAAATGAGGT

CAGTAGACAGTCTATGGTGCTAGAAACCCACCATTGCCTAATGACCTAGATGACTCCGTAATCTCTGAGCGTGACCAAGACCACACCTAGATCGTGGGTA

CTGTGTGTCCATGTGAACCTCCACATTTGCTCGTAATCTGCTTCCTGCCTAGAAGCGGCAAAGCCAGGCTAAGGGAATCTACCAGTCATAGCACTTATGT

CTGCTCCTCATGGATTACGCGCTACACATGTGTTTGGGTTTTAGAAACAGGTGCATGTGAAGACAAATCTGAGCTCAGTCAGGGTAGAAGCGAAAGGCTG

AACCTTCCAACGTGCTGATCACAAACGCAAAGCCAGAGGGTTCAAGCAGCCATGGGATTGTTCTTCATGAAGTGGGCTTATTTCTCTCATTTTAGTTATT

ATGATGGGATGAATTAATTGACATGTCGGGTGGCTTATCTGTGGGTGCCATGGGTGATGATGTTCATTTTAAGCTTTTGCCTGTAGTACAAGCACATAAT

GCTACTGAACGTTTTTCCACTTGGAGACTGTGAGCTGGTTGCTGCATTAAAAACACAAACAAAATCACAAGCACTGTGGACTTTTACTCAAGCTGGTCTT

TCTTCCCCAGTGTAGGGCAATCCTGCCTATAAACAAGACCAAACCACTCCATCTGTGATGCTGACGCAGTGAAGGGGCCAGGCAGGGCATTTGTGCCAAG

TATAAGAATCAGCAGACACCCAGCATACGTACCTATTGCAGTTTTGAAGTTGTTTCTCCCTAACTCCCAACTCCCAACTCCCAAACTGCCTGCATATTTA

CTCTTCGTCAGTGCTATCTTCTTGTATGTCATTGTGAGCAAGCTGTGATGAATAAAGAATTGGAGTTCTGTGAACT
Translation
YSDSSLALSAATAGPFSFAFATTPCVHIPTMAKTAMA - UNI81 - - UNI12160 - - UNI27652 - AYKEKMKELSMLSLICSCFYPEPRNI

NIYTYDD - UNI12411 - DMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRK - UNI14132 - SQEAQVL

KQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEK ERHAAEVRRNKELQVELSG

For any suggestions or comments, please send an email to unitrap@crg.es