Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027508 (Pag1)
Chromosomal location
Chr 3: 9691774 - 9833630 (-)
Description
phosphoprotein associated with glycosphingolipid microdomains 1 Gene [Source:MGI Symbol;Acc:MGI:2443160]
RefSeq_dna
NM_053182 
RefSeq_peptide
NP_444412.2 
UniGene
Mm.214484 
MGI
MGI:2443160 
Uniprot/SWISSPROT
Q3U1F9 
Uniprot/SPTREMBL
A6H659 
Human Ortholog
ENSG00000076641 (PAG1)
Omim not available
UniTrap UNI14949
Vector Insertion
Chr 3: 9787261 - 9833631
Public Clones PST7292-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34326
Vector Insertion
Chr 3: 9752412 - 9787321
Public Clones (sanger) IST12068A11 (tigm) IST12742A5 (tigm) IST15008G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108384
Sequence
GTCATTCTCCGCGGCGCGGCGGCCAGTGCGGACTGCGGTTCCCGCCCGGCGCGCGGGTGCTGTGACTGCTCCTCCGGGGCGGACTGGTGACTCTGCAGCG

CTCTGGAGCCTCTCGTGCGGGGACTCCGTGGTGTCGCATTCCCTCAGAGAGGGAGACACGCACCCGGAGCTCCGAGCACAGCTCTCAAGGGCTGGCGGCC

ACGACGGCGTTTGCTCGGGTTCCCGGTGCAGTCCGAGTCTCTGCGGCCGCCCGGTGCGCCCGGGAGAGCGCACCTCCCCCGGCACGGCAGAACCGAGGCG

ACGAGGATCAGGAGGGTCCTGCGCCCGCTACCACTGCCCACCGCGGGCCAGCCCGGCTGCGAGCAGCGGAGTTGCAGCGCTTTTTAGAGCTCTGGAGCCC

CAGAAGACCTCTGCGAACCA - UNI14949 - - UNI34326 - AACACACTGGGTTCTTCTCTGATTTCCACAGTGGAGCACAACTTCAAAGCTGG

GAGTTG - UNI14949 - - UNI34326 - GCCAAGAAGGAAGAGAGAACCCCAGCATACTGACACGTGAACGAAACCCTCTTCTGGACAACCGTTT

CTCCAAG - UNI34326 - GAGGATGAAGCCTTCTAGACCCATGTGATCTCCTATGAAGAACTGACCCCACCTGCTGGTCACCCCAGCTCCCACCATG

GGCCCTGCAGGAAGCGTACTGAGCAGTGGGCAGATGCAGATGCAGATGGTCCTGTGGGGAAGTCTGGCTGCCGTGGCCATGTTCTTCCTCATCACCTTCC

TCGTCCTCCTGTGTTCCACTTGCGACAG AGAGAAGAAGCCACGGCAGCATAGCGGGGACCATGAGAACCTGATGAATGTG CCTTCCGACAAGGACATG

TTCAGCCATTCGGCAACCAGCCTGACAACAGATGCACTGGCTAGCAGCGAACAGAACGGGGTGCTCACCAATGGCGACA TTCTTTCAGAAGACAGCACG

CTGACCTGCATGCAGCACTATGAGGAAGTCCAGACCTCGGCTTCCGATCTCCTGGACTCCCAGGACAGCACAGGAAAGGCCAAGTGCCACCAGAGCCGGG

AGCTGCCCAGGATCCCGCCTGAGAACGCCGTGGACGAGATTCTCACAGCCAGGGCTGCAGACACGGAACTGGGGCCCGGAGTGGAGGGGCCCTACGAGGT

GCTCAAGGACAGCTCCTCCCAGGAGAACATGGTGGAGGACTGTCTGTATGAAACAGTGAAGGAGATCAAGGAAGTGGCAGACAAAGGCCAGGGTGGCAAG

TCCAAGTCCACTTCTGCCTTGAAGGAGCTTCAGGGGGCTCCCATGGAGGGCAAGGCCGACTTTGCTGAATATGCCTCTGTGGACAGAAACAAAAAGTGCC

GCCACAGCGCGAACGCAGAGAGCATTCTGGGAACTTGCAGTGACCTGGACGAGGAAAGCCCACCTCCTGTCCCGGTTAAGCTTCTGGATGAGAATGCCAA

CCTTCCCCAGGAGGGAGGAGGACAGGCAGAGGAGCAAGCTGCAGAAGGGACCGGTGGACACAGCAAG AGATTTAGTTCCTTGTCATACAAGTCTCGGGA

AGAAGACCCGACTCTTACAGAAGAGGAG ATCTCAGCAATGTATTCCTCAGTGAATAAGCCTGGCCAGTCGGCACACAAACCTGGACCATGTATGAAAGG

GCCAGAATCTGCCTGCCACTCCATGAAGGGCCTCCCTCAGAGGTCGTCATCTTCCTGCAATGACCTCTATGCCACTGTGAAAGACTTTGAGAAAACTCCC

AACAGCATCAGCACACTGCCCCCGGCAAGGAGACCCAGTGAGGAGCCAGAGCCTGACTATGAAGCCATACAGACTCTAAACAGAGAGGATGAGAAGGTCC

CTCTGGAGACCAATGGCCACCATGTCCCCAAGGAGAGTGACTACGAGAGCATTGGGGACTTGCAGCAATGCAGAGATGTCACCAGGCTCTAGCAACTAAA

AGAGGCTGTGATCAGCAGCTCTGCTGTGGAAAGGAGGTGGCTGCAGTTTCTCGCTGCTTTGGTTGACTGAAATCTTCAAGTGCAGTCTCCCAGTTGTCTC

CCAGTTTCCAAAACAGTAAGGTACGGACCTGCCTGCCAGGGCAGCCACCCTCCAGTGCTCCCAAGAAACCCCTGGGACCCCTCACCTCCACATTCCACAG

AGGAAGGCCAGCTGTGGGTGCTGGCGGGGAAGCCCCACCCACCAATGCCAAAATCCCACTGCCTGCTGAAGAAGAGCCAGGTTTCCATCCTTGCTCTCTT

TCCCTCTGCTCCTCATGCTAAAACACTGGCACTTCACCCCTGGAGACCTCCCATGTGTGCTTCATCCCAAGGATGGTCTCCCACTGGCCTGCACTGGCCT

TCAGTAAATGTTAGCATGGAGAGAAACTGGTTGCCGTTAACCCACCCTCTTCCCAGACCTGCCTCTTAGTCCCTGGGAAGGAACCTGGATGTGCAGGCTG

TGAGGTATGGGGTGGGCCGTCCCTGGAGTCTCTGGGGTTCTTGCTCCTCGTTGGACACTGCATCTGCAGTCTTCAGAGGTTCATGAGGTCAGTTGAGATG

TTTTTTAATGTTCTATGTTGAAAACCTTCCCAACAGTGTTTGGATTTTCATAACTACTGTGGTACTTCTGTAGCTGTTCACACCCAGTGCTCTTCCTTCC

AAACAGAGCCTTAATGTTTCTGTGAGGATGGCAGCCATGGTGTCTATCCCCAAAGGGCTGCGGACATAAATGTGTTCCCGGTGGTCTTTGCTGCCCACAT

GTGACTTTCCTATAATCTGATGGTAATCTGAGTAAAATGTAAACATTTATTTTATTATATAAATTTATAAGATGTTTTATGTTTAATGCCTAATTTCTAG

AAAGTGCCAGAAAATATATATTAACTATTTGGATTTTATGTACAACGATTTATACTCTCATTTTACAAACGATACCATAAAGCACATAAGCTAGATAATT

ATAAGCAGTTTTTATTCTTTTCTCTAATGAGTAATATAGCATTGAAGACTTGTTAAGGCTCAACTCCTCAGACAGTACTGGGAGTTCTAGATCCAAAACA

CTGAGGCACTGGTGGCAAAATGCAATGGACATAAATGTGTCACTGCTGAGACACTCGGTGTTATAAATAGAACAAAATCTGACTTGGGAATCCTGAAAGT

ACCAGACTTTCACTGATGTCTAGTGACCCCTCTAAAGACAGCAGTGGCGGTGCCCCCGTTCAGTCTCTGCCGACGCAAATTGCCCGGTTGTTCATCGCTT

CACAGGAATCAGTAGCTGAAGCAGCTCACATTGAAAGTTCAGTCATCGCTCTAGATCTTCCCAGGCCAGCATTGGAAACTCTGTTCACTTTTCATTTTAA

GAGGAGCCTCGCTGAAGTGCAGGACACAGATAAAGAGACAGCCTTTTCTTTCCTACTGCCATGTGGCATCTTATTCTAATGACTTAAGAATCATGCTATT

TTCCTTCCCTGTGATAAAGAGTGTGCGTGGGAAGGTGACATGACCAGCTCTGTGGCCTGTCTTTCCATCCTTGTACTCACCGACTGGTTGTGGATCATGC

CTGTGGAGCTGCAAACTCTCTTGGATGTTGTTGGCATTAGCCTAATCCTCCATGAAGATGGTGGGCACATGGATAAGCATCGCCTCTGCTGGCCCCGCCA

CAGCGGTGGGATACCCCAGGGAACTGGGAGCAGTAATGGGCAAGGCTGTTTGCAACCACTGATTTTCGCTGCTGTGTATTAATGAGTTTGGCCCAACCAT

CTCTCAGGCCACGAGGGTCCCCTCATCACATGCCACTCCCCGTGCCACAGGGCGCTCCTGGACATGTGCTTGCCACCATGCAATTCCTTACAGGCATCGT

ATAGCTCAGGAGTTTGATTATGTTTTATAAAAAGTCTTAGCAGGAAAGCTGGTATGATCTCTAAAGTATAAAACTCTTTTTTTCT
Translation
 - UNI14949 - - UNI34326 -  - UNI14949 - - UNI34326 -  - UNI34326 - MGPAGSVLSSGQMQMQMVLWGSLAAVAMFFLI

TFLVLLCSTCDR REKKPRQHSGDHENLMNV PSDKDMFSHSATSLTTDALASSEQNGVLTNGDI ILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKA

KCHQSRELPRIPPENAVDEILTARAADTELGPGVEGPYEVLKDSSSQENMVEDCLYETVKEIKEVADKGQGGKSKSTSALKELQGAPMEGKADFAEYASV

DRNKKCRHSANAESILGTCSDLDEESPPPVPVKLLDENANLPQEGGGQAEEQAAEGTGGHSK RFSSLSYKSREEDPTLTEEE ISAMYSSVNKPGQSAH

KPGPCMKGPESACHSMKGLPQRSSSSCNDLYATVKDFEKTPNSISTLPPARRPSEEPEPDYEAIQTLNREDEKVPLETNGHHVPKESDYESIGDLQQCRD

VTRL

For any suggestions or comments, please send an email to unitrap@crg.es