Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027531 (Impa1)
Chromosomal location
Chr 3: 10313949 - 10331439 (-)
Description
inositol (myo)-1(or 4)-monophosphatase 1 Gene [Source:MGI (curated);Acc:Impa1-002]
RefSeq_dna
NM_018864 
RefSeq_peptide
NP_061352.2 
UniGene
Mm.183042 Mm.398299 
MGI
MGI:1933158 
Uniprot/SWISSPROT
O55023 
Uniprot/SPTREMBL
Q80ZJ2 Q3TME6 Q3U5R8 Q924B0 Q9D066 
Human Ortholog
ENSG00000133731 (IMPA1)
Omim not available
UniTrap UNI16464
Vector Insertion
Chr 3: 10328942 - 10329009
Public Clones not available
Private Clones OST460625 (lexicon) OST167814 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118410
Sequence
GGGGTTTTAATGGGGCGGGACTTCCTGTCGGAGCAATCCCCGTTACCTCCGGAAGAGCCGAAGAACCGAGCCCTCGGACGCCGGCGGTTGAGCATCGATC

GCGGTGCGCTCGCGCGAG - UNI16464 - ATAATGGCAGACCCTTGGCAGGAGTGCATGGACTATGCAGTAATCCTCGCGAGGCAAGCTGGAGAG -

 UNI16464 - ATGATTCGTGAAGCTTTAAAAAATGAGATGGATGTCATGATTAAAAGTTCTCCAGCCGACTTGGTAACAGTTACTGACCAAAAAGTTG

AAAAAATGCTCATGTCTTCTATAAAGGAAAAGTATCCATGTCACAG CTTCATTGGTGAAGAGTCTGTGGCAGCTGGGGAGAAGACGGTCTTCACAGAGC

AGCCCACGTGGGTCATTGACCCCATTGATGGAACGACTAACTTCGTGCATCG GTTTCCCTTTGTAGCTGTTTCAATTGGCTTCCTTGTGAATAAAGAG 

ATGGAGTTTGGAATTGTGTACAGCTGTGTGGAAGATAAGATGTACACCGGCAGGAAAGGGAAAGGTGCCTTTTGTAACGGTCAGAAGCTTCAGGTGTCCC

AGCAGGAAG ACATTACCAAGTCACTCTTGGTGACCGAGTTGGGCTCGTCCAGAAAGCCCGAGACTTTACGGATCGTTCTCTCCAACATGGAAAAGCTGT

GTTCCATCCCCATCCATGG AATCCGGAGTGTTGGAACAGCTGCTGTTAATATGTGCCTTGTGGCAACGGGAGGAGCAGATGCCTATTATGAGATGGGAA

TCCACTGCTGGGACATGGCGGGAGCTGGCATCATTGTCACCGAGGCAGGCGGAGTGCTCATGGATGTCACGGGTGAGATCATGCCACCACAAAGCATGCA

GGGCTCTCTCCTTGATGTGTGTGAGTCTCTGCAAAATCAGACGTTAGCAGATGGAGACAGTGGTGTGGCTAGTGCTACTACATAGTGAGCATTGCTTGAG

AATTCCTTCATGCCTTCATTGTGAATATCGAGAGCTCCTGAGAGGCCTGGAGAGCTCTGCACCACCTCTGAGGCTTGGACCATGAACTTTGGACAGGACC

ACAGTGATAGTGAAAAATGGGCTCTGTCCTCCAACTATTTTGCTCTGGCCTGGGTCAGTTAAATATTAACTCTGAGCAGAAGGTGAAATTAAGGAGAATA

AACCGGGGTTCAAAGAGTTCAGAAACCATGAGATACAGCACACTGAAACAGGAAGTGGAAAAAAAAGCAGTGTGACAGTGCGTGGGATAAGTGTAACTGT

CTCACACATGTGACAGTGCATGGTGTGAGTGTGACTGTCTCATACCTGTGACAGTGTGTGGGGTGAGTGTGACTGTCCTCACACATGTGACAGTGTATGG

GTGTGAGTGTGCCTGTCCTCAGACATTAGAGAGATGAAGTAGAAGAGCGCCCACAAGAAACAGAGGATCCTGCATTCCAATTGGAGATCGCTAGCATTGG

CCTTTACTCAGAAAAGATGCCTAGCGGCTTCCGTTCTGGAGGCTGAGAGCTGACCGGAGGGGTGGGGGGGGTTAAGAAAAGTTGAGCATTGCCAGAGGAT

ATAACTGTGTACTATCTTTTCTGGTGATTGTTTTTGTTCAGGTATAACTTTTCTATATTTGATTTGATTTCAGGTGGACCGTTCGATCTGATGTCTCGGA

GAATAATTGCCGCAAATAGTATAACATTAGCCAAAAGAATAGCCAAAGAAATTGAGATAATACCTTTGCAAAGAGACGACGAAAGCTAGTCACAGAGAAC

AGTGTCCAGCTCCAGTGTCATCCTTGCTGTCCCTGGGGTGTTTCAGATGGATGGTGTCACTGATTTAGACTGAACTTTGAGGTCCTGATTTTAAAATGGA

AACTTTTTTTTTACAGATGACATATTCAAAATTAGATGGAATATTTGATTATTGAAAGAAAATTTGCATGTAGTAATATTCTTGGGGAAAATATACAAAA

AGTATACTTAATGAACTAGCCATTGAAATTGTCCCTAGTCCTTATGATCCCCTTCAACTTAATGTACTGTTTATATGCATAATTCTCAATTACAAAGTTT

CTTTTTGTAAGTGGCTTTCTCTATGTTCCAGAAGCCATATTTGATTAAGTCTAAAGGCTGTAACAAGCTGGCTCTCCCTGTGCAGAGGGCCTTTGTGTTT

TATTAATCACTGTAAGATAGTGCCTGGCCCAGTGCCTGTCAGACAGTAGGCAGTCTGAAGTCCACACCTGACAATGCGTGCTCGAAGCTGCAGCTGCTGC

CTCTAATGCGTCACAGTAAGATAACCACCCTCCTGTTGCGAGGTAGAAGTTACTTCACTGTCCTTTTTATATTTCTTATTGCTATGCCATTTCACAGGAT

CGTGCTGCCAGAGACGACTGCTTCTAGTGGACATTTCTGCAGTTAGTACACTGCTGTATGTTGTAGGTTCTGCTTAAAGCTGCCGTGCTAAAGAGATTTT

CACAGACATCTTCCAGGTACCTGGTCTAGTTAGTGGCAGGGATATGTTTTACAAAAGGCAGCTTTCTCATTCAGATCCGTACCCTGGTGCTGACCTGTGT

ACTGTGGTGTAATGGTGAACTTTTTGATTTCTTTCCAGACTTGCTGAATTTCATCACTGCTAACTCTAGATGCTCTCTCTATAAGGTCTTGGGCCTCTCA

AACTCAAGAAAATTTAATGGCTCCTATTCCTTTGTTAAAGGGTTAATTCATTGTCTAGCCTTGGCCCTTGGCATATGAACAGATGTTTTGCTCTTAGTAT

GTTTGAACCTTGCATTTGATACAATGAAGTGTTTTTGTAAGTTTCAAGGCAGTTATCTTGATTTTGGGGGGATTTAATATATTAAAGCTATATAATACTC

AGATTTGGGCACTGTAATGACTATATCTGTGCTGTTAATTACATGTATTTAAAACGTCACGTACCATGTAAATTCTATTACAAGACAGGTTGCTTTGCAA

TTAAATTTATTTTAGTTAAGA
Translation
 - UNI16464 - MADPWQECMDYAVILARQAGE - UNI16464 - MIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHS SFIGE

ESVAAGEKTVFTEQPTWVIDPIDGTTNFVHR RFPFVAVSIGFLVNKE MEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQED DITKSLLVTELGS

SRKPETLRIVLSNMEKLCSIPIHG GIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGEIMPPQSMQGSLLDVCESLQNQT

LADGDSGVASATT
Transcript ENSMUST00000065938
Sequence
GAAGAGCCGAAGAACCGAGCCCTCGGACGCCGGCGGTTGAGCATCGATCGCGGTGCGCTCGCGCGAG - UNI16464 - ATAATGGCAGACCCTTGGC

AGGAGTGCATGGACTATGCAGTAATCCTCGCGAGGCAAGCTGGAGAG - UNI16464 - ATGATTCGTGAAGCTTTAAAAAATGAGATGGATGTCATG

ATTAAAAGTTCTCCAGCCGACTTGGTAACAGTTACTGACCAAAAAGTTGAAAAAATGCTCATGTCTTCTATAAAGGAAAAGTATCCATGTCACAG CTTC

ATTGGTGAAGAGTCTGTGGCAGCTGGGGAGAAGACGGTCTTCACAGAGCAGCCCACGTGGGTCATTGACCCCATTGATGGAACGACTAACTTCGTGCATC

G GTTTCCCTTTGTAGCTGTTTCAATTGGCTTCCTTGTGAATAAAGAG ATGGAGTTTGGAATTGTGTACAGCTGTGTGGAAGATAAGATGTACACCGGC

AGGAAAGGGAAAGGTGCCTTTTGTAACGGTCAGAAGCTTCAGGTGTCCCAGCAGGAAG ACATTACCAAGTCACTCTTGGTGACCGAGTTGGGCTCGTCC

AGAAAGCCCGAGACTTTACGGATCGTTCTCTCCAACATGGAAAAGCTGTGTTCCATCCCCATCCATGG AATCCGGAGTGTTGGAACAGCTGCTGTTAAT

ATGTGCCTTGTGGCAACGGGAGGAGCAGATGCCTATTATGAGATGGGAATCCACTGCTGGGACATGGCGGGAGCTGGCATCATTGTCACCGAGGCAGGCG

GAGTGCTCATGGATGTCACGG GTGGACCGTTCGATCTGATGTCTCGGAGAATAATTGCCGCAAATAGTATAACATTAGCCAAAAGAATAGCCAAAGAAA

TTGAGATAATACCTTTGCAAAGAGACGACGAAAGCTAGTCACAGAGAACAGTGTCCAGCTCCAGTGTCATCCTTGCTGTCCCTGGGGTGTTTCAGATGGA

TGGTGTCACTGATTTAGACTGAACTTTGAGGTCCTGATTTTAAAATGGAAACTTTTTTTTTACAGATGACATATTCAAAATTAGATGGAATATTTGATTA

TTGAAAGAAAATTTGCATGTAGTAATATTCTTGGGGAAAATATACAAAAAGTATACTTAATGAACTAGCCATTGAAATTGTCCCTAGTCCTTATGATCCC

CTTCAACTTAATGTACTGTTTATATGCATAATTCTCAATTACAAAGTTTCTTTTTGTAAGTGGCTTTCTCTATGTTCCAGAAGCCATATTTGATTAAGTC

TAAAGGCTGTAACAAGCTGGCTCTCCCTGTGCAGAGGGCCTTTGTGTTTTATTAATCACTGTAAGATAGTGCCTGGCCCAGTGCCTGTCAGACAGTAGGC

AGTCTGAAGTCCACACCTGACAATGCGTGCTCGAAGCTGCAGCTGCTGCCTCTAATGCGTCACAGTAAGATAACCACCCTCCTGTTGCGAGGTAGAAGTT

ACTTCACTGTCCTTTTTATATTTCTTATTGCTATGCCATTTCACAGGATCGTGCTGCCAGAGACGACTGCTTCTAGTGGACATTTCTGCAGTTAGTACAC

TGCTGTATGTTGTAGGTTCTGCTTAAAGCTGCCGTGCTAAAGAGATTTTCACAGACATCTTCCAGGTACCTGGTCTAGTTAGTGGCAGGGATATGTTTTA

CAAAAGGCAGCTTTCTCATTCAGATCCGTACCCTGGTGCTGACCTGTGTACTGTGGTGTAATGGTGAACTTTTTGATTTCTTTCCAGACTTGCTGAATTT

CATCACTGCTAACTCTAGATGCTCTCTCTATAAGGTCTTGGGCCTCTCAAACTCAAGAAAATTTAATGGCTCCTATTCCTTTGTTAAAGGGTTAATTCAT

TGTCTAGCCTTGGCCCTTGGCATATGAACAGATGTTTTGCTCTTAGTATGTTTGAACCTTGCATTTGATACAATGAAGTGTTTTTGTAAGTTTCAAGGCA

GTTATCTTGATTTTGGGGGGATTTAATATATTAAAGCTATATAATACTCAGATTTGGGCACTGTAATGACTATATCTGTGCTGTTAATTACATGTATTTA

AAACGTCACGTACCATGTAAATTCTATTACAAGACAGGTTGCTTTGCAATTAAATTTATTTTAGTTAAGACTTAG
Translation
 - UNI16464 - MADPWQECMDYAVILARQAGE - UNI16464 - MIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHS SFIGE

ESVAAGEKTVFTEQPTWVIDPIDGTTNFVHR RFPFVAVSIGFLVNKE MEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQED DITKSLLVTELGS

SRKPETLRIVLSNMEKLCSIPIHG GIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTG GGPFDLMSRRIIAANSITLAKR

IAKEIEIIPLQRDDES

For any suggestions or comments, please send an email to unitrap@crg.es