Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027502 (2410001C21Rik)
Chromosomal location
Chr 2: 172266090 - 172294367 (+)
Description
RIKEN cDNA 2410001C21 gene Gene [Source:MGI Symbol;Acc:MGI:1913654]
RefSeq_dna
NM_025542 
RefSeq_peptide
NP_079818.1 
UniGene
Mm.25157 
MGI
MGI:1913654 
Uniprot/SWISSPROT
Q99K95 
Uniprot/SPTREMBL
A1L0V7 A2APA0 A4QMY9 Q3TDK9 Q3TEK4 Q4V9T7 
Human Ortholog
ENSG00000022277 (C20orf43)
Omim not available
UniTrap UNI10473
Vector Insertion
Chr 2: 172266240 - 172270146
Public Clones D052G01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI532
Vector Insertion
Chr 2: 172272614 - 172278751
Public Clones CA0045 (sanger) CF0553 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029005
Sequence
GCCAGAGACCCCGGAAGCGACGGCTTCTCGTCTTTGCTAAGGCTTCTGGTTTTTGCTACGGTTTCTGATTTCGGCTTTGGGATGGGTTGCGACGGAGGCA

CCATCCCCAAGAGGCACGAGCTGGTGAAGGGGCCGAAGAAGGTCGAGAAG - UNI10473 - GTTGACAAAGACGCTGAACTGGTAGCCCAATGGAAC

TACTGTACCCTAAGTCAGGAAATCCTGAGGCGCCCAATAGTTGCCTGTGAGCTTGGCAG ACTGTATAACAAAGACGCGGTCATCGAGTTTCTGTTGGAC

AAATCTGCTGAGAAGGCCCTGGGGAAGGCGGCATCGCACATCAGAAGCATCAAG AATGTGACAGAGCTCAGGCTTTCTGACAACCCCGCCTGGGAAGGA

GATAAAGGGAACACCAAGGGCGACAAGCATGATGACCTCCAGAGAGCGCGGTTCATCTGCCCTGTGGTGGGCCTGGAGATGAATGGCCGGCACAG GTTT

TGCTTCCTCCGATGCTGCGGTTGTGTGTTTTCTGAACGCGCCTTGAAGGAGATAAAAGCTGAAGTGTGTCACACG - UNI532 - TGTGGGGCTGCCT

TCCAGGAGGAGGACATCATTGTGCTCAATGGCACCAAGGAGGATGTGGAGATGCTGAAGAAGAGGATGGAGGAGAGGAGGCTGAGGGCCAAGCTGGAAAA

G AAAACAAAGAAACCGAAGACAGCGACCGAGTGTGCGTCAAAGCCGGGTACCACACAAG ATTCCGCAGGGCCATCAAAAGTGAAGTCTGGCAAGCCTG

AGGAGGCGGACCCTGATCCTAGAGAGAAGAAAAGCACCCCGGCTCCCAGGGGCGCAG CAACTAATGGGAGTGCGTCTGGGAAAGTTGGCAAGCCCCCAT

GTGGGGCCCTGAAGAGGTCCATTGCAGACAGCGAGGAGTCTGAAACCTACAAGTCTATCTTCACCAGCCACAGCTCTGCCAAGCGCTCCAAGGAGGAGTC

TGCGCACTGGGTCACCCACACATCCTACTGCTTCTGAAGCGGGACCGGGCCTTCACCCTGGGTTTCCCGTGGCCTTCTGTGCCACACTTGCTTGGTGTGG

CACTGTGCTATAAAGCTGTCCTCTGCAGTC
Translation
MGCDGGTIPKRHELVKGPKKVEK - UNI10473 - VDKDAELVAQWNYCTLSQEILRRPIVACELGR RLYNKDAVIEFLLDKSAEKALGKAASHIRS

IK NVTELRLSDNPAWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHR RFCFLRCCGCVFSERALKEIKAEVCHT - UNI532 - CGAAFQEEDI

IVLNGTKEDVEMLKKRMEERRLRAKLEK KTKKPKTATECASKPGTTQD DSAGPSKVKSGKPEEADPDPREKKSTPAPRGAA ATNGSASGKVGKPPCG

ALKRSIADSEESETYKSIFTSHSSAKRSKEESAHWVTHTSYCF
Transcript ENSMUST00000109132
Sequence
ATGTGTGTGATGTGCCCTCAGGACCATGCTGGGGGCTCTGCGCTGCATTCCTGTCTGACAGCCCTG TGTGGGGCTGCCTTCCAGGAGGAGGACATCATT

GTGCTCAATGGCACCAAGGAGGATGTGGAGATGCTGAAGAAGAGGATGGAGGAGAGGAGGCTGAGGGCCAAGCTGGAAAAG AAAACAAAGAAACCGAAG

ACAGCGACCGAGTGTGCGTCAAAGCCGGGTACCACACAAG ATTCCGCAGGGCCATCAAAAGTGAAGTCTGGCAAGCCTGAGGAGGCGGACCCTGATCCT

AGAGAGAAGAAAAGCACCCCGGCTCCCAGGGGCGCAG CAACTAATGGGAGTGCGTCTGGGAAAGTTGGCAAGCCCCCATGTGGGGCCCTGAAGAGGTCC

ATTGCAGACAGCGAGGAGTCTGAAACCTACAAGTCTATCTTCACCAGCCACAGCTCTGCCAAGCGCTCCAAGGAGGAGTCTGCGCACTGGGTCACCCACA

CATCCTACTGCTTCTGAAGCGGGACCGGGCCTTCACCCTGGGTTTCCCGTGGCCTTCTGTGCCACACTTGCTTGGTGTGGCACTGTGCTATAAAGCTGTC

CTCTGCAGTC
Translation
MCVMCPQDHAGGSALHSCLTAL CGAAFQEEDIIVLNGTKEDVEMLKKRMEERRLRAKLEK KTKKPKTATECASKPGTTQD DSAGPSKVKSGKPEEAD

PDPREKKSTPAPRGAA ATNGSASGKVGKPPCGALKRSIADSEESETYKSIFTSHSSAKRSKEESAHWVTHTSYCF

For any suggestions or comments, please send an email to unitrap@crg.es