Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027523 (Gnas)
Chromosomal location
Chr 2: 174109821 - 174172245 (+)
Description
GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus Gene [Source:MGI (curated);Acc:Gnas-007]
RefSeq_dna
NM_019690 NM_022000 NM_010309 NM_001077507 NM_201617 NM_201616 NM_001077510 
RefSeq_peptide
NP_068840.2 NP_062664.2 NP_034439.2 NP_001070975.1 NP_963911.1 NP_963912.1 NP_963910.1 NP_001070978.1 
UniGene
Mm.125770 
MGI
MGI:95777 
Uniprot/SWISSPROT
Q9Z0F1 Q6R0H7 Q6R0H6 P63094 
Uniprot/SPTREMBL
A6PW69 A6PW70 A6PW71 A2A608 Q9JJ33 Q9QYZ0 A2A607 A2A606 A6PW72 Q6LEA6 Q9JJ21 A2A610 
Human Ortholog
ENSG00000087460 (GNAS)
Omim 102200 - PITUITARY ADENOMA, GROWTH HORMONE-SECRETING  103580 - PSEUDOHYPOPARATHYROIDISM, TYPE IA  114500 - COLORECTAL CANCER  139320 - GNAS COMPLEX LOCUS  166350 - OSSEOUS HETEROPLASIA, PROGRESSIVE  174800 - MCCUNE-ALBRIGHT SYNDROME  219080 - ACTH-INDEPENDENT MACRONODULAR ADRENAL HYPERPLASIA  603233 - PSEUDOHYPOPARATHYROIDISM, TYPE IB  
UniTrap UNI34748
Vector Insertion
Chr 2: 174110979 - 174113991
Public Clones (sanger) IST14389G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15629
Vector Insertion
Chr 2: 174114088 - 174121496
Public Clones (sanger) PST1002-1 (escells)
Private Clones OST190980 (lexicon) OST65618 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109096
Sequence
AGTCTCCTCTATCCTCTCCCAGACGAGAGGATCAGTGGAGGCACCTCTCGGAGTCTTAGACTTCAGAGTCTGAGACTTAGCGAGAGGAGCCTCGAGGAGA

CTCCTTCTCTCTTCTTTACCCATCCCTTTCTTTTACTTACAGCCACAAGCTGAGGCGCGGAGCTTTAGAAAGTTCGCAGTGGTTTGAAG TCCTTGCGCA

GTGGGGCCACTCTCTGCAGAGCCAGAGGGTGAGTCGGCTTCTCGGTGAGCACCTAAGAGAATGGATCGCAGGTCCCGGGCTCAGCAGTGGCGCCGAGCTC

GCCATAATTACAACGACCTGTGCCCGCCCATAGGCCGCCGGGCTGCCACCGCTCTCCTCTGGCTCTCCTGCTCCATTGCTCTCCTCCGCGCCCTAGCCTC

TTCCAACGCCCGCGCCCAGCAGCGTGCTGCCCAGCGCCGGAGCTTCCTTAACGCCCACCACCGCTCCGCTGCCGCTGCAGCTGCCGCACAGGTACTCCCT

GAGTCCTCTGAATCTGAGTCTGATCACGAGCACGAGGAGGTTGAGCCTGAGCTGGCCCGCCCCGAGTGCCTAGAGTACGATCAGGACGACTACGAGACCG

AGACCGATTCTGAGACCGAGCCTGAGTCCGATATCGAATCCGAGACCGAAATCGAGACCGAGCCAGAGACCGAGCCAGAAACCGAGCCAGAGACCGAGCC

AGAGGACGAGCGCGGCCCCCGGGGTGCCACCTTCAACCAGTCACTCACTCAGCGTCTGCACGCTCTGAAGTTGCAGAGCGCCGACGCCTCCCCGAGACGT

GCGCAGCCCACCACTCAGGAGCCTGAGAGCGCAAGCGAGGGGGAGGAGCCCCAGCGAGGGCCCTTAGATCAGGATCCTCGGGACCCCGAGGAGGAGCCAG

AGGAGCGCAAGGAGGAAAACAGGCAGCCCCGCCGCTGCAAGACCAGGAGGCCAGCCCGCCGTCGCGACCAGTCCCCGGAGTCCCCTCCCAGAAAGGGGCC

CATCCCCATCCGGCGTCACTAATGGGTGACTCCGTCCAGATTCTCCTTGTTTTCATGGATAAAG - UNI15629 - - UNI34748 - GTGCTGGAG

AGTCTGGCAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCA

ACAGCGATGG TGAGAAGGCCACTAAAGTGCAGGACATCAAAAACAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGCAACCTGGTGCCC

CCTGTGGAGCTGGCCAACCCTGAGAACCAGTTCAGAGTGGACTACATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT GAATTCTATGAG

CATGCCAAGGCTCTGTGGGAGGATGAGGGAGTGCGTGCCTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA CTTCCTGGACAAG

ATTGATGTGATCAAGCAGGCCGACTACGTGCCAAGTGACCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACCAAGTTCCAGGTG

GACAAAGTCAACTTCCA CATGTTCGATGTGGGCGGCCAGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCCATCATCTTCGTG

GTGGCCAGCAGCAGCTACAACATGGTCATTCGGGAGGACAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAG A

TGGCTGCGCACCATCTCTGTGATTCTCTTCCTCAACAAGCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGGACTACTTTCCAG

AGTTCGCTCGCTACACCACTCCTGAGGATG CGACTCCCGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGGATGAGTTTCTG 

AGAATCAGCACTGCTAGTGGAGATGGGCGCCACTACTGCTACCCTCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCTTCAACGACTGCC

GTGACATCATCCAGCGCATGCATCTCCGCCAATACGAGCTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTAATTAAGAGTGAA

ACGTAATTGTACAAGCAGTTGGTCACCCACCATAGGGCATGATCAACACCGCAACCTTTCCTTTTTCCCCCAGTGATTCTGAAAAACCCCTCTTCCCTTC

AGCTTGCTTAGATGTTCCAAATTTAGTAAGCTTAAGGCGGCCTACAGAAGAAAAAGAAAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAATAAA

ATAAAAGCAGCAACAGAAATAAAGAAATAAATGAAATTCAAAATGAAATAAATATTGTGTTGTGCAGCATT
Translation
 MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRRSFLNAHHRSAAAAAAAQVLPESSESESDHEHEEVEPELA

RPECLEYDQDDYETETDSETEPESDIESETEIETEPETEPETEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPESASEGEEPQR

GPLDQDPRDPEEEPEERKEENRQPRRCKTRRPARRRDQSPESPPRKGPIPIRRH - UNI15629 - - UNI34748 -           
Transcript ENSMUST00000076093
Sequence
AGTCTCCTCTATCCTCTCCCAGACGAGAGGATCAGTGGAGGCACCTCTCGGAGTCTTAGACTTCAGAGTCTGAGACTTAGCGAGAGGAGCCTCGAGGAGA

CTCCTTCTCTCTTCTTTACCCATCCCTTTCTTTTACTTACAGCCACAAGCTGAGGCGCGGAGCTTTAGAAAGTTCGCAGTGGTTTGAAG TCCTTGCGCA

GTGGGGCCACTCTCTGCAGAGCCAGAGGGTGAGTCGGCTTCTCGGTGAGCACCTAAGAGAATGGATCGCAGGTCCCGGGCTCAGCAGTGGCGCCGAGCTC

GCCATAATTACAACGACCTGTGCCCGCCCATAGGCCGCCGGGCTGCCACCGCTCTCCTCTGGCTCTCCTGCTCCATTGCTCTCCTCCGCGCCCTAGCCTC

TTCCAACGCCCGCGCCCAGCAGCGTGCTGCCCAGCGCCGGAGCTTCCTTAACGCCCACCACCGCTCCGCTGCCGCTGCAGCTGCCGCACAGGTACTCCCT

GAGTCCTCTGAATCTGAGTCTGATCACGAGCACGAGGAGGTTGAGCCTGAGCTGGCCCGCCCCGAGTGCCTAGAGTACGATCAGGACGACTACGAGACCG

AGACCGATTCTGAGACCGAGCCTGAGTCCGATATCGAATCCGAGACCGAAATCGAGACCGAGCCAGAGACCGAGCCAGAAACCGAGCCAGAGACCGAGCC

AGAGGACGAGCGCGGCCCCCGGGGTGCCACCTTCAACCAGTCACTCACTCAGCGTCTGCACGCTCTGAAGTTGCAGAGCGCCGACGCCTCCCCGAGACGT

GCGCAGCCCACCACTCAGGAGCCTGAGAGCGCAAGCGAGGGGGAGGAGCCCCAGCGAGGGCCCTTAGATCAGGATCCTCGGGACCCCGAGGAGGAGCCAG

AGGAGCGCAAGGAGGAAAACAGGCAGCCCCGCCGCTGCAAGACCAGGAGGCCAGCCCGCCGTCGCGACCAGTCCCCGGAGTCCCCTCCCAGAAAGGGGCC

CATCCCCATCCGGCGTCACTAATGGGTGACTCCGTCCAGATTCTCCTTGTTTTCATGGATAAAG - UNI15629 - - UNI34748 - GTGCTGGAG

AGTCTGGCAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCA

ACAGCGATGG AGTCTATTACCCCCACTAGATGATGGCTACAGTCCTCCATCTTCGCTATGTCCTACCCCAGTTATCCCAATTTGCATGCTGGAATTGCC

CGGTCTTAGGAAACTACTAATAAGAATACTATTCTGTTTTCCTGGGGATGGGGGGGGGTGGGGGAGGGGGGAGGGGTCCCTAACCTAACCTTTAGGCGTA

AGTTAAAAACAGAAAGATGGGATGAAGTCTTTAATTGGCAACAGCATAGTAGAACAGCAATCAGAAAAGGCATCGATATATTGATAATCTACTGTACCAA

AAGTTGGCATCCGAGAAGTGTGGCAAGCCCCTACTGAGAGAGCCTCCTATATATTGTGTGCTGTGCTAACCCCTTCAACCTTACTAATACCTGCACGTCT

TTCTTCCTATGACTCTACAAGTAAAAATAACTATTAACGCTCCTGATAAATAAAACTCTCTGCATGTTTCAGCAA
Translation
 MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRRSFLNAHHRSAAAAAAAQVLPESSESESDHEHEEVEPELA

RPECLEYDQDDYETETDSETEPESDIESETEIETEPETEPETEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPESASEGEEPQR

GPLDQDPRDPEEEPEERKEENRQPRRCKTRRPARRRDQSPESPPRKGPIPIRRH - UNI15629 - - UNI34748 -   
Transcript ENSMUST00000109095
Sequence
AGTCTCCTCTATCCTCTCCCAGACGAGAGGATCAGTGGAGGCACCTCTCGGAGTCTTAGACTTCAGAGTCTGAGACTTAGCGAGAGGAGCCTCGAGGAGA

CTCCTTCTCTCTTCTTTACCCATCCCTTTCTTTTACTTACAGCCACAAGCTGAGGCGCGGAGCTTTAGAAAGTTCGCAGTGGTTTGAAG TCCTTGCGCA

GTGGGGCCACTCTCTGCAGAGCCAGAGGGTGAGTCGGCTTCTCGGTGAGCACCTAAGAGAATGGATCGCAGGTCCCGGGCTCAGCAGTGGCGCCGAGCTC

GCCATAATTACAACGACCTGTGCCCGCCCATAGGCCGCCGGGCTGCCACCGCTCTCCTCTGGCTCTCCTGCTCCATTGCTCTCCTCCGCGCCCTAGCCTC

TTCCAACGCCCGCGCCCAGCAGCGTGCTGCCCAGCGCCGGAGCTTCCTTAACGCCCACCACCGCTCCGCTGCCGCTGCAGCTGCCGCACAGGTACTCCCT

GAGTCCTCTGAATCTGAGTCTGATCACGAGCACGAGGAGGTTGAGCCTGAGCTGGCCCGCCCCGAGTGCCTAGAGTACGATCAGGACGACTACGAGACCG

AGACCGATTCTGAGACCGAGCCTGAGTCCGATATCGAATCCGAGACCGAAATCGAGACCGAGCCAGAGACCGAGCCAGAAACCGAGCCAGAGACCGAGCC

AGAGGACGAGCGCGGCCCCCGGGGTGCCACCTTCAACCAGTCACTCACTCAGCGTCTGCACGCTCTGAAGTTGCAGAGCGCCGACGCCTCCCCGAGACGT

GCGCAGCCCACCACTCAGGAGCCTGAGAGCGCAAGCGAGGGGGAGGAGCCCCAGCGAGGGCCCTTAGATCAGGATCCTCGGGACCCCGAGGAGGAGCCAG

AGGAGCGCAAGGAGGAAAACAGGCAGCCCCGCCGCTGCAAGACCAGGAGGCCAGCCCGCCGTCGCGACCAGTCCCCGGAGTCCCCTCCCAGAAAGGGGCC

CATCCCCATCCGGCGTCACTAATGGGTGACTCCGTCCAGATTCTCCTTGTTTTCATGGATAAAG - UNI34748 - CCTTTTATCCTCTGGGATTGCT

TACAACCTTTGACTCTTTAGCCTACATTTTAGCAGCTGTGTCCCCTTAACGAGAAACTTGAAACATCAGAACTG - UNI15629 - GGTCCTGCAGGC

CAGACCTGCCCACTGCCTAGCTGTATTGCAACAAAAGACAATGCCTCGCGCCATCGCCATTACCTACTGGCAAAATGTCCGCGGTGTGCGCGTGCCGCGG

GCGCGCGGCAAAACAAAAAAAAACAGAACCCCAAAGGCAAACAATTAACAAAAAAACCCTGCCCAGGAATAATCTGCAGATCCCAGACCTAAAGCATTTT

ATGATTATTCGCTGAGCCCACCGGGCAATGTGACTGTATAAACTCCTGCAGCTCTGAGCCCACCCCGGCACCGCAAGGGGCGCGCAGCCGCAGGCTTTGT

GACCGCGCTTAATTTCGCCTGGGTGGACTGTTGCAGTTCAACGTATAGCAAATGCTCTATGGTGCTCACAACAGAAGGAGGAGGGGATAAAAGGGGGCTG

GAGAAGGGCTTGAGAGAGGAAATGAACACGGAATCCGCAGCTGGCGCTGGTGGCTGGAAGATGCGAGTCTCGGCAGCTGTTGCCACCATGGCACGGTTGG

TCGGTGGGTTAAGTGCATTTCAGGTTTTCTAGTCTGCGAGACCACCCTAAATGGGCCATCAACTACACCCCAAATCTCCTTTTGCCTTTACCCAGAAGAC

AGAAGTACAAGACCTGAGCTAGGTGGGGGGTCTTCCGGTAAGCCTTAAGCCCCCTCCCCTATTTGCACGAAAGCGGCAAACATGAATAACTCCTAAGGGG

GCTTTGCTTGATTTTCTGCAGTGCACTGCTGAGACCTTTATTTCTACTGCATCACCGTCCATATAAACAGAGCAAGCCCTGACTACAACACACTATACCA

CTGTTGAGAGCTCCGAGGTGTAATGGGGATGGGGGACATTGAAGGGATTTGCTGGAGCCATCCCCAACAAACAGCAAACATAAACATT
Translation
 MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRRSFLNAHHRSAAAAAAAQVLPESSESESDHEHEEVEPELA

RPECLEYDQDDYETETDSETEPESDIESETEIETEPETEPETEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPESASEGEEPQR

GPLDQDPRDPEEEPEERKEENRQPRRCKTRRPARRRDQSPESPPRKGPIPIRRH - UNI34748 -  - UNI15629 - 
Transcript ENSMUST00000069396
Sequence
ATGGGTGACTCCGTCCAGATTCTCCTTGTTTTCATGGATAAAG - UNI15629 - - UNI34748 - GTGCTGGAGAGTCTGGCAAAAGCACCATTG

TGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGG TGAGAAGGCC

ACTAAAGTGCAGGACATCAAAAACAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCTGTGGAGCTGGCCAACCCT

GAGAACCAGTTCAGAGTGGACTACATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT GAATTCTATGAGCATGCCAAGGCTCTGTGGGAG

GATGAGGGAGTGCGTGCCTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA CTTCCTGGACAAGATTGATGTGATCAAGCAGGCC

GACTACGTGCCAAGTGACCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCA CAT

GTTCGATGTGGGCGGCCAGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAAC

ATGGTCATTCGGGAGGACAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAG ATGGCTGCGCACCATCTCTGTG

ATTCTCTTCCTCAACAAGCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGGACTACTTTCCAGAGTTCGCTCGCTACACCACTC

CTGAGGATG CGACTCCCGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGGATGAGTTTCTG AGAATCAGCACTGCTAGTGGA

GATGGGCGCCACTACTGCTACCCTCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCTTCAACGACTGCCGTGACATCATCCAGCGCATGC

ATCTCCGCCAATACGAGCTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTAATTAAGAGTGAAACGTAATTGTACAAGCAGTTG

GTCACCCACCATAGGGCATGATCAACACCGCAACCTTTCCTTTTTCCCCCAGTGATTCTGAAAAACCCCTCTTCCCTTCAGCTTGCTTAGATGTTCCAAA

TTTAGTAAGCTTAAGGCGGCCTACAGAAGAAAAAGAAAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAATAAAATAAAAGCAGCAACAGAAATA

AAGAAATAAATGAAATTCAAAATGAAATAAATATTGTGTTGTGCAGCATT
Translation
MGDSVQILLVFMDKG - UNI15629 - - UNI34748 - GAGESGKSTIVKQMRILHVNGFNGE EGGEEDPQAARSNSDG GEKATKVQDIKNNLK

EAIE TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPP EFYEHAKALWEDEGVRACYERSNEYQLIDCAQY YFLDKIDVIKQADYVPSDQ 

DLLRCRVLTSGIFETKFQVDKVNFH HMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR RWLRTISVILFL

NKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDA ATPEPGEDPRVTRAKYFIRDEFL RISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHL

RQYELL
Transcript ENSMUST00000080493
Sequence
GTTATGGGCATGTTCAACTGCCTCCACGGCAATAATATGTCAGGACAACACGATATCCCCCCTGAAGTCGGGGAGCAGCCCGAGCAAGAACCTTTGGAAG

CCCCAGGGGCAGCTGCCCCCGGTGCTGGGGCTGGCCCAGCCGAAGAAATGGCGACCGAACCGGACTCCGAACCGTCTAACAATGAGCCCGTCCCCGACGA

GACTGGCAGTGAGATCAGTGGACCCCCAGAAGACTCCAAATCTGACATCCAAAGCCCCTGCCAGGCCTTCGAGGAAGTCCGAGTGGGTGGAGACTACAGC

CCACCTCCGGAGGAAGCCATGCCATTCGAGACACAACAGCCCAGCCTGGGAGATTTCTGGCCCACCCTGGAGCAGCCAGGACCATCTGGGACCCCATCAG

GCCTCCAAGCCTTCAACCCAGCGATTTTGGAGCCCGGGACCCCCACTGGCGCGAGCCCAGGCCTGGGAGCCTATACCCCCCCACCAGAAGAAGCTATGCC

ATTTGAGTTCAACGAGCCTGCCCAGGGAGACCATAGCCAGCCTCCCTTGCAAGTCCCAGACCTTGCGCCAGGAGGTCCGGAAGCATTGGTCCCCAGAGCT

CTTCCCGCGGAGCCCGGGAACATCAGATTTGAAAACGCTGGCTTCCGAGAAGACTACAGCCCTCCCCCTGAAGAATCTGTGCCATTTCAGGTCGGTGGAG

AAGAATTCGGGGGCGATAGCCCACCCCCAGGACTCCCGCGAGTCATCCCACAAATCGGCATTGGCGGCGAGTTCCCGACAGTCGCGGTCCCGAGTGCGCT

CTGCCTCGCTCCCGCCGAGAACGCGCCTCCCCTCTGGGTCCGAGGCGCCATTGACAGACCATTCCGCGAGGCTGTCAGATCTCCTCCTAACTTCGCATGC

GACAGCCCCCCGATGGAGATCACCAGACCCCTGCTTGAGATTGGCAGAGCCTCCATTGGGGTCGACGACGACACCGCTGTCAATATGGACAGCCCCCCAA

TCGCAAGTGATGGCCCGCCCATCGAAGTCTCGGGAGCCCCAGATAAGAGCGAGTGCGCAGAGAGACCCCCAGTTGAGCGAGAAGCAGCCGAGATGGAAGG

AAGCCCTACCACCGCCACTGCGGTGGAAGGAAAAGTCCCCTCTCCGGAGAGAGGGGACGGATCTTCCACCCAGCCTGAAGCAATGGATGCCAAGCCAGCC

CCTGCTGCCCAAGCCGTCTCTACCGGATCTGATGCTGGAGCTCCTACGGATTCCGCGATGCTCACAGATAGCCAGAGCGATGCCGGAGAAGACGGGACAG

CCCCAGGAACGCCTTCAGATCTCCAGTCGGATCCTGAAGAACTCGAAGAAGCCCCAGCTGTCCGCGCCGATCCTGACGGAGGGGCAGCCCCAGTCGCCCC

AGCCACTCCTGCCGAGTCCGAGTCTGAAGGCAGCAGAGATCCAGCCGCCGAGCCAGCCTCCGAGGCAGTCCCTGCCACCACGGCCGAGTCTGCCTCCGGG

GCAGCCCCTGTCACCCAGGTGGAGCCCGCAGCCGCGGCAGTCTCTGCCACCCTGGCGGAGCCTGCCGCCCGGGCAGCCCCTATCACCCCCAAGGAGCCCA

CTACCCGGGCAGTCCCCTCTGCTAGAGCCCATCCGGCCGCTGGAGCAGTCCCTGGCGCCCCAGCAATGTCAGCCTCTGCTAGGGCAGCTGCCGCTAGGGC

AGCCTATGCAGGTCCACTGGTCTGGGGAGCCAGGTCACTCTCAGCTACTCCCGCCGCTCGGGCATCCCTTCCTGCCCGCGCAGCAGCTGCCGCCCGGGCA

GCCTCTGCTGCCCGCGCAGTCGCTGCTGGCCGGTCAGCCTCTGCCGCCCCCAGCAGGGCCCATCTTAGACCCCCCAGCCCCGAGATCCAGGTTGCTGACC

CGCCTACTCCGCGGCCTCCTCCGCGGCCGACTGCCTGGCCTGACAAGTACGAGCGGGGCCGAAGCTGCTGCAGGTACGAGGCATCGTCTGGCATCTGCGA

GATCGAGTCCTCCAGTGATGAGTCGGAAGAAGGGGCCACCGGCTGCTTCCAGTGGCTTCTGCGGCGAAACCGCCGCCCTGGCCTGCCCCGGAGCCACACG

GTCGGGAGCAACCCAGTCCGCAACTTCTTCACCCGAGCCTTCGGAAGCTGCTTCGGTCTATCCGAGTGTACCCGATCACGATCCCTCAGCCCCGGGAAGG

CCAAGGATCCTATGGAGGAGAGGCGCAAACAGATGCGCAAAGAAGCCATTGAGATGCGAGAGCAGAAGCGCGCAGATAAGAAACGCAGCAAGCTCATCGA

CAAGCAACTGGAGGAGGAGAAGATGGACTACATGTGTACACACCGCCTGCTGCTTCTAG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGAT

GAGGATCCTGCATGTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGG TGAGAAGGCCACTAAAGTGC

AGGACATCAAAAACAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCTGTGGAGCTGGCCAACCCTGAGAACCAGT

TCAGAGTGGACTACATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT GAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAGGGAG

TGCGTGCCTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA CTTCCTGGACAAGATTGATGTGATCAAGCAGGCCGACTACGTGC

CAAGTGACCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCA CATGTTCGATGTG

GGCGGCCAGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATTC

GGGAGGACAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAG ATGGCTGCGCACCATCTCTGTGATTCTCTTCC

TCAACAAGCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGGACTACTTTCCAGAGTTCGCTCGCTACACCACTCCTGAGGATG 

CGACTCCCGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGGATGAGTTTCTG AGAATCAGCACTGCTAGTGGAGATGGGCGCC

ACTACTGCTACCCTCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCTTCAACGACTGCCGTGACATCATCCAGCGCATGCATCTCCGCCA

ATACGAGCTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTAATTAAGAGTGAAACGTAATTGTACAAGCAGTTGGTCACCCACC

ATAGGGCATGATCAACACCGCAACCTTTCCTTTTTCCCCCAGTGATTCTGAAAAACCCCTCTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGTAAGC

TTAAGGCGGCCTACAGAAGAAAAAGAAAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAATAAAATAAAAGCAGCAACAGAAATAAAGAAATAAA

TGAAATTCAAAATGAAATAAATATTGTGTTGTGCAGCATT
Translation
MGMFNCLHGNNMSGQHDIPPEVGEQPEQEPLEAPGAAAPGAGAGPAEEMATEPDSEPSNNEPVPDETGSEISGPPEDSKSDIQSPCQAFEEVRVGGDYSP

PPEEAMPFETQQPSLGDFWPTLEQPGPSGTPSGLQAFNPAILEPGTPTGASPGLGAYTPPPEEAMPFEFNEPAQGDHSQPPLQVPDLAPGGPEALVPRAL

PAEPGNIRFENAGFREDYSPPPEESVPFQVGGEEFGGDSPPPGLPRVIPQIGIGGEFPTVAVPSALCLAPAENAPPLWVRGAIDRPFREAVRSPPNFACD

SPPMEITRPLLEIGRASIGVDDDTAVNMDSPPIASDGPPIEVSGAPDKSECAERPPVEREAAEMEGSPTTATAVEGKVPSPERGDGSSTQPEAMDAKPAP

AAQAVSTGSDAGAPTDSAMLTDSQSDAGEDGTAPGTPSDLQSDPEELEEAPAVRADPDGGAAPVAPATPAESESEGSRDPAAEPASEAVPATTAESASGA

APVTQVEPAAAAVSATLAEPAARAAPITPKEPTTRAVPSARAHPAAGAVPGAPAMSASARAAAARAAYAGPLVWGARSLSATPAARASLPARAAAAARAA

SAARAVAAGRSASAAPSRAHLRPPSPEIQVADPPTPRPPPRPTAWPDKYERGRSCCRYEASSGICEIESSSDESEEGATGCFQWLLRRNRRPGLPRSHTV

GSNPVRNFFTRAFGSCFGLSECTRSRSLSPGKAKDPMEERRKQMRKEAIEMREQKRADKKRSKLIDKQLEEEKMDYMCTHRLLLLG GAGESGKSTIVKQ

MRILHVNGFNGE EGGEEDPQAARSNSDG GEKATKVQDIKNNLKEAIE TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPP EFYEHAKAL

WEDEGVRACYERSNEYQLIDCAQY YFLDKIDVIKQADYVPSDQ DLLRCRVLTSGIFETKFQVDKVNFH HMFDVGGQRDERRKWIQCFNDVTAIIFVV

ASSSYNMVIREDNQTNRLQEALNLFKSIWNNR RWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDA ATPEPGEDPRVTRAKYFIRDE

FL RISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
Transcript ENSMUST00000087876
Sequence
GTTATGGGCATGTTCAACTGCCTCCACGGCAATAATATGTCAGGACAACACGATATCCCCCCTGAAGTCGGGGAGCAGCCCGAGCAAGAACCTTTGGAAG

CCCCAGGGGCAGCTGCCCCCGGTGCTGGGGCTGGCCCAGCCGAAGAAATGGCGACCGAACCGGACTCCGAACCGTCTAACAATGAGCCCGTCCCCGACGA

GACTGGCAGTGAGATCAGTGGACCCCCAGAAGACTCCAAATCTGACATCCAAAGCCCCTGCCAGGCCTTCGAGGAAGTCCGAGTGGGTGGAGACTACAGC

CCACCTCCGGAGGAAGCCATGCCATTCGAGACACAACAGCCCAGCCTGGGAGATTTCTGGCCCACCCTGGAGCAGCCAGGACCATCTGGGACCCCATCAG

GCCTCCAAGCCTTCAACCCAGCGATTTTGGAGCCCGGGACCCCCACTGGCGCGAGCCCAGGCCTGGGAGCCTATACCCCCCCACCAGAAGAAGCTATGCC

ATTTGAGTTCAACGAGCCTGCCCAGGGAGACCATAGCCAGCCTCCCTTGCAAGTCCCAGACCTTGCGCCAGGAGGTCCGGAAGCATTGGTCCCCAGAGCT

CTTCCCGCGGAGCCCGGGAACATCAGATTTGAAAACGCTGGCTTCCGAGAAGACTACAGCCCTCCCCCTGAAGAATCTGTGCCATTTCAGGTCGGTGGAG

AAGAATTCGGGGGCGATAGCCCACCCCCAGGACTCCCGCGAGTCATCCCACAAATCGGCATTGGCGGCGAGTTCCCGACAGTCGCGGTCCCGAGTGCGCT

CTGCCTCGCTCCCGCCGAGAACGCGCCTCCCCTCTGGGTCCGAGGCGCCATTGACAGACCATTCCGCGAGGCTGTCAGATCTCCTCCTAACTTCGCATGC

GACAGCCCCCCGATGGAGATCACCAGACCCCTGCTTGAGATTGGCAGAGCCTCCATTGGGGTCGACGACGACACCGCTGTCAATATGGACAGCCCCCCAA

TCGCAAGTGATGGCCCGCCCATCGAAGTCTCGGGAGCCCCAGATAAGAGCGAGTGCGCAGAGAGACCCCCAGTTGAGCGAGAAGCAGCCGAGATGGAAGG

AAGCCCTACCACCGCCACTGCGGTGGAAGGAAAAGTCCCCTCTCCGGAGAGAGGGGACGGATCTTCCACCCAGCCTGAAGCAATGGATGCCAAGCCAGCC

CCTGCTGCCCAAGCCGTCTCTACCGGATCTGATGCTGGAGCTCCTACGGATTCCGCGATGCTCACAGATAGCCAGAGCGATGCCGGAGAAGACGGGACAG

CCCCAGGAACGCCTTCAGATCTCCAGTCGGATCCTGAAGAACTCGAAGAAGCCCCAGCTGTCCGCGCCGATCCTGACGGAGGGGCAGCCCCAGTCGCCCC

AGCCACTCCTGCCGAGTCCGAGTCTGAAGGCAGCAGAGATCCAGCCGCCGAGCCAGCCTCCGAGGCAGTCCCTGCCACCACGGCCGAGTCTGCCTCCGGG

GCAGCCCCTGTCACCCAGGTGGAGCCCGCAGCCGCGGCAGTCTCTGCCACCCTGGCGGAGCCTGCCGCCCGGGCAGCCCCTATCACCCCCAAGGAGCCCA

CTACCCGGGCAGTCCCCTCTGCTAGAGCCCATCCGGCCGCTGGAGCAGTCCCTGGCGCCCCAGCAATGTCAGCCTCTGCTAGGGCAGCTGCCGCTAGGGC

AGCCTATGCAGGTCCACTGGTCTGGGGAGCCAGGTCACTCTCAGCTACTCCCGCCGCTCGGGCATCCCTTCCTGCCCGCGCAGCAGCTGCCGCCCGGGCA

GCCTCTGCTGCCCGCGCAGTCGCTGCTGGCCGGTCAGCCTCTGCCGCCCCCAGCAGGGCCCATCTTAGACCCCCCAGCCCCGAGATCCAGGTTGCTGACC

CGCCTACTCCGCGGCCTCCTCCGCGGCCGACTGCCTGGCCTGACAAGTACGAGCGGGGCCGAAGCTGCTGCAGGTACGAGGCATCGTCTGGCATCTGCGA

GATCGAGTCCTCCAGTGATGAGTCGGAAGAAGGGGCCACCGGCTGCTTCCAGTGGCTTCTGCGGCGAAACCGCCGCCCTGGCCTGCCCCGGAGCCACACG

GTCGGGAGCAACCCAGTCCGCAACTTCTTCACCCGAGCCTTCGGAAGCTGCTTCGGTCTATCCGAGTGTACCCGATCACGATCCCTCAGCCCCGGGAAGG

CCAAGGATCCTATGGAGGAGAGGCGCAAACAGATGCGCAAAGAAGCCATTGAGATGCGAGAGCAGAAGCGCGCAGATAAGAAACGCAGCAAGCTCATCGA

CAAGCAACTGGAGGAGGAGAAGATGGACTACATGTGTACACACCGCCTGCTGCTTCTAG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGAT

GAGGATCCTGCATGTTAATGGGTTTAACGGAGA TAGTGAGAAGGCCACTAAAGTGCAGGACATCAAAAACAACCTGAAGGAGGCCATTGAA ACCATTG

TGGCCGCCATGAGCAACCTGGTGCCCCCTGTGGAGCTGGCCAACCCTGAGAACCAGTTCAGAGTGGACTACATTCTGAGCGTGATGAACGTGCCGAACTT

TGACTTCCCACCT GAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAGGGAGTGCGTGCCTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGA

CTGTGCCCAGTA CTTCCTGGACAAGATTGATGTGATCAAGCAGGCCGACTACGTGCCAAGTGACCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTG

GAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCA CATGTTCGATGTGGGCGGCCAGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCA

ATGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATTCGGGAGGACAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCT

CTTCAAGAGCATCTGGAACAACAG ATGGCTGCGCACCATCTCTGTGATTCTCTTCCTCAACAAGCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAA

ATCGAAGATTGAGGACTACTTTCCAGAGTTCGCTCGCTACACCACTCCTGAGGATG CGACTCCCGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAA

GTACTTCATTCGGGATGAGTTTCTG AGAATCAGCACTGCTAGTGGAGATGGGCGCCACTACTGCTACCCTCACTTTACCTGCGCCGTGGACACTGAGAA

CATCCGCCGTGTCTTCAACGACTGCCGTGACATCATCCAGCGCATGCATCTCCGCCAATACGAGCTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGC

CTTAAGCACAATTAATTAAGAGTGAAACGTAATTGTACAAGCAGTTGGTCACCCACCATAGGGCATGATCAACACCGCAACCTTTCCTTTTTCCCCCAGT

GATTCTGAAAAACCCCTCTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGTAAGCTTAAGGCGGCCTACAGAAGAAAAAGAAAAAAAAGGCCACAAAA

GTTCCCTCTCACTTTCAGTAAATAAAATAAAAGCAGCAACAGAAATAAAGAAATAAATGAAATTCAAAATGAAATAAATATTGTGTTGTGCAGCATT
Translation
MGMFNCLHGNNMSGQHDIPPEVGEQPEQEPLEAPGAAAPGAGAGPAEEMATEPDSEPSNNEPVPDETGSEISGPPEDSKSDIQSPCQAFEEVRVGGDYSP

PPEEAMPFETQQPSLGDFWPTLEQPGPSGTPSGLQAFNPAILEPGTPTGASPGLGAYTPPPEEAMPFEFNEPAQGDHSQPPLQVPDLAPGGPEALVPRAL

PAEPGNIRFENAGFREDYSPPPEESVPFQVGGEEFGGDSPPPGLPRVIPQIGIGGEFPTVAVPSALCLAPAENAPPLWVRGAIDRPFREAVRSPPNFACD

SPPMEITRPLLEIGRASIGVDDDTAVNMDSPPIASDGPPIEVSGAPDKSECAERPPVEREAAEMEGSPTTATAVEGKVPSPERGDGSSTQPEAMDAKPAP

AAQAVSTGSDAGAPTDSAMLTDSQSDAGEDGTAPGTPSDLQSDPEELEEAPAVRADPDGGAAPVAPATPAESESEGSRDPAAEPASEAVPATTAESASGA

APVTQVEPAAAAVSATLAEPAARAAPITPKEPTTRAVPSARAHPAAGAVPGAPAMSASARAAAARAAYAGPLVWGARSLSATPAARASLPARAAAAARAA

SAARAVAAGRSASAAPSRAHLRPPSPEIQVADPPTPRPPPRPTAWPDKYERGRSCCRYEASSGICEIESSSDESEEGATGCFQWLLRRNRRPGLPRSHTV

GSNPVRNFFTRAFGSCFGLSECTRSRSLSPGKAKDPMEERRKQMRKEAIEMREQKRADKKRSKLIDKQLEEEKMDYMCTHRLLLLG GAGESGKSTIVKQ

MRILHVNGFNGD DSEKATKVQDIKNNLKEAIE TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPP EFYEHAKALWEDEGVRACYERSNEY

QLIDCAQY YFLDKIDVIKQADYVPSDQ DLLRCRVLTSGIFETKFQVDKVNFH HMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTN

RLQEALNLFKSIWNNR RWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDA ATPEPGEDPRVTRAKYFIRDEFL RISTASGDGRHYC

YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
Transcript ENSMUST00000109089
Sequence
ATGGGCATGTTCAACTGCCTCCACGGCAATAATATGTCAGGACAACACGATATCCCCCCTGAAGTCGGGGAGCAGCCCGAGCAAGAACCTTTGGAAGCCC

CAGGGGCAGCTGCCCCCGGTGCTGGGGCTGGCCCAGCCGAAGAAATGGCGACCGAACCGGACTCCGAACCGTCTAACAATGAGCCCGTCCCCGACGAGAC

TGGCAGTGAGATCAGTGGACCCCCAGAAGACTCCAAATCTGACATCCAAAGCCCCTGCCAGGCCTTCGAGGAAGTCCGAGTGGGTGGAGACTACAGCCCA

CCTCCGGAGGAAGCCATGCCATTCGAGACACAACAGCCCAGCCTGGGAGATTTCTGGCCCACCCTGGAGCAGCCAGGACCATCTGGGACCCCATCAGGCC

TCCAAGCCTTCAACCCAGCGATTTTGGAGCCCGGGACCCCCACTGGCGCGAGCCCAGGCCTGGGAGCCTATACCCCCCCACCAGAAGAAGCTATGCCATT

TGAGTTCAACGAGCCTGCCCAGGGAGACCATAGCCAGCCTCCCTTGCAAGTCCCAGACCTTGCGCCAGGAGGTCCGGAAGCATTGGTCCCCAGAGCTCTT

CCCGCGGAGCCCGGGAACATCAGATTTGAAAACGCTGGCTTCCGAGAAGACTACAGCCCTCCCCCTGAAGAATCTGTGCCATTTCAGGTCGGTGGAGAAG

AATTCGGGGGCGATAGCCCACCCCCAGGACTCCCGCGAGTCATCCCACAAATCGGCATTGGCGGCGAGTTCCCGACAGTCGCGGTCCCGAGTGCGCTCTG

CCTCGCTCCCGCCGAGAACGCGCCTCCCCTCTGGGTCCGAGGCGCCATTGACAGACCATTCCGCGAGGCTGTCAGATCTCCTCCTAACTTCGCATGCGAC

AGCCCCCCGATGGAGATCACCAGACCCCTGCTTGAGATTGGCAGAGCCTCCATTGGGGTCGACGACGACACCGCTGTCAATATGGACAGCCCCCCAATCG

CAAGTGATGGCCCGCCCATCGAAGTCTCGGGAGCCCCAGATAAGAGCGAGTGCGCAGAGAGACCCCCAGTTGAGCGAGAAGCAGCCGAGATGGAAGGAAG

CCCTACCACCGCCACTGCGGTGGAAGGAAAAGTCCCCTCTCCGGAGAGAGGGGACGGATCTTCCACCCAGCCTGAAGCAATGGATGCCAAGCCAGCCCCT

GCTGCCCAAGCCGTCTCTACCGGATCTGATGCTGGAGCTCCTACGGATTCCGCGATGCTCACAGATAGCCAGAGCGATGCCGGAGAAGACGGGACAGCCC

CAGGAACGCCTTCAGATCTCCAGTCGGATCCTGAAGAACTCGAAGAAGCCCCAGCTGTCCGCGCCGATCCTGACGGAGGGGCAGCCCCAGTCGCCCCAGC

CACTCCTGCCGAGTCCGAGTCTGAAGGCAGCAGAGATCCAGCCGCCGAGCCAGCCTCCGAGGCAGTCCCTGCCACCACGGCCGAGTCTGCCTCCGGGGCA

GCCCCTGTCACCCAGGTGGAGCCCGCAGCCGCGGCAGTCTCTGCCACCCTGGCGGAGCCTGCCGCCCGGGCAGCCCCTATCACCCCCAAGGAGCCCACTA

CCCGGGCAGTCCCCTCTGCTAGAGCCCATCCGGCCGCTGGAGCAGTCCCTGGCGCCCCAGCAATGTCAGCCTCTGCTAGGGCAGCTGCCGCTAGGGCAGC

CTATGCAGGTCCACTGGTCTGGGGAGCCAGGTCACTCTCAGCTACTCCCGCCGCTCGGGCATCCCTTCCTGCCCGCGCAGCAGCTGCCGCCCGGGCAGCC

TCTGCTGCCCGCGCAGTCGCTGCTGGCCGGTCAGCCTCTGCCGCCCCCAGCAGGGCCCATCTTAGACCCCCCAGCCCCGAGATCCAGGTTGCTGACCCGC

CTACTCCGCGGCCTCCTCCGCGGCCGACTGCCTGGCCTGACAAGTACGAGCGGGGCCGAAGCTGCTGCAGGTACGAGGCATCGTCTGGCATCTGCGAGAT

CGAGTCCTCCAGTGATGAGTCGGAAGAAGGGGCCACCGGCTGCTTCCAGTGGCTTCTGCGGCGAAACCGCCGCCCTGGCCTGCCCCGGAGCCACACGGTC

GGGAGCAACCCAGTCCGCAACTTCTTCACCCGAGCCTTCGGAAGCTGCTTCGGTCTATCCGAGTGTACCCGATCACGATCCCTCAGCCCCGGGAAGGCCA

AGGATCCTATGGAGGAGAGGCGCAAACAGATGCGCAAAGAAGCCATTGAGATGCGAGAGCAGAAGCGCGCAGATAAGAAACGCAGCAAGCTCATCGACAA

GCAACTGGAGGAGGAGAAGATGGACTACATGTGTACACACCGCCTGCTGCTTCTAG GGAGAAAAGTGGTGCCGAGCGACACTGAGGGTCGTTACCGGCC

GGAGGCCAGCGCCAGCGCCAGCGATCGTAGGCTGGACAGGCGGGGGCGTGAG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGATGAGGATC

CTGCATGTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGG TGAGAAGGCCACTAAAGTGCAGGACAT

CAAAAACAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCTGTGGAGCTGGCCAACCCTGAGAACCAGTTCAGAGT

GGACTACATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT GAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAGGGAGTGCGTGC

CTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA CTTCCTGGACAAGATTGATGTGATCAAGCAGGCCGACTACGTGCCAAGTGA

CCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCA CATGTTCGATGTGGGCGGCC

AGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATTCGGGAGGA

CAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAG ATGGCTGCGCACCATCTCTGTGATTCTCTTCCTCAACAA

GCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGGACTACTTTCCAGAGTTCGCTCGCTACACCACTCCTGAGGATG CGACTCC

CGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGGATGAGTTTCTG AGAATCAGCACTGCTAGTGGAGATGGGCGCCACTACTG

CTACCCTCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCTTCAACGACTGCCGTGACATCATCCAGCGCATGCATCTCCGCCAATACGAG

CTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTAATTAAGAGTGAAACGTAATTGTACAAGCAGTTGGTCACCCACCATAGGGC

ATGATCAACACCGCAACCTTTCCTTTTTCCCCCAGTGATTCTGAAAAACCCCTCTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGTAAGCTTAAGGC

GGCCTACAGAAGAAAAAGAAAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAATAAAATAAAAGCAGCAACAGAAATAAAGAAATAAATGAAATT

CAAAATGAAATAAATATTGTGTTGTGCAGCATT
Translation
MGMFNCLHGNNMSGQHDIPPEVGEQPEQEPLEAPGAAAPGAGAGPAEEMATEPDSEPSNNEPVPDETGSEISGPPEDSKSDIQSPCQAFEEVRVGGDYSP

PPEEAMPFETQQPSLGDFWPTLEQPGPSGTPSGLQAFNPAILEPGTPTGASPGLGAYTPPPEEAMPFEFNEPAQGDHSQPPLQVPDLAPGGPEALVPRAL

PAEPGNIRFENAGFREDYSPPPEESVPFQVGGEEFGGDSPPPGLPRVIPQIGIGGEFPTVAVPSALCLAPAENAPPLWVRGAIDRPFREAVRSPPNFACD

SPPMEITRPLLEIGRASIGVDDDTAVNMDSPPIASDGPPIEVSGAPDKSECAERPPVEREAAEMEGSPTTATAVEGKVPSPERGDGSSTQPEAMDAKPAP

AAQAVSTGSDAGAPTDSAMLTDSQSDAGEDGTAPGTPSDLQSDPEELEEAPAVRADPDGGAAPVAPATPAESESEGSRDPAAEPASEAVPATTAESASGA

APVTQVEPAAAAVSATLAEPAARAAPITPKEPTTRAVPSARAHPAAGAVPGAPAMSASARAAAARAAYAGPLVWGARSLSATPAARASLPARAAAAARAA

SAARAVAAGRSASAAPSRAHLRPPSPEIQVADPPTPRPPPRPTAWPDKYERGRSCCRYEASSGICEIESSSDESEEGATGCFQWLLRRNRRPGLPRSHTV

GSNPVRNFFTRAFGSCFGLSECTRSRSLSPGKAKDPMEERRKQMRKEAIEMREQKRADKKRSKLIDKQLEEEKMDYMCTHRLLLLG GRKVVPSDTEGRY

RPEASASASDRRLDRRGRE VLESLAKAPL          
Transcript ENSMUST00000087877
Sequence
GTTATGGGCATGTTCAACTGCCTCCACGGCAATAATATGTCAGGACAACACGATATCCCCCCTGAAGTCGGGGAGCAGCCCGAGCAAGAACCTTTGGAAG

CCCCAGGGGCAGCTGCCCCCGGTGCTGGGGCTGGCCCAGCCGAAGAAATGGCGACCGAACCGGACTCCGAACCGTCTAACAATGAGCCCGTCCCCGACGA

GACTGGCAGTGAGATCAGTGGACCCCCAGAAGACTCCAAATCTGACATCCAAAGCCCCTGCCAGGCCTTCGAGGAAGTCCGAGTGGGTGGAGACTACAGC

CCACCTCCGGAGGAAGCCATGCCATTCGAGACACAACAGCCCAGCCTGGGAGATTTCTGGCCCACCCTGGAGCAGCCAGGACCATCTGGGACCCCATCAG

GCCTCCAAGCCTTCAACCCAGCGATTTTGGAGCCCGGGACCCCCACTGGCGCGAGCCCAGGCCTGGGAGCCTATACCCCCCCACCAGAAGAAGCTATGCC

ATTTGAGTTCAACGAGCCTGCCCAGGGAGACCATAGCCAGCCTCCCTTGCAAGTCCCAGACCTTGCGCCAGGAGGTCCGGAAGCATTGGTCCCCAGAGCT

CTTCCCGCGGAGCCCGGGAACATCAGATTTGAAAACGCTGGCTTCCGAGAAGACTACAGCCCTCCCCCTGAAGAATCTGTGCCATTTCAGGTCGGTGGAG

AAGAATTCGGGGGCGATAGCCCACCCCCAGGACTCCCGCGAGTCATCCCACAAATCGGCATTGGCGGCGAGTTCCCGACAGTCGCGGTCCCGAGTGCGCT

CTGCCTCGCTCCCGCCGAGAACGCGCCTCCCCTCTGGGTCCGAGGCGCCATTGACAGACCATTCCGCGAGGCTGTCAGATCTCCTCCTAACTTCGCATGC

GACAGCCCCCCGATGGAGATCACCAGACCCCTGCTTGAGATTGGCAGAGCCTCCATTGGGGTCGACGACGACACCGCTGTCAATATGGACAGCCCCCCAA

TCGCAAGTGATGGCCCGCCCATCGAAGTCTCGGGAGCCCCAGATAAGAGCGAGTGCGCAGAGAGACCCCCAGTTGAGCGAGAAGCAGCCGAGATGGAAGG

AAGCCCTACCACCGCCACTGCGGTGGAAGGAAAAGTCCCCTCTCCGGAGAGAGGGGACGGATCTTCCACCCAGCCTGAAGCAATGGATGCCAAGCCAGCC

CCTGCTGCCCAAGCCGTCTCTACCGGATCTGATGCTGGAGCTCCTACGGATTCCGCGATGCTCACAGATAGCCAGAGCGATGCCGGAGAAGACGGGACAG

CCCCAGGAACGCCTTCAGATCTCCAGTCGGATCCTGAAGAACTCGAAGAAGCCCCAGCTGTCCGCGCCGATCCTGACGGAGGGGCAGCCCCAGTCGCCCC

AGCCACTCCTGCCGAGTCCGAGTCTGAAGGCAGCAGAGATCCAGCCGCCGAGCCAGCCTCCGAGGCAGTCCCTGCCACCACGGCCGAGTCTGCCTCCGGG

GCAGCCCCTGTCACCCAGGTGGAGCCCGCAGCCGCGGCAGTCTCTGCCACCCTGGCGGAGCCTGCCGCCCGGGCAGCCCCTATCACCCCCAAGGAGCCCA

CTACCCGGGCAGTCCCCTCTGCTAGAGCCCATCCGGCCGCTGGAGCAGTCCCTGGCGCCCCAGCAATGTCAGCCTCTGCTAGGGCAGCTGCCGCTAGGGC

AGCCTATGCAGGTCCACTGGTCTGGGGAGCCAGGTCACTCTCAGCTACTCCCGCCGCTCGGGCATCCCTTCCTGCCCGCGCAGCAGCTGCCGCCCGGGCA

GCCTCTGCTGCCCGCGCAGTCGCTGCTGGCCGGTCAGCCTCTGCCGCCCCCAGCAGGGCCCATCTTAGACCCCCCAGCCCCGAGATCCAGGTTGCTGACC

CGCCTACTCCGCGGCCTCCTCCGCGGCCGACTGCCTGGCCTGACAAGTACGAGCGGGGCCGAAGCTGCTGCAGGTACGAGGCATCGTCTGGCATCTGCGA

GATCGAGTCCTCCAGTGATGAGTCGGAAGAAGGGGCCACCGGCTGCTTCCAGTGGCTTCTGCGGCGAAACCGCCGCCCTGGCCTGCCCCGGAGCCACACG

GTCGGGAGCAACCCAGTCCGCAACTTCTTCACCCGAGCCTTCGGAAGCTGCTTCGGTCTATCCGAGTGTACCCGATCACGATCCCTCAGCCCCGGGAAGG

CCAAGGATCCTATGGAGGAGAGGCGCAAACAGATGCGCAAAGAAGCCATTGAGATGCGAGAGCAGAAGCGCGCAGATAAGAAACGCAGCAAGCTCATCGA

CAAGCAACTGGAGGAGGAGAAGATGGACTACATGTGTACACACCGCCTGCTGCTTCTAG GGAGAAAAGTGGTGCCGAGCGACACTGAGGGTCGTTACCG

GCCGGAGGCCAGCGCCAGCGCCAGCGATCGTAGGCTGGACAGGCGGGGGCGTGAGGTGAGCCCAGAACTGCTGGGGTGGGCCCTTCGGGGCTCCCCCGGC

TCGATTGTTCGTGACCGCGGTGGGCTAGGGCCATCCGGGTGCGCGCCCCCGCCTCGCCTGGCACGGCTGCTTCGACTCAGACAGCTTGTTGTTGGTGTGT

GTTGGTGTCCATTTTCTGTGTTCGCCTGTGCATGACATGCTCAGTGTGTCCCAGTATCCATCCCAGGCACTTTCAACGTACCCGCCGATTTTATATTTGT

ACTCTAAAATAGGTTACCTTGTGATTTGCGCC
Translation
MGMFNCLHGNNMSGQHDIPPEVGEQPEQEPLEAPGAAAPGAGAGPAEEMATEPDSEPSNNEPVPDETGSEISGPPEDSKSDIQSPCQAFEEVRVGGDYSP

PPEEAMPFETQQPSLGDFWPTLEQPGPSGTPSGLQAFNPAILEPGTPTGASPGLGAYTPPPEEAMPFEFNEPAQGDHSQPPLQVPDLAPGGPEALVPRAL

PAEPGNIRFENAGFREDYSPPPEESVPFQVGGEEFGGDSPPPGLPRVIPQIGIGGEFPTVAVPSALCLAPAENAPPLWVRGAIDRPFREAVRSPPNFACD

SPPMEITRPLLEIGRASIGVDDDTAVNMDSPPIASDGPPIEVSGAPDKSECAERPPVEREAAEMEGSPTTATAVEGKVPSPERGDGSSTQPEAMDAKPAP

AAQAVSTGSDAGAPTDSAMLTDSQSDAGEDGTAPGTPSDLQSDPEELEEAPAVRADPDGGAAPVAPATPAESESEGSRDPAAEPASEAVPATTAESASGA

APVTQVEPAAAAVSATLAEPAARAAPITPKEPTTRAVPSARAHPAAGAVPGAPAMSASARAAAARAAYAGPLVWGARSLSATPAARASLPARAAAAARAA

SAARAVAAGRSASAAPSRAHLRPPSPEIQVADPPTPRPPPRPTAWPDKYERGRSCCRYEASSGICEIESSSDESEEGATGCFQWLLRRNRRPGLPRSHTV

GSNPVRNFFTRAFGSCFGLSECTRSRSLSPGKAKDPMEERRKQMRKEAIEMREQKRADKKRSKLIDKQLEEEKMDYMCTHRLLLLG GRKVVPSDTEGRY

RPEASASASDRRLDRRGREVSPELLGWALRGSPGSIVRDRGGLGPSGCAPPPRLARLLRLRQLVVGVCWCPFSVFACA
Transcript ENSMUST00000109088
Sequence
GTTATGGGCATGTTCAACTGCCTCCACGGCAATAATATGTCAGGACAACACGATATCCCCCCTGAAGTCGGGGAGCAGCCCGAGCAAGAACCTTTGGAAG

CCCCAGGGGCAGCTGCCCCCGGTGCTGGGGCTGGCCCAGCCGAAGAAATGGCGACCGAACCGGACTCCGAACCGTCTAACAATGAGCCCGTCCCCGACGA

GACTGGCAGTGAGATCAGTGGACCCCCAGAAGACTCCAAATCTGACATCCAAAGCCCCTGCCAGGCCTTCGAGGAAGTCCGAGTGGGTGGAGACTACAGC

CCACCTCCGGAGGAAGCCATGCCATTCGAGACACAACAGCCCAGCCTGGGAGATTTCTGGCCCACCCTGGAGCAGCCAGGACCATCTGGGACCCCATCAG

GCCTCCAAGCCTTCAACCCAGCGATTTTGGAGCCCGGGACCCCCACTGGCGCGAGCCCAGGCCTGGGAGCCTATACCCCCCCACCAGAAGAAGCTATGCC

ATTTGAGTTCAACGAGCCTGCCCAGGGAGACCATAGCCAGCCTCCCTTGCAAGTCCCAGACCTTGCGCCAGGAGGTCCGGAAGCATTGGTCCCCAGAGCT

CTTCCCGCGGAGCCCGGGAACATCAGATTTGAAAACGCTGGCTTCCGAGAAGACTACAGCCCTCCCCCTGAAGAATCTGTGCCATTTCAGGTCGGTGGAG

AAGAATTCGGGGGCGATAGCCCACCCCCAGGACTCCCGCGAGTCATCCCACAAATCGGCATTGGCGGCGAGTTCCCGACAGTCGCGGTCCCGAGTGCGCT

CTGCCTCGCTCCCGCCGAGAACGCGCCTCCCCTCTGGGTCCGAGGCGCCATTGACAGACCATTCCGCGAGGCTGTCAGATCTCCTCCTAACTTCGCATGC

GACAGCCCCCCGATGGAGATCACCAGACCCCTGCTTGAGATTGGCAGAGCCTCCATTGGGGTCGACGACGACACCGCTGTCAATATGGACAGCCCCCCAA

TCGCAAGTGATGGCCCGCCCATCGAAGTCTCGGGAGCCCCAGATAAGAGCGAGTGCGCAGAGAGACCCCCAGTTGAGCGAGAAGCAGCCGAGATGGAAGG

AAGCCCTACCACCGCCACTGCGGTGGAAGGAAAAGTCCCCTCTCCGGAGAGAGGGGACGGATCTTCCACCCAGCCTGAAGCAATGGATGCCAAGCCAGCC

CCTGCTGCCCAAGCCGTCTCTACCGGATCTGATGCTGGAGCTCCTACGGATTCCGCGATGCTCACAGATAGCCAGAGCGATGCCGGAGAAGACGGGACAG

CCCCAGGAACGCCTTCAGATCTCCAGTCGGATCCTGAAGAACTCGAAGAAGCCCCAGCTGTCCGCGCCGATCCTGACGGAGGGGCAGCCCCAGTCGCCCC

AGCCACTCCTGCCGAGTCCGAGTCTGAAGGCAGCAGAGATCCAGCCGCCGAGCCAGCCTCCGAGGCAGTCCCTGCCACCACGGCCGAGTCTGCCTCCGGG

GCAGCCCCTGTCACCCAGGTGGAGCCCGCAGCCGCGGCAGTCTCTGCCACCCTGGCGGAGCCTGCCGCCCGGGCAGCCCCTATCACCCCCAAGGAGCCCA

CTACCCGGGCAGTCCCCTCTGCTAGAGCCCATCCGGCCGCTGGAGCAGTCCCTGGCGCCCCAGCAATGTCAGCCTCTGCTAGGGCAGCTGCCGCTAGGGC

AGCCTATGCAGGTCCACTGGTCTGGGGAGCCAGGTCACTCTCAGCTACTCCCGCCGCTCGGGCATCCCTTCCTGCCCGCGCAGCAGCTGCCGCCCGGGCA

GCCTCTGCTGCCCGCGCAGTCGCTGCTGGCCGGTCAGCCTCTGCCGCCCCCAGCAGGGCCCATCTTAGACCCCCCAGCCCCGAGATCCAGGTTGCTGACC

CGCCTACTCCGCGGCCTCCTCCGCGGCCGACTGCCTGGCCTGACAAGTACGAGCGGGGCCGAAGCTGCTGCAGGTACGAGGCATCGTCTGGCATCTGCGA

GATCGAGTCCTCCAGTGATGAGTCGGAAGAAGGGGCCACCGGCTGCTTCCAGTGGCTTCTGCGGCGAAACCGCCGCCCTGGCCTGCCCCGGAGCCACACG

GTCGGGAGCAACCCAGTCCGCAACTTCTTCACCCGAGCCTTCGGAAGCTGCTTCGGTCTATCCGAGTGTACCCGATCACGATCCCTCAGCCCCGGGAAGG

CCAAGGATCCTATGGAGGAGAGGCGCAAACAGATGCGCAAAGAAGCCATTGAGATGCGAGAGCAGAAGCGCGCAGATAAGAAACGCAGCAAGCTCATCGA

CAAGCAACTGGAGGAGGAGAAGATGGACTACATGTGTACACACCGCCTGCTGCTTCTAG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGAT

GAGGATCCTGCATGTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGG TGAGAAGGCCACTAAAGTGC

AGGACATCAAAAACAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCTGTGGAGCTGGCCAACCCTGAGAACCAGT

TCAGAGTGGACTACATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT GAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAGGGAG

TGCGTGCCTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA CTTCCTGGACAAGATTGATGTGATCAAGCAGGCCGACTACGTGC

CAAGTGACCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCA CATGTTCGATGTG

GGCGGCCAGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATTC

GGGAGGACAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAG ATGGCTGCGCACCATCTCTGTGATTCTCTTCC

TCAACAAGCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGGACTACTTTCCAGAGTTCGCTCGCTACACCACTCCTGAGGATG 

CGACTCCCGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGGATGAGTTTCTG AGAATCAGCACTGCTAGTGGAGATGGGCGCC

ACTACTGCTACCCTCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCTTCAACGACTGCCGTGACATCATCCAGCGCATGCATCTCCGCCA

ATACGAGCTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTAATTAAGAGTGAAACGTAATTGTACAAGCAGTTGGTCACCCACC

ATAGGGCATGATCAACACCGCAACCTTTCC
Translation
MSPSPTRLAVRSVDPQKTPNLTSKAPARPSRKSEWVETTAHLRRKPCHSRHNSPAWEISGPPWSSQDHLGPHQASKPSTQRFWSPGPPLARAQAWEPIPP

HQKKLCHLSSTSLPRETIASLPCKSQTLRQEVRKHWSPELFPRSPGTSDLKTLASEKTTALPLKNLCHFRSVEKNSGAIAHPQDSRESSHKSALAASSRQ

SRSRVRSASLPPRTRLPSGSEAPLTDHSARLSDLLLTSHATAPRWRSPDPCLRLAEPPLGSTTTPLSIWTAPQSQVMARPSKSREPQIRASAQRDPQLSE

KQPRWKEALPPPLRWKEKSPLRREGTDLPPSLKQWMPSQPLLPKPSLPDLMLELLRIPRCSQIARAMPEKTGQPQERLQISSRILKNSKKPQLSAPILTE

GQPQSPQPLLPSPSLKAAEIQPPSQPPRQSLPPRPSLPPGQPLSPRWSPQPRQSLPPWRSLPPGQPLSPPRSPLPGQSPLLEPIRPLEQSLAPQQCQPLL

GQLPLGQPMQVHWSGEPGHSQLLPPLGHPFLPAQQLPPGQPLLPAQSLLAGQPLPPPAGPILDPPAPRSRLLTRLLRGLLRGRLPGLTSTSGAEAAAGTR

HRLASARSSPPVMSRKKGPPAASSGFCGETAALACPGATRSGATQSATSSPEPSEAASVYPSVPDHDPSAPGRPRILWRRGANRCAKKPLRCESRSAQIR

NAASSSTSNWRRRRWTTCVHTACCF           
Transcript ENSMUST00000109087
Sequence
AATAAGAGCGGCGGCGGCGGCGGCGGCGGCAGCAGCTCCCGCGGCTCCTGCTCTGCTCCGCCTCGGCCCCGGAGCGAGGGGCGGAGAGCCGCGCGCTTGC

CTTAGTCCGAGCCGCCACCCTCCCCGCGTTCCCCGCTTTCCCGGCCCGCCCGAGGCCGCCCGCCCCGTCCCCGCCGCCCCGCAGCCCGGCCGCGCCCCGC

CGCCGCCATGGGCTGCCTCGGCAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGCGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAG

AAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCAT

GTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGG TGAGAAGGCCACTAAAGTGCAGGACATCAAAAA

CAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCTGTGGAGCTGGCCAACCCTGAGAACCAGTTCAGAGTGGACTA

CATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT GAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAGGGAGTGCGTGCCTGCTA

CGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA CTTCCTGGACAAGATTGATGTGATCAAGCAGGCCGACTACGTGCCAAGTGACCAG G

ACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCA CATGTTCGATGTGGGCGGCCAGCGCG

ATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATTCGGGAGGACAACCA

GACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAG ATGGCTGCGCACCATCTCTGTGATTCTCTTCCTCAACAAGCAAGA

CCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGGACTACTTTCCAGAGTTCGCTCGCTACACCACTCCTGAGGATG CGACTCCCGAGCC

GGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGGATGAGTTTCTG AGAATCAGCACTGCTAGTGGAGATGGGCGCCACTACTGCTACCC

TCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCTTCAACGACTGCCGTGACATCATCCAGCGCATGCATCTCCGCCAATACGAGCTGCTC

TAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTAATTAAGAGTGAAACGTAATTGTACAAGCAGTTGGTCACCCACCATAGGGCATGATC

AACACCGCAACCTTTCCTTTTTCCCCCAGTGATTCTGAAAAACCCCTCTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGTAAGCTTAAGGCGGCCTA

CAGAAGAAAAAGAAAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAATAAAATAAAAGCAGCAACAGAAATAAAGAAATAAATGAAATTCAAAAT

GAAATAAATATTGTGTTGTGCAGCATT
Translation
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLG GAGESGKSTIVKQMRILHVNGFNGE EGGEEDPQAARSNSDG GEKATKVQD

IKNNLKEAIE TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPP EFYEHAKALWEDEGVRACYERSNEYQLIDCAQY YFLDKIDVIKQADY

VPSDQ DLLRCRVLTSGIFETKFQVDKVNFH HMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR RWLRTI

SVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDA ATPEPGEDPRVTRAKYFIRDEFL RISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDI

IQRMHLRQYELL
Transcript ENSMUST00000087871
Sequence
CACCGCGGAGCGGGTTGCTTCAGGTGGCTGGTACCAGCGGCGCTCGCTAGCTCCCGGCTCTCTGGGCTCGGGGCTGCAGCACCGGCTGGAGCGAACCCTT

GTCCCAGCGCTTGGCGGCGGCAGGCAGACGGGCAGGCAGGCGCTGCTTTGCGTGTGAGTGCGTCTCACTCACAT AGCTAACCCAAGGAGCACCTAAGGG

TAATAGCAAACTCTTGTCATCTGCACCTTTGCACTTTCCTTTCTCTTGTGTTATTTTTTTTATTTTTTTTGTCTTTTCTAGACTCTCTTCCCCCCTTTTT

GAGTTGTTGGGCAGTTCTTATTTCTTGCTTGCTTTTCGGTTTCTTGCTGTTGTTGGGTGTTTTTTTTGTTTGTTTGTTTGTTTGTTTGTTCTCGCTTTTT

TTGTTTGCTCATCCTATTTGACGCTAACTCTTAGGCAGCCAGTCCATCAGCCCCCTACGAAGCCCGGGAAGCCGCACTCGGTGACCCCAAGACAGCACAG

CGGAGACTGCAGCTGAGCCCCCCGACACGGGGCGCACAGGAGCCGGGAAGCCCGAGGCCGGGGGCAAGCAGACCGCCCGAGCCAGGCGCGAACCAAGCAC

CCCGAGGTGGCCGGGGCACCATGCTGAAGATGGCCATGAAGCTCAAAGCCCGAGCGGCCGAGAGCGAGAGGAAGACAGCCGCGGCTGCCGCCGAAGTGGC

TGCCGAAGCTGCCGTGGCGGCTGCGGTGCTGGCAGAACCGTTCGCTTCGCAGAAGAACGGGATCCCCGCGAAGCCCCCGAAGTCCGTCAGGGTCCTCGTG

AACGCCGGGCGCGATGTGCCGCCCGCAAAGTTGCTGACCGACAAAGAGCGCAAGAAGATGGAGAAGAAGCTGCTGGAGCAGAGGAGAAAGGAGGAGAAGA

AGAGAGAGAAAGAGAGGAAGAAGTTGGAGAAGATGTTGAAGAAGAAGAAGAAGAAGAATGTGCCAGAAGCTCCGCCAGAGGCCCGAGGCCCCGAGGGCGC

CGCCGCCACCGCCGCAGGCGAAGACGAGGGCGCCGCGCAGGGCGCCGCCGGGTTCGGAGAGGGCGCCGCCACCGGGGGCGCGAGTAGGGCCTGGGCCGAA

TGGGACAGTGACACTGATGAAGAAGATGATGCCTACTACGCGCCTCCCCGCGTGGGGGGCGTCGTGTGGCGGCCTGGGCCTGCCAAGGCAGGCGCACTCA

GCGCGCACATGCCCCTCGTGGTGTTCCTGGTGTTCTCGGTTCGCAGCCCCTCATGGGTGCTTAACTTCCTGCTACAGAGGCGCACAGAGCAGGGCCGCGG

CTGCGGCTTCGTGTTCGGGGCGACCTGCTGCTTCAGAGTGTTCCTGGGCTGCGCCTTCTTCTCCTTCCTGAGTGGTCGCGCCAAGCGCAGAGGCCGTGGG

CGATCCCGGGCCAGGGGCACCGGGCGCCGGGGGCGCGACGAGCGGCTCATCTAGTCAGCCTCCCCCCCACCCCTCCACCATCATCATCTACATCGCCATC

GACCACCACCACCAACACCACCAACACATCCACCACCACCACCTTCCACCACCATTGCTGTGTAGTGTGGATCTTTATTAGTGCTTGTGTGTGGACACAT

TTTCCTTTTTGGTTGCTCTGTCCTATGCTTAGTGCTCTCCTAGCTTTTCTCCAAGCTCCCTGCTTTCTGGCTCTCTCAGTGTCTCCCTCTCTCTCTCTCT

CTCTCCTTTTCGAAATTTTCCTAAGTCCGGGCCCGCACTCCCTCCCTTTCCGCCCACCCCGGCCCCTTGGCGGCGCCTGCCCGCCCTGCTGCTGCAGGAG

GAGGGGGATCGGGGGCCGCCCGGCCCGGGGGTGGAGCGCTGGCATCGTGTGAGGGGTCGTCACCACCGCGGGGCCGCCCCCTTTTCCCCCCGCCGCACGG

CCAGGCCCCGGCCCCGAACTGCGGGTGGGGCGAGGGGGCGACCCCTCCGTGGAGCCGGCCCGAGCCGGACGTGGGTGCTGGGACCCCTGCCCGGCCTCTG

GGCACCGCCTCCCGGCGCCCGCGCCCGCCCTCCCAGCCGCGGCCCTCCTCCTCCTCCTCTTCTTCCCACCCCCCTCGCCGCCGTCGCCTCCGCCTCCCCC

CGCTCCCCCGCCCGCCGCGGCGCTTTTGGGTCGGGGCGGCGGGCCCGGGCCGAGGCAATAAGAGCGGCGGCGGCGGCGGCGGCGGCAGCAGCTCCCGCGG

CTCCTGCTCTGCTCCGCCTCGGCCCCGGAGCGAGGGGCGGAGAGCCGCGCGCTTGCCTTAGTCCGAGCCGCCACCCTCCCCGCGTTCCCCGCTTTCCCGG

CCCGCCCGAGGCCGCCCGCCCCGTCCCCGCCGCCCCGCAGCCCGGCCGCGCCCCGCCGCCGCCATGGGCTGCCTCGGCAACAGTAAGACCGAGGACCAGC

GCAACGAGGAGAAGGCGCAGCGCGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCT

GG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGG

CTGCAAGGAGCAACAGCGATGG TGAGAAGGCCACTAAAGTGCAGGACATCAAAAACAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGC

AACCTGGTGCCCCCTGTGGAGCTGGCCAACCCTGAGAACCAGTTCAGAGTGGACTACATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT 

GAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAGGGAGTGCGTGCCTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA C

TTCCTGGACAAGATTGATGTGATCAAGCAGGCCGACTACGTGCCAAGTGACCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACC

AAGTTCCAGGTGGACAAAGTCAACTTCCA CATGTTCGATGTGGGCGGCCAGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCC

ATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATTCGGGAGGACAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCT

GGAACAACAG ATGGCTGCGCACCATCTCTGTGATTCTCTTCCTCAACAAGCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGG

ACTACTTTCCAGAGTTCGCTCGCTACACCACTCCTGAGGATG CGACTCCCGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGG

ATGAGTTTCTG AGAATCAGCACTGCTAGTGGAGATGGGCGCCACTACTGCTACCCTCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCT

TCAACGACTGCCGTGACATCATCCAGCGCATGCATCTCCGCCAATACGAGCTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTA

ATTAAGAGTGAAACGTAATTGTACAAGCAGTTGGTCACCCACCATAGGGCATGATCAACACCGCAACCTTTCCTTTTTCCCCCAGTGATTCTGAAAAACC

CCTCTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGTAAGCTTAAGGCGGCCTACAGAAGAAAAAGAAAAAAAAGGCCACAAAAGTTCCCTCTCACTT

TCAGTAAATAAAATAAAAGCAGCAACAGAAATAAAGAAATAAATGAAATTCAAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAATCAATAAAAAT

TAAAAATGAGCAAAA
Translation
 MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLG GAGESGKSTIVKQMRILHVNGFNGE EGGEEDPQAARSNSDG GEKATKVQ

DIKNNLKEAIE TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPP EFYEHAKALWEDEGVRACYERSNEYQLIDCAQY YFLDKIDVIKQAD

YVPSDQ DLLRCRVLTSGIFETKFQVDKVNFH HMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR RWLRT

ISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDA ATPEPGEDPRVTRAKYFIRDEFL RISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRD

IIQRMHLRQYELL
Transcript ENSMUST00000109085
Sequence
CTCGCCGCCGTCGCCTCCGCCTCCCCCCGCTCCCCCGCCCGCCGCGGCGCTTTTGGGTCGGGGCGGCGGGCCCGGGCCGAGGCAATAAGAGCGGCGGCGG

CGGCGGCGGCGGCAGCAGCTCCCGCGGCTCCTGCTCTGCTCCGCCTCGGCCCCGGAGCGAGGGGCGGAGAGCCGCGCGCTTGCCTTAGTCCGAGCCGCCA

CCCTCCCCGCGTTCCCCGCTTTCCCGGCCCGCCCGAGGCCGCCCGCCCCGTCCCCGCCGCCCCGCAGCCCGGCCGCGCCCCGCCGCCGCCATGGGCTGCC

TCGGCAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGCGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTA

CCGGGCCACGCACCGCCTGCTGCTGCTGG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAACGG

AGA TAGTGAGAAGGCCACTAAAGTGCAGGACATCAAAAACAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCTG

TGGAGCTGGCCAACCCTGAGAACCAGTTCAGAGTGGACTACATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT GAATTCTATGAGCATG

CCAAGGCTCTGTGGGAGGATGAGGGAGTGCGTGCCTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA CTTCCTGGACAAGATTG

ATGTGATCAAGCAGGCCGACTACGTGCCAAGTGACCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACA

AAGTCAACTTCCA CATGTTCGATGTGGGCGGCCAGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCCATCATCTTCGTGGTGG

CCAGCAGCAGCTACAACATGGTCATTCGGGAGGACAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAG ATGGC

TGCGCACCATCTCTGTGATTCTCTTCCTCAACAAGCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGGACTACTTTCCAGAGTT

CGCTCGCTACACCACTCCTGAGGATG CGACTCCCGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGGATGAGTTTCTG AGAA

TCAGCACTGCTAGTGGAGATGGGCGCCACTACTGCTACCCTCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCTTCAACGACTGCCGTGA

CATCATCCAGCGCATGCATCTCCGCCAATACGAGCTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTAATTAAGAGTGAAACGT

AATTGTACAAGCAGTTGGTCACCCACCATAGGGCATGATCAACACCGCAACCTTTCCTTTTTCCCCCAGTGATTCTGAAAAACCCCTCTTCCCTTCAGCT

TGCTTAGATGTTCCAAATTTAGTAAGCTTAAGGCGGCCTACAGAAGAAAAAGAAAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAATAAAATAA

AAGCAGCAACAGAAATAAAGAAATAAATGAAATTCAAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAATCAATAAAAATTAAAAATGAGCAAAA
Translation
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLG GAGESGKSTIVKQMRILHVNGFNGD DSEKATKVQDIKNNLKEAIE TIVAA

MSNLVPPVELANPENQFRVDYILSVMNVPNFDFPP EFYEHAKALWEDEGVRACYERSNEYQLIDCAQY YFLDKIDVIKQADYVPSDQ DLLRCRVLTS

GIFETKFQVDKVNFH HMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR RWLRTISVILFLNKQDLLAEKV

LAGKSKIEDYFPEFARYTTPEDA ATPEPGEDPRVTRAKYFIRDEFL RISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
Transcript ENSMUST00000109084
Sequence
CGGCGGCGGCGGCGGCGGCGGCAGCAGCTCCCGCGGCTCCTGCTCTGCTCCGCCTCGGCCCCGGAGCGAGGGGCGGAGAGCCGCGCGCTTGCCTTAGTCC

GAGCCGCCACCCTCCCCGCGTTCCCCGCTTTCCCGGCCCGCCCGAGGCCGCCCGCCCCGTCCCCGCCGCCCCGCAGCCCGGCCGCGCCCCGCCGCCGCCA

TGGGCTGCCTCGGCAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGCGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAA

GCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGG

GTTTAACGGAGA TGAGAAGGCCACTAAAGTGCAGGACATCAAAAACAACCTGAAGGAGGCCATTGAA ACCATTGTGGCCGCCATGAGCAACCTGGTGC

CCCCTGTGGAGCTGGCCAACCCTGAGAACCAGTTCAGAGTGGACTACATTCTGAGCGTGATGAACGTGCCGAACTTTGACTTCCCACCT GAATTCTATG

AGCATGCCAAGGCTCTGTGGGAGGATGAGGGAGTGCGTGCCTGCTACGAGCGCTCCAATGAGTACCAGCTGATTGACTGTGCCCAGTA CTTCCTGGACA

AGATTGATGTGATCAAGCAGGCCGACTACGTGCCAAGTGACCAG GACCTGCTTCGCTGCCGTGTCCTGACCTCTGGAATCTTTGAGACCAAGTTCCAGG

TGGACAAAGTCAACTTCCA CATGTTCGATGTGGGCGGCCAGCGCGATGAGCGCCGCAAGTGGATCCAGTGCTTCAATGATGTGACTGCCATCATCTTCG

TGGTGGCCAGCAGCAGCTACAACATGGTCATTCGGGAGGACAACCAGACTAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAG

 ATGGCTGCGCACCATCTCTGTGATTCTCTTCCTCAACAAGCAAGACCTGCTTGCTGAGAAAGTCCTCGCTGGCAAATCGAAGATTGAGGACTACTTTCC

AGAGTTCGCTCGCTACACCACTCCTGAGGATG CGACTCCCGAGCCGGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGGGATGAGTTTCT

G AGAATCAGCACTGCTAGTGGAGATGGGCGCCACTACTGCTACCCTCACTTTACCTGCGCCGTGGACACTGAGAACATCCGCCGTGTCTTCAACGACTG

CCGTGACATCATCCAGCGCATGCATCTCCGCCAATACGAGCTGCTCTAAGAAGGGAACACCCAAATTTAATTCAGCCTTAAGCACAATTAATTAAGAGTG

AAACGTAATTGTACAAGCAGTTGGTCACCCACCATAGGGCATGATCAACACCGCAACCTTTCCTTTTTCCCCCAGTGATTCTGAAAAACCCCTCTTCCCT

TCAGCTTGCTTAGATGTTCCAAATTTAGTAAGCTTAAGGCGGCCTACAGAAGAAAAAGAAAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAATA

AAATAAAAGCAGCAACAGAAATAAAGAAATAAATGAAATTCAAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAATCAATAAAAATTAAAAATGAG

CAAAA
Translation
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLG GAGESGKSTIVKQMRILHVNGFNGD DEKATKVQDIKNNLKEAIE TIVAAM

SNLVPPVELANPENQFRVDYILSVMNVPNFDFPP EFYEHAKALWEDEGVRACYERSNEYQLIDCAQY YFLDKIDVIKQADYVPSDQ DLLRCRVLTSG

IFETKFQVDKVNFH HMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR RWLRTISVILFLNKQDLLAEKVL

AGKSKIEDYFPEFARYTTPEDA ATPEPGEDPRVTRAKYFIRDEFL RISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
Transcript ENSMUST00000109083
Sequence
GCCGCCGCCATGGGCTGCCTCGGCAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGCGAGGCCAACAAAAAGATCGAGAAGCAGCTGC

AGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGG GTGCTGGAGAGTCTGGCAAAAGCACCATTGTGAAGCAGATGAGGATCCTGC

ATGTTAATGGGTTTAACGGAGA GGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGG AGTCTATTACCCCCACTAGATGATGGCTACA

GTCCTCCATCTTCGCTATGTCCTACCCCAGTTATCCCAATTTGCATGCTGGAATTGCCCGGTCTTAGGAAACTACTAATAAGAATACTATTCTGTTTTCC

TGGGGATGGGGGGGGGTGGGGGAGGGGGGAGGGGTCCCTAACCTAACCTTTAGGCGTAAGTTAAAAACAGAAAGATGGGATGAAGTCTTTAATTGGCAAC

AGCATAGTAGAACAGCAATCAGAAAAGGCATCGATATATTGATAATCTACTGTACCAAAAGTTGGCATCCGAGAAGTGTGGCAAGCCCCTACTGAGAGAG

CCTCCTATATATTGTGTGCTGTGCTAACCCCTTCAACCTTACTAATACCTGCACGTCTTTCTTCCTATGACTCTACAAGTAAAAATAACTATTAACGCTC

CTGATAAATAAAACTCTCTGCATGTTTCAGCAA
Translation
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLG GAGESGKSTIVKQMRILHVNGFNGE EGGEEDPQAARSNSDG GVYYPH

For any suggestions or comments, please send an email to unitrap@crg.es