Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027546 (Atp9a)
Chromosomal location
Chr 2: 168459938 - 168567821 (-)
Description
ATPase, class II, type 9A Gene [Source:MGI (curated);Acc:Atp9a-003]
RefSeq_dna
NM_015731 
RefSeq_peptide
NP_056546.2 
UniGene
Mm.330819 
MGI
MGI:1330826 
Uniprot/SWISSPROT
O70228 
Uniprot/SPTREMBL
A2AUZ0 B2FDH4 Q8C4G3 A2AQC3 Q505G9 Q6DI68 Q8C288 A2AQC9 A2AUZ1 
Human Ortholog
ENSG00000054793 (ATP9A)
Omim not available
UniTrap UNI35184
Vector Insertion
Chr 2: 168559520 - 168567301
Public Clones IST14808A2 (tigm) IST14964D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36806
Vector Insertion
Chr 2: 168536575 - 168559541
Public Clones IST14645H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25456
Vector Insertion
Chr 2: 168536477 - 168536529
Public Clones not available
Private Clones OST183315 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30596
Vector Insertion
Chr 2: 168516465 - 168530732
Public Clones (cmhd) IST12445B1 (tigm) IST13115D12 (tigm) IST14024E9 (tigm) IST13092E8 (tigm)
IST13660D5 (tigm) IST12443B1BBF1 (tigm) IST12445A1 (tigm) IST11053F2 (tigm)
IST12443B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18023
Vector Insertion
Chr 2: 168516465 - 168516525
Public Clones not available
Private Clones OST431957 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30959
Vector Insertion
Chr 2: 168514798 - 168516525
Public Clones IST15111B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13328
Vector Insertion
Chr 2: 168514798 - 168514851
Public Clones CMHD-GT_320C1-3 (cmhd)
Private Clones OST369235 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21005
Vector Insertion
Chr 2: 168512936 - 168514798
Public Clones (cmhd) CMHD-GT_258C06-3 (cmhd) IST13190G2 (tigm) IST13190G4 (tigm)
Private Clones OST346101 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21970
Vector Insertion
Chr 2: 168509212 - 168509294
Public Clones not available
Private Clones OST312491 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38663
Vector Insertion
Chr 2: 168493505 - 168499090
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109177
Sequence
GAGTGCGCGCCGCTCGGAGCGAGCAGGAGAGAATGCCCGGGGTGGG - UNI25456 - - UNI35184 - GTGCTGTGAGTGGCTGAGATGTTGCGG

TGGAGGGGAGCCCAGGCCCCGTACTGTCTGGTTGGGACACCCCGAGAAGAGGGACCAGCGGTACCCTCGAAATGTCATCAACAACCAGAAGTACAATTTC

TTCACATTTCTTCCTGGG GTGTTGTTCAGCCAGTTCAGATACTTCTTCAACTTCTACTTCCTGCTTCTCGCCTGCTCGCAGTTCGTCCCAGAGATGAGG

CTTGGCGCCCTGTACACCTACTGGGTTCCTCTG - UNI30596 - GGCTTCGTGCTGGCTGTCACCATCATCCGTGAGGCAGTAGAGGAGATCCGATG

TTATGTGCGTGACAAGGAGATGAACTCCCAGGTCTACAGCCGGCTCACGTCACGAG - UNI18023 - - UNI30596 - - UNI30959 - GGAC

CGTGAAGGTGAAGAGTTCAAACATCCAGGTGGGAGACCTCATCCTTGTGGAAAAG - UNI13328 - - UNI18023 - - UNI30596 - - UNI

30959 - AACCAGCGGGTCCCTGCTGACATGATCTTCCTGAGGACGTCAGAGAAAAACG - UNI13328 - - UNI21005 - - UNI30959 - 

GCTCTTGCTTCTTGCGCACGGATCAGCTGGATGGAGAGACAGACTGGAAGCTTCGGCTCCCGGTGGCCTGCACACAGAGGCTTCCCACGGCTGCT - UN

I21970 - GACCTCCTGCAGATTCGGTCCTATGTGTACGCTGAAGAGCCCAACATCGACATTCACAACTTCCTGGGGACTTTCACCAGG - UNI2197

0 - GAAGACAGTGACCCTCCGATCAGTGAGAGTCTGAGCATTGAGAACACGCTGTGGGCCGGCACCGTCATAGCATCAG GCACTGTTGTAGGCGTTGT

TCTCTACACTGGCAGAGAACTGCGGAGTGTCATGAATACTTCCGACCCCAGAAGTAAG ATTGGCCTGTTCGACCTGGAGGTGAACTGCCTCACCAAGAT

CCTGTTTGGTGCGCTGGTGGTGGTGTCGCTGGTCATGGTGGCCCTGCAGCACTTTGCCGGCCGCTGGTACCTGCAGATCATCCGCTTCCTGCTCCTGTTT

TCCAACATCATTCCTATCAG CTTGCGTGTGAACTTGGACATGGGCAAGATCGTGTACAGCTGGGTGATCCGCAGGGATTCCAAAATCCCCGGGACCGTG

GTTCGTTCCAGCACAATTCCTGAGCAGCTGGGCAGGATTTCGTACTTGCTCACAGACAAGACAG GAACCCTGACCCAGAATGAGATGGTGTTCAAGCGG

CTGCACCTGGGTACGGTGGCCTACGGCCTGGACTCCATGGACGAAGTGCAGAGTCACATCTTCAGCATTTACACCCAG CAATCCCAGGATCCACCTGCT

CAGAAGGGCCCCACGGTCACCACCAAGGTTCGGAGGACCATGAGCAGCCGTGTCCACGAGGCTGTGAAGGCCATTGCACTCTGCCACAACGTGACACCCG

TGTACGAGTCCAATGGTGTGACGGACCAGGCTGAGGCTGAGAAGCAGTTTGAGGACTCCTGCCGAGTGTACCAGGCATCCAGCCCGGATGAG GTGGCTC

TGGTCCAGTGGACAGAAAGTGTGGGACTGACGCTGGTGGGTCGAGACCAGTCCTCCATGCAGCTGAGGACCCCTGGTGACCAGGTCCTGAATCTCACTAT

CCTTCAGGTCTTCCCGTTCACCTATGAGAGCAAGCGGATGGGCATCATCGTGCGG GATGAGTCCACGGGGGAAATCACGTTCTACATGAAGGGAGCAGA

CGTCGTCATGGCTGGCATTGTCCAGTACAACGACTGGCTGGAGGAGGAG TGTGGCAACATGGCCCGGGAGGGACTACGTGTGCTGGTGGTAGCCAAGAA

GTCCCTCACAGAGGAGCAGTACCAAGACTTTGAA GCCCGCTACGTCCAGGCTAAGCTGAGTGTGCATGACCGCTCGCTGAAGGTGGCCACGGTGATCGA

GAGCCTGGAGATGGAGATGGAGCTGCTGTGCCTGACTGGTGTGGAGGACCAGCTGCAGGCAGATGTCAGGCCCACGCTGGAGACGCTGCGCAACGCTGGC

ATCAAG GTTTGGATGCTAACAGGGGACAAGCTGGAGACAGCCACGTGCACAGCCAAGAACGCACATCTGGTGACCAGAAACCAAGATATCCATGTTTTC

CGACTG GTGACCAACCGCGGGGAGGCCCACCTGGAGCTGAATGCCTTCCGTAGGAAGCATGACTGTGCCCTGGTCATCTCTGGAGACTCCCTGGAG GT

TTGCCTCAAATACTATGAGTACGAGTTCATGGAACTGGCCTGCCAGTGCCCGGCTGTGGTGTGCTGCCGCTGTGCCCCAACCCAGAAGGCCCAGATTGTT

CGGCTGCTCCAGGAACGCACCGGGAAGCTCACCTGTGCAGTAG GGGACGGAGGCAATGACGTCAGCATGATCCAGGAATCCGACTGCGGCGTGGGCGTG

GAGGGCAAG GAAGGGAAGCAGGCCTCGCTGGCAGCGGACTTCTCCATCACCCAGTTCAAGCATCTCGGCCGCTTGCTCATGGTGCACGGTCGGAACAGC

TACAAGCGCTCGGCGGCCCTCAGTCAGTTTGTGATCCACAGGAGCCTCTGCATCAGCACCATGCAG GCTGTCTTCTCGTCTGTGTTCTACTTTGCATCC

GTTCCTCTCTACCAAGGCTTCCTGATCATTGG GTATTCTACCATCTACACGATGTTTCCCGTGTTCTCCCTGGTTTTGGACAAAGACGTGAAGTCGGAA

GTCGCCATGTTGTATCCTGAGCTCTACAAGGACCTGCTTAAG GGGCGGCCACTGTCCTACAAGACGTTCTTAATTTGGGTGTTAATCAGCATCTATCAA

G GGAGCACCATCATGTACGGGGCGCTGCTGCTGTTCGAGTCGGAGTTTGTACACATCGTGGCAATCTCCTTCACATCCCTCATCCTCACTGAGCTACTG

ATGGTGGCGCTCACCATCCAGACGTGGCACTGGCTCATGACAGTGGCCGAGCTACTCAGCCTGGCCTGCTACATTGCCTCCCTGGTGTTCCTCCATGAGT

TCATCG ATGTCTACTTCATTGCCACCCTGTCATTCCTCTGGAAGGTGTCCGTCATCACCTTGGTCAGCTGTCTCCCCCTCTATGTCCTCAAGTACCTGC

GGAGACGGTTCTCCCCACCCAGCTACTCGAAGCTCACTTCCTAAAGCTGCAGGGCTGCCTCGGGCAGGGCCTCCGGCCTCCGGCGCTCTCCCAGGAGGAG

GTCAAGTTCCACACGCACGAGCCGCCTCAGCTGGACGGTGCAGTCATGGCTGGCACATGAGGCTTCGCTGAGGCGACACTGGGCACCTAATGGGGATGGA

ACATTGGTGGAACCGGAGGGAGGGGCCTGAGAGCTGTACCTATCAGAACCTTGGGTGCTAAGCTGTGCTGAGGGGGAAGACGTGGGACCGGATGGCCCGT

CTGAGGTTTGTGGGGTCACTGTGCAAGCTTCCTTATGGTTTGAACCTCTTGTCATGTGATAAAAGTCTCTGTCTCGAA
Translation
MPGVG - UNI25456 - - UNI35184 - GCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG VLFSQFRYFFNFYFLLLA

CSQFVPEMRLGALYTYWVPL - UNI30596 - GFVLAVTIIREAVEEIRCYVRDKEMNSQVYSRLTSRG - UNI18023 - - UNI30596 - - 

UNI30959 - GTVKVKSSNIQVGDLILVEK - UNI13328 - - UNI18023 - - UNI30596 - - UNI30959 - NQRVPADMIFLRTSEK

NG - UNI13328 - - UNI21005 - - UNI30959 - GSCFLRTDQLDGETDWKLRLPVACTQRLPTAA - UNI21970 - DLLQIRSYVYAE

EPNIDIHNFLGTFTR - UNI21970 - EDSDPPISESLSIENTLWAGTVIASG GTVVGVVLYTGRELRSVMNTSDPRSK IGLFDLEVNCLTKILFG

ALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPIS SLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTG GTLTQNEMVFKR

LHLGTVAYGLDSMDEVQSHIFSIYTQ QSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQFEDSCRVYQASSPDE V

ALVQWTESVGLTLVGRDQSSMQLRTPGDQVLNLTILQVFPFTYESKRMGIIVR DESTGEITFYMKGADVVMAGIVQYNDWLEEE CGNMAREGLRVLVV

AKKSLTEEQYQDFE ARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIK VWMLTGDKLETATCTAKNAHLVTRNQD

IHVFRL VTNRGEAHLELNAFRRKHDCALVISGDSLE VCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVG GDGGNDVSMIQE

SDCGVGVEGK EGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQ AVFSSVFYFASVPLYQGFLIIG GYSTIYTMFPVFS

LVLDKDVKSEVAMLYPELYKDLLK GRPLSYKTFLIWVLISIYQG GSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELLSL

ACYIASLVFLHEFID DVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKLTS
Transcript ENSMUST00000109176
Sequence
GGGCGGGCGCGCGCGTGGGCGCAGCGCGGAGCGGGGCCCATGGTGCGGCCGTGTCCGTCGGTCGGGCCGCGCGGGCGGCTCCGCGCGTGGCCCGGCGCTC

GCGACCTCGCCCCTGCGCTGCGGGCCCGGCCCGCCCGCTGCCGGCGCCTTCTCCCCCTGCCCCGGGGCGGCGCGGAGGCCGCGGGGAGCGCAGGGGGCGC

GGCGGGCGGCGACATGACGGACAGCATCCCGCTGCAGCCCGTGCGCCACAAGAAGCGGGTGGACAGTAGGCCGCGCGCGGG - UNI25456 - - UNI

35184 - GTGCTGTGAGTGGCTGAGATGTTGCGGTGGAGGGGAGCCCAGGCCCCGTACTGTCTGGTTGGGACACCCCGAGAAGAGGGACCAGCGGTACC

CTCGAAATGTCATCAACAACCAGAAGTACAATTTCTTCACATTTCTTCCTGGG GTGTTGTTCAGCCAGTTCAGATACTTCTTCAACTTCTACTTCCTGC

TTCTCGCCTGCTCGCAGTTCGTCCCAGAGATGAGGCTTGGCGCCCTGTACACCTACTGGGTTCCTCTG - UNI30596 - GGCTTCGTGCTGGCTGTC

ACCATCATCCGTGAGGCAGTAGAGGAGATCCGATGTTATGTGCGTGACAAGGAGATGAACTCCCAGGTCTACAGCCGGCTCACGTCACGAG - UNI180

23 - - UNI30596 - - UNI30959 - GGACCGTGAAGGTGAAGAGTTCAAACATCCAGGTGGGAGACCTCATCCTTGTGGAAAAG - UNI1332

8 - - UNI18023 - - UNI30596 - - UNI30959 - AACCAGCGGGTCCCTGCTGACATGATCTTCCTGAGGACGTCAGAGAAAAACG - UN

I13328 - - UNI21005 - - UNI30959 - GCTCTTGCTTCTTGCGCACGGATCAGCTGGATGGAGAGACAGACTGGAAGCTTCGGCTCCCGGTG

GCCTGCACACAGAGGCTTCCCACGGCTGCT - UNI21970 - GACCTCCTGCAGATTCGGTCCTATGTGTACGCTGAAGAGCCCAACATCGACATTCA

CAACTTCCTGGGGACTTTCACCAGG - UNI21970 - GAAGACAGTGACCCTCCGATCAGTGAGAGTCTGAGCATTGAGAACACGCTGTGGGCCGGCA

CCGTCATAGCATCAG GCACTGTTGTAGGCGTTGTTCTCTACACTGGCAGAGAACTGCGGAGTGTCATGAATACTTCCGACCCCAGAAGTAAG ATTGGC

CTGTTCGACCTGGAGGTGAACTGCCTCACCAAGATCCTGTTTGGTGCGCTGGTGGTGGTGTCGCTGGTCATGGTGGCCCTGCAGCACTTTGCCGGCCGCT

GGTACCTGCAGATCATCCGCTTCCTGCTCCTGTTTTCCAACATCATTCCTATCAG CTTGCGTGTGAACTTGGACATGGGCAAGATCGTGTACAGCTGGG

TGATCCGCAGGGATTCCAAAATCCCCGGGACCGTGGTTCGTTCCAGCACAATTCCTGAGCAGCTGGGCAGGATTTCGTACTTGCTCACAGACAAGACAG 

GAACCCTGACCCAGAATGAGATGGTGTTCAAGCGGCTGCACCTGGGTACGGTGGCCTACGGCCTGGACTCCATGGACGAAGTGCAGAGTCACATCTTCAG

CATTTACACCCAG CAATCCCAGGATCCACCTGCTCAGAAGGGCCCCACGGTCACCACCAAGGTTCGGAGGACCATGAGCAGCCGTGTCCACGAGGCTGT

GAAGGCCATTGCACTCTGCCACAACGTGACACCCGTGTACGAGTCCAATGGTGTGACGGACCAGGCTGAGGCTGAGAAGCAGTTTGAGGACTCCTGCCGA

GTGTACCAGGCATCCAGCCCGGATGAG GTGGCTCTGGTCCAGTGGACAGAAAGTGTGGGACTGACGCTGGTGGGTCGAGACCAGTCCTCCATGCAGCTG

AGGACCCCTGGTGACCAGGTCCTGAATCTCACTATCCTTCAGGTCTTCCCGTTCACCTATGAGAGCAAGCGGATGGGCATCATCGTGCGG GATGAGTCC

ACGGGGGAAATCACGTTCTACATGAAGGGAGCAGACGTCGTCATGGCTGGCATTGTCCAGTACAACGACTGGCTGGAGGAGGAG TGTGGCAACATGGCC

CGGGAGGGACTACGTGTGCTGGTGGTAGCCAAGAAGTCCCTCACAGAGGAGCAGTACCAAGACTTTGAA GCCCGCTACGTCCAGGCTAAGCTGAGTGTG

CATGACCGCTCGCTGAAGGTGGCCACGGTGATCGAGAGCCTGGAGATGGAGATGGAGCTGCTGTGCCTGACTGGTGTGGAGGACCAGCTGCAGGCAGATG

TCAGGCCCACGCTGGAGACGCTGCGCAACGCTGGCATCAAG GTTTGGATGCTAACAGGGGACAAGCTGGAGACAGCCACGTGCACAGCCAAGAACGCAC

ATCTGGTGACCAGAAACCAAGATATCCATGTTTTCCGACTG GTGACCAACCGCGGGGAGGCCCACCTGGAGCTGAATGCCTTCCGTAGGAAGCATGACT

GTGCCCTGGTCATCTCTGGAGACTCCCTGGAG GTTTGCCTCAAATACTATGAGTACGAGTTCATGGAACTGGCCTGCCAGTGCCCGGCTGTGGTGTGCT

GCCGCTGTGCCCCAACCCAGAAGGCCCAGATTGTTCGGCTGCTCCAGGAACGCACCGGGAAGCTCACCTGTGCAGTAG GGGACGGAGGCAATGACGTCA

GCATGATCCAGGAATCCGACTGCGGCGTGGGCGTGGAGGGCAAG GAAGGGAAGCAGGCCTCGCTGGCAGCGGACTTCTCCATCACCCAGTTCAAGCATC

TCGGCCGCTTGCTCATGGTGCACGGTCGGAACAGCTACAAGCGCTCGGCGGCCCTCAGTCAGTTTGTGATCCACAGGAGCCTCTGCATCAGCACCATGCA

G GCTGTCTTCTCGTCTGTGTTCTACTTTGCATCCGTTCCTCTCTACCAAGGCTTCCTGATCATTGG GTATTCTACCATCTACACGATGTTTCCCGTGT

TCTCCCTGGTTTTGGACAAAGACGTGAAGTCGGAAGTCGCCATGTTGTATCCTGAGCTCTACAAGGACCTGCTTAAG GGGCGGCCACTGTCCTACAAGA

CGTTCTTAATTTGGGTGTTAATCAGCATCTATCAAG GGAGCACCATCATGTACGGGGCGCTGCTGCTGTTCGAGTCGGAGTTTGTACACATCGTGGCAA

TCTCCTTCACATCCCTCATCCTCACTGAGCTACTGATGGTGGCGCTCACCATCCAGACGTGGCACTGGCTCATGACAGTGGCCGAGCTACTCAGCCTGGC

CTGCTACATTGCCTCCCTGGTGTTCCTCCATGAGTTCATCG ATGTCTACTTCATTGCCACCCTGTCATTCCTCTGGAAGGTGTCCGTCATCACCTTGGT

CAGCTGTCTCCCCCTCTATGTCCTCAAGTACCTGCGGAGACGGTTCTCCCCACCCAGCTACTCGAAGCTCACTTCCTAAAGCTGCAGGGCTGCCTCGGGC

AGGGCCTCCGGCCTCCGGCGCTCTCCCAGGAGGAGGTCAAGTTCCACACGCACGAGCCGCCTCAGCTGGACGGTGCAGTCATGGCTGGCACATGAGGCTT

CGCTGAGGCGACACTGGGCACCTAATGGGGATGGAACATTGGTGGAACCGGAGGGAGGGGCCTGAGAGCTGTACCTATCAGAACCTTGGGTGCTAAGCTG

TGCTGAGGGGGAAGACGTGGGACCGGATGGCCCGTCTGAGGTTTGTGGGGTCACTGTGCAAGCTTCCTTATGGTTTGAACCTCTTGTCATGTGATAAAAG

TCTCTGTCTCGAA
Translation
MVRPCPSVGPRGRLRAWPGARDLAPALRARPARCRRLLPLPRGGAEAAGSAGGAAGGDMTDSIPLQPVRHKKRVDSRPRAG - UNI25456 - - UNI

35184 - GCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG VLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTYWVPL - U

NI30596 - GFVLAVTIIREAVEEIRCYVRDKEMNSQVYSRLTSRG - UNI18023 - - UNI30596 - - UNI30959 - GTVKVKSSNIQVG

DLILVEK - UNI13328 - - UNI18023 - - UNI30596 - - UNI30959 - NQRVPADMIFLRTSEKNG - UNI13328 - - UNI210

05 - - UNI30959 - GSCFLRTDQLDGETDWKLRLPVACTQRLPTAA - UNI21970 - DLLQIRSYVYAEEPNIDIHNFLGTFTR - UNI219

70 - EDSDPPISESLSIENTLWAGTVIASG GTVVGVVLYTGRELRSVMNTSDPRSK IGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQII

RFLLLFSNIIPIS SLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTG GTLTQNEMVFKRLHLGTVAYGLDSMDEVQSHIFSIY

TQ QSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQFEDSCRVYQASSPDE VALVQWTESVGLTLVGRDQSSMQLR

TPGDQVLNLTILQVFPFTYESKRMGIIVR DESTGEITFYMKGADVVMAGIVQYNDWLEEE CGNMAREGLRVLVVAKKSLTEEQYQDFE ARYVQAKLS

VHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIK VWMLTGDKLETATCTAKNAHLVTRNQDIHVFRL VTNRGEAHLELNAFRRK

HDCALVISGDSLE VCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVG GDGGNDVSMIQESDCGVGVEGK EGKQASLAADFSI

TQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQ AVFSSVFYFASVPLYQGFLIIG GYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLK

 GRPLSYKTFLIWVLISIYQG GSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEFID DVYFIATL

SFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKLTS
Transcript ENSMUST00000029060
Sequence
GCGGGCGGGCGCGCGCGTGGGCGCAGCGCGGAGCGGGGCCCATGGTGCGGCCGTGTCCGTCGGTCGGGCCGCGCGGGCGGCTCCGCGCGTGGCCCGGCGC

TCGCGACCTCGCCCCTGCGCTGCGGGCCCGGCCCGCCCGCTGCCGGCGCCTTCTCCCCCTGCCCCGGGGCGGCGCGGAGGCCGCGGGGAGCGCAGGGGGC

GCGGCGGGCGGCGACATGACGGACAGCATCCCGCTGCAGCCCGTGCGCCACAAGAAGCGGGTGGACAGTAGGCCGCGCGCGGG - UNI25456 - - U

NI35184 - GTGCTGTGAGTGGCTGAGATGTTGCGGTGGAGGGGAGCCCAGGCCCCGTACTGTCTGGTTGGGACACCCCGAGAAGAGGGACCAGCGGTA

CCCTCGAAATGTCATCAACAACCAGAAGTACAATTTCTTCACATTTCTTCCTGGG GTGTTGTTCAGCCAGTTCAGATACTTCTTCAACTTCTACTTCCT

GCTTCTCGCCTGCTCGCAGTTCGTCCCAGAGATGAGGCTTGGCGCCCTGTACACCTACTGGGTTCCTCTG - UNI30596 - GGCTTCGTGCTGGCTG

TCACCATCATCCGTGAGGCAGTAGAGGAGATCCGATGTTATGTGCGTGACAAGGAGATGAACTCCCAGGTCTACAGCCGGCTCACGTCACGAG - UNI1

8023 - - UNI30596 - - UNI30959 - GGACCGTGAAGGTGAAGAGTTCAAACATCCAGGTGGGAGACCTCATCCTTGTGGAAAAG - UNI13

328 - - UNI18023 - - UNI30596 - - UNI30959 - AACCAGCGGGTCCCTGCTGACATGATCTTCCTGAGGACGTCAGAGAAAAACG - 

UNI13328 - - UNI21005 - - UNI30959 - GCTCTTGCTTCTTGCGCACGGATCAGCTGGATGGAGAGACAGACTGGAAGCTTCGGCTCCCGG

TGGCCTGCACACAGAGGCTTCCCACGGCTGCT - UNI21970 - GACCTCCTGCAGATTCGGTCCTATGTGTACGCTGAAGAGCCCAACATCGACATT

CACAACTTCCTGGGGACTTTCACCAGG - UNI21970 - GAAGACAGTGACCCTCCGATCAGTGAGAGTCTGAGCATTGAGAACACGCTGTGGGCCGG

CACCGTCATAGCATCAG GCACTGTTGTAGGCGTTGTTCTCTACACTGGCAGAGAACTGCGGAGTGTCATGAATACTTCCGACCCCAGAAGTAAG ATTG

GCCTGTTCGACCTGGAGGTGAACTGCCTCACCAAGATCCTGTTTGGTGCGCTGGTGGTGGTGTCGCTGGTCATGGTGGCCCTGCAGCACTTTGCCGGCCG

CTGGTACCTGCAGATCATCCGCTTCCTGCTCCTGTTTTCCAACATCATTCCTATCAG CTTGCGTGTGAACTTGGACATGGGCAAGATCGTGTACAGCTG

GGTGATCCGCAGGGATTCCAAAATCCCCGGGACCGTGGTTCGTTCCAGCACAATTCCTGAGCAGCTGGGCAGGATTTCGTACTTGCTCACAGACAAGACA

G GAACCCTGACCCAGAATGAGATGGTGTTCAAGCGGCTGCACCTGGGTACGGTGGCCTACGGCCTGGACTCCATGGACGAAGTGCAGAGTCACATCTTC

AGCATTTACACCCAG CAATCCCAGGATCCACCTGCTCAGAAGGGCCCCACGGTCACCACCAAGGTTCGGAGGACCATGAGCAGCCGTGTCCACGAGGCT

GTGAAGGCCATTGCACTCTGCCACAACGTGACACCCGTGTACGAGTCCAATGGTGTGACGGACCAGGCTGAGGCTGAGAAGCAGTTTGAGGACTCCTGCC

GAGTGTACCAGGCATCCAGCCCGGATGAG GTGGCTCTGGTCCAGTGGACAGAAAGTGTGGGACTGACGCTGGTGGGTCGAGACCAGTCCTCCATGCAGC

TGAGGACCCCTGGTGACCAGGTCCTGAATCTCACTATCCTTCAGGTCTTCCCGTTCACCTATGAGAGCAAGCGGATGGGCATCATCGTGCGG GATGAGT

CCACGGGGGAAATCACGTTCTACATGAAGGGAGCAGACGTCGTCATGGCTGGCATTGTCCAGTACAACGACTGGCTGGAGGAGGAG TGTGGCAACATGG

CCCGGGAGGGACTACGTGTGCTGGTGGTAGCCAAGAAGTCCCTCACAGAGGAGCAGTACCAAGACTTTGAA GCCCGCTACGTCCAGGCTAAGCTGAGTG

TGCATGACCGCTCGCTGAAGGTGGCCACGGTGATCGAGAGCCTGGAGATGGAGATGGAGCTGCTGTGCCTGACTGGTGTGGAGGACCAGCTGCAGGCAGA

TGTCAGGCCCACGCTGGAGACGCTGCGCAACGCTGGCATCAAG GTTTGGATGCTAACAGGGGACAAGCTGGAGACAGCCACGTGCACAGCCAAGAACGC

ACATCTGGTGACCAGAAACCAAGATATCCATGTTTTCCGACTG GTGACCAACCGCGGGGAGGCCCACCTGGAGCTGAATGCCTTCCGTAGGAAGCATGA

CTGTGCCCTGGTCATCTCTGGAGACTCCCTGGAG GTTTGCCTCAAATACTATGAGTACGAGTTCATGGAACTGGCCTGCCAGTGCCCGGCTGTGGTGTG

CTGCCGCTGTGCCCCAACCCAGAAGGCCCAGATTGTTCGGCTGCTCCAGGAACGCACCGGGAAGCTCACCTGTGCAGTAG GGGACGGAGGCAATGACGT

CAGCATGATCCAGGAATCCGACTGCGGCGTGGGCGTGGAGGGCAAG GAAGGGAAGCAGGCCTCGCTGGCAGCGGACTTCTCCATCACCCAGTTCAAGCA

TCTCGGCCGCTTGCTCATGGTGCACGGTCGGAACAGCTACAAGCGCTCGGCGGCCCTCAGTCAGTTTGTGATCCACAGGAGCCTCTGCATCAGCACCATG

CAG GCTGTCTTCTCGTCTGTGTTCTACTTTGCATCCGTTCCTCTCTACCAAGGCTTCCTGATCATTGG GTATTCTACCATCTACACGATGTTTCCCGT

GTTCTCCCTGGTTTTGGACAAAGACGTGAAGTCGGAAGTCGCCATGTTGTATCCTGAGCTCTACAAGGACCTGCTTAAG GGGCGGCCACTGTCCTACAA

GACGTTCTTAATTTGGGTGTTAATCAGCATCTATCAAG GGAGCACCATCATGTACGGGGCGCTGCTGCTGTTCGAGTCGGAGTTTGTACACATCGTGGC

AATCTCCTTCACATCCCTCATCCTCACTGAGCTACTGATGGTGGCGCTCACCATCCAGACGTGGCACTGGCTCATGACAGTGGCCGAGCTACTCAGCCTG

GCCTGCTACATTGCCTCCCTGGTGTTCCTCCATGAGTTCATCG ATGTCTACTTCATTGCCACCCTGTCATTCCTCTGGAAGGTGTCCGTCATCACCTTG

GTCAGCTGTCTCCCCCTCTATGTCCTCAAGTACCTGCGGAGACGGTTCTCCCCACCCAGCTACTCGAAGCTCACTTCCTAAAGCTGCAGGGCTGCCTCGG

GCAGGGCCTCCGGCCTCCGGCGCTCTCCCAGGAGGAGGTCAAGTTCCACACGCACGAGCCGCCTCAGCTGGACGGTGCAGTCATGGCTGGCACATGAGGC

TTCGCTGAGGCGACACTGGGCACCTAATGGGGATGGAACATTGGTGGAACCGGAGGGAGGGGCCTGAGAGCTGTACCTATCAGAACCTTGGGTGCTAAGC

TGTGCTGAGGGGGAAGACGTGGGACCGGATGGCCCGTCTGAGGTTTGTGGGGTCACTGTGCAAGCTTCCTTATGGTTTGAACCTCTTGTC
Translation
MTDSIPLQPVRHKKRVDSRPRAG - UNI25456 - - UNI35184 - GCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG 

VLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTYWVPL - UNI30596 - GFVLAVTIIREAVEEIRCYVRDKEMNSQVYSRLTSRG - UNI18023

 - - UNI30596 - - UNI30959 - GTVKVKSSNIQVGDLILVEK - UNI13328 - - UNI18023 - - UNI30596 - - UNI30959 

- NQRVPADMIFLRTSEKNG - UNI13328 - - UNI21005 - - UNI30959 - GSCFLRTDQLDGETDWKLRLPVACTQRLPTAA - UNI21

970 - DLLQIRSYVYAEEPNIDIHNFLGTFTR - UNI21970 - EDSDPPISESLSIENTLWAGTVIASG GTVVGVVLYTGRELRSVMNTSDPRSK

 IGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPIS SLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLL

TDKTG GTLTQNEMVFKRLHLGTVAYGLDSMDEVQSHIFSIYTQ QSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEK

QFEDSCRVYQASSPDE VALVQWTESVGLTLVGRDQSSMQLRTPGDQVLNLTILQVFPFTYESKRMGIIVR DESTGEITFYMKGADVVMAGIVQYNDWL

EEE CGNMAREGLRVLVVAKKSLTEEQYQDFE ARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIK VWMLTGDKL

ETATCTAKNAHLVTRNQDIHVFRL VTNRGEAHLELNAFRRKHDCALVISGDSLE VCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKL

TCAVG GDGGNDVSMIQESDCGVGVEGK EGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQ AVFSSVFYFASVPLYQGF

LIIG GYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLK GRPLSYKTFLIWVLISIYQG GSTIMYGALLLFESEFVHIVAISFTSLILTELLMVA

LTIQTWHWLMTVAELLSLACYIASLVFLHEFID DVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKLTS
Transcript ENSMUST00000109175
Sequence
ATGTGTGAATGTCAGCCCAG - UNI25456 - - UNI35184 - GTGCTGTGAGTGGCTGAGATGTTGCGGTGGAGGGGAGCCCAGGCCCCGTACTG

TCTGGTTGGGACACCCCGAGAAGAGGGACCAGCGGTACCCTCGAAATGTCATCAACAACCAGAAGTACAATTTCTTCACATTTCTTCCTGGG GTGTTGT

TCAGCCAGTTCAGATACTTCTTCAACTTCTACTTCCTGCTTCTCGCCTGCTCGCAGTTCGTCCCAGAGATGAGGCTTGGCGCCCTGTACACCTACTGGGT

TCCTCTG - UNI30596 - GGCTTCGTGCTGGCTGTCACCATCATCCGTGAGGCAGTAGAGGAGATCCGATGTTATGTGCGTGACAAGGAGATGAACT

CCCAGGTCTACAGCCGGCTCACGTCACGAG - UNI18023 - - UNI30596 - - UNI30959 - GGACCGTGAAGGTGAAGAGTTCAAACATCC

AGGTGGGAGACCTCATCCTTGTGGAAAAG - UNI13328 - - UNI18023 - - UNI30596 - - UNI30959 - AACCAGCGGGTCCCTGCT

GACATGATCTTCCTGAGGACGTCAGAGAAAAACG - UNI13328 - - UNI21005 - - UNI30959 - GCTCTTGCTTCTTGCGCACGGATCAG

CTGGATGGAGAGACAGACTGGAAGCTTCGGCTCCCGGTGGCCTGCACACAGAGGCTTCCCACGGCTGCT - UNI21970 - GACCTCCTGCAGATTCG

GTCCTATGTGTACGCTGAAGAGCCCAACATCGACATTCACAACTTCCTGGGGACTTTCACCAGG - UNI21970 - GAAGACAGTGACCCTCCGATCA

GTGAGAGTCTGAGCATTGAGAACACGCTGTGGGCCGGCACCGTCATAGCATCAG GCACTGTTGTAGGCGTTGTTCTCTACACTGGCAGAGAACTGCGGA

GTGTCATGAATACTTCCGACCCCAGAAGTAAG ATTGGCCTGTTCGACCTGGAGGTGAACTGCCTCACCAAGATCCTGTTTGGTGCGCTGGTGGTGGTGT

CGCTGGTCATGGTGGCCCTGCAGCACTTTGCCGGCCGCTGGTACCTGCAGATCATCCGCTTCCTGCTCCTGTTTTCCAACATCATTCCTATCAG CTTGC

GTGTGAACTTGGACATGGGCAAGATCGTGTACAGCTGGGTGATCCGCAGGGATTCCAAAATCCCCGGGACCGTGGTTCGTTCCAGCACAATTCCTGAGCA

GCTGGGCAGGATTTCGTACTTGCTCACAGACAAGACAG GAACCCTGACCCAGAATGAGATGGTGTTCAAGCGGCTGCACCTGGGTACGGTGGCCTACGG

CCTGGACTCCATGGACGAAGTGCAGAGTCACATCTTCAGCATTTACACCCAG CAATCCCAGGATCCACCTGCTCAGAAGGGCCCCACGGTCACCACCAA

GGTTCGGAGGACCATGAGCAGCCGTGTCCACGAGGCTGTGAAGGCCATTGCACTCTGCCACAACGTGACACCCGTGTACGAGTCCAATGGTGTGACGGAC

CAGGCTGAGGCTGAGAAGCAGTTTGAGGACTCCTGCCGAGTGTACCAGGCATCCAGCCCGGATGAG GTGGCTCTGGTCCAGTGGACAGAAAGTGTGGGA

CTGACGCTGGTGGGTCGAGACCAGTCCTCCATGCAGCTGAGGACCCCTGGTGACCAGGTCCTGAATCTCACTATCCTTCAGGTCTTCCCGTTCACCTATG

AGAGCAAGCGGATGGGCATCATCGTGCGG GATGAGTCCACGGGGGAAATCACGTTCTACATGAAGGGAGCAGACGTCGTCATGGCTGGCATTGTCCAGT

ACAACGACTGGCTGGAGGAGGAG TGTGGCAACATGGCCCGGGAGGGACTACGTGTGCTGGTGGTAGCCAAGAAGTCCCTCACAGAGGAGCAGTACCAAG

ACTTTGAA GCCCGCTACGTCCAGGCTAAGCTGAGTGTGCATGACCGCTCGCTGAAGGTGGCCACGGTGATCGAGAGCCTGGAGATGGAGATGGAGCTGC

TGTGCCTGACTGGTGTGGAGGACCAGCTGCAGGCAGATGTCAGGCCCACGCTGGAGACGCTGCGCAACGCTGGCATCAAG GTTTGGATGCTAACAGGGG

ACAAGCTGGAGACAGCCACGTGCACAGCCAAGAACGCACATCTGGTGACCAGAAACCAAGATATCCATGTTTTCCGACTG GTGACCAACCGCGGGGAGG

CCCACCTGGAGCTGAATGCCTTCCGTAGGAAGCATGACTGTGCCCTGGTCATCTCTGGAGACTCCCTGGAG GTTTGCCTCAAATACTATGAGTACGAGT

TCATGGAACTGGCCTGCCAGTGCCCGGCTGTGGTGTGCTGCCGCTGTGCCCCAACCCAGAAGGCCCAGATTGTTCGGCTGCTCCAGGAACGCACCGGGAA

GCTCACCTGTGCAGTAG GGGACGGAGGCAATGACGTCAGCATGATCCAGGAATCCGACTGCGGCGTGGGCGTGGAGGGCAAG GAAGGGAAGCAGGCCT

CGCTGGCAGCGGACTTCTCCATCACCCAGTTCAAGCATCTCGGCCGCTTGCTCATGGTGCACGGTCGGAACAGCTACAAGCGCTCGGCGGCCCTCAGTCA

GTTTGTGATCCACAGGAGCCTCTGCATCAGCACCATGCAG GCTGTCTTCTCGTCTGTGTTCTACTTTGCATCCGTTCCTCTCTACCAAGGCTTCCTGAT

CATTGG GTATTCTACCATCTACACGATGTTTCCCGTGTTCTCCCTGGTTTTGGACAAAGACGTGAAGTCGGAAGTCGCCATGTTGTATCCTGAGCTCTA

CAAGGACCTGCTTAAG GGGCGGCCACTGTCCTACAAGACGTTCTTAATTTGGGTGTTAATCAGCATCTATCAAG GGAGCACCATCATGTACGGGGCGC

TGCTGCTGTTCGAGTCGGAGTTTGTACACATCGTGGCAATCTCCTTCACATCCCTCATCCTCACTGAGCTACTGATGGTGGCGCTCACCATCCAGACGTG

GCACTGGCTCATGACAGTGGCCGAGCTACTCAGCCTGGCCTGCTACATTGCCTCCCTGGTGTTCCTCCATGAGTTCATCG ATGTCTACTTCATTGCCAC

CCTGTCATTCCTCTGGAAGGTGTCCGTCATCACCTTGGTCAGCTGTCTCCCCCTCTATGTCCTCAAGTACCTGCGGAGACGGTTCTCCCCACCCAGCTAC

TCGAAGCTCACTTCCTAAAGCTGCAGGGCTGCCTCGGGCAGGGCCTCCGGCCTCCGGCGCTCTCCCAGGAGGAGGTCAAGTTCCACACGCACGAGCCGCC

TCAGCTGGACGGTGCAGTCATGGCTGGCACATGAGGCTTCGCTGAGGCGACACTGGGCACCTAATGGGGATGGAACATTGGTGGAACCGGAGGGAGGGGC

CTGAGAGCTGTACCTATCAGAACCTTGGGTGCTAAGCTGTGCTGAGGGGGAAGACGTGGGACCGGATGGCCCGTCTGAGGTTTGTGGGGTCACTGTGCAA

GCTTCCTTATGGTTTGAACCTCTTGTC
Translation
MCECQPR - UNI25456 - - UNI35184 - RCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG VLFSQFRYFFNFYFLL

LACSQFVPEMRLGALYTYWVPL - UNI30596 - GFVLAVTIIREAVEEIRCYVRDKEMNSQVYSRLTSRG - UNI18023 - - UNI30596 - 

- UNI30959 - GTVKVKSSNIQVGDLILVEK - UNI13328 - - UNI18023 - - UNI30596 - - UNI30959 - NQRVPADMIFLRTS

EKNG - UNI13328 - - UNI21005 - - UNI30959 - GSCFLRTDQLDGETDWKLRLPVACTQRLPTAA - UNI21970 - DLLQIRSYVY

AEEPNIDIHNFLGTFTR - UNI21970 - EDSDPPISESLSIENTLWAGTVIASG GTVVGVVLYTGRELRSVMNTSDPRSK IGLFDLEVNCLTKIL

FGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPIS SLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTG GTLTQNEMVF

KRLHLGTVAYGLDSMDEVQSHIFSIYTQ QSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQFEDSCRVYQASSPDE

 VALVQWTESVGLTLVGRDQSSMQLRTPGDQVLNLTILQVFPFTYESKRMGIIVR DESTGEITFYMKGADVVMAGIVQYNDWLEEE CGNMAREGLRVL

VVAKKSLTEEQYQDFE ARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIK VWMLTGDKLETATCTAKNAHLVTRN

QDIHVFRL VTNRGEAHLELNAFRRKHDCALVISGDSLE VCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVG GDGGNDVSMI

QESDCGVGVEGK EGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQ AVFSSVFYFASVPLYQGFLIIG GYSTIYTMFPV

FSLVLDKDVKSEVAMLYPELYKDLLK GRPLSYKTFLIWVLISIYQG GSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELL

SLACYIASLVFLHEFID DVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKLTS
Transcript ENSMUST00000109173
Sequence
ATAACAGGGGTGTG - UNI25456 - GTGCTGTGAGTGGCTGAGATGTTGCGGTGGAGGGGAGCCCAGGCCCCGTACTGTCTGGTTGGGACACCCCGA

GAAGAGGGACCAGCGGTACCCTCGAAATGTCATCAACAACCAGAAGTACAATTTCTTCACATTTCTTCCTGGG GTGTTGTTCAGCCAGTTCAGATACTT

CTTCAACTTCTACTTCCTGCTTCTCGCCTGCTCGCAGTTCGTCCCAGAGATGAGGCTTGGCGCCCTGTACACCTACTGGGTTCCTCTG - UNI30596 

- GGCTTCGTGCTGGCTGTCACCATCATCCGTGAGGCAGTAGAGGAGATCCGATGTTATGTGCGTGACAAGGAGATGAACTCCCAGGTCTACAGCCGGCT

CACGTCACGAG - UNI18023 - - UNI30596 - - UNI30959 - GGACCGTGAAGGTGAAGAGTTCAAACATCCAGGTGGGAGACCTCATCCT

TGTGGAAAAG - UNI13328 - - UNI18023 - - UNI30596 - - UNI30959 - AACCAGCGGGTCCCTGCTGACATGATCTTCCTGAGGA

CGTCAGAGAAAAACG - UNI13328 - - UNI21005 - - UNI30959 - GCTCTTGCTTCTTGCGCACGGATCAGCTGGATGGAGAGACAGACT

GGAAGCTTCGGCTCCCGGTGGCCTGCACACAGAGGCTTCCCACGGCTGCT - UNI21970 - GACCTCCTGCAGATTCGGTCCTATGTGTACGCTGAA

GAGCCCAACATCGACATTCACAACTTCCTGGGGACTTTCACCAGG - UNI21970 - GAAGACAGTGACCCTCCGATCAGTGAGAGTCTGAGCATTGA

GAACACGCTGTGGGCCGGCACCGTCATAGCATCAG GCACTGTTGTAGGCGTTGTTCTCTACACTGGCAGAGAACTGCGGAGTGTCATGAATACTTCCGA

CCCCAGAAGTAAG ATTGGCCTGTTCGACCTGGAGGTGAACTGCCTCACCAAGATCCTGTTTGGTGCGCTGGTGGTGGTGTCGCTGGTCATGGTGGCCCT

GCAGCACTTTGCCGGCCGCTGGTACCTGCAGATCATCCGCTTCCTGCTCCTGTTTTCCAACATCATTCCTATCAG CTTGCGTGTGAACTTGGACATGGG

CAAGATCGTGTACAGCTGGGTGATCCGCAGGGATTCCAAAATCCCCGGGACCGTGGTTCGTTCCAGCACAATTCCTGAGCAGCTGGGCAGGATTTCGTAC

TTGCTCACAGACAAGACAG GAACCCTGACCCAGAATGAGATGGTGTTCAAGCGGCTGCACCTGGGTACGGTGGCCTACGGCCTGGACTCCATGGACGAA

GTGCAGAGTCACATCTTCAGCATTTACACCCAG CAATCCCAGGATCCACCTGCTCAGAAGGGCCCCACGGTCACCACCAAGGTTCGGAGGACCATGAGC

AGCCGTGTCCACGAGGCTGTGAAGGCCATTGCACTCTGCCACAACGTGACACCCGTGTACGAGTCCAATGGTGTGACGGACCAGGCTGAGGCTGAGAAGC

AGTTTGAGGACTCCTGCCGAGTGTACCAGGCATCCAGCCCGGATGAG GTGGCTCTGGTCCAGTGGACAGAAAGTGTGGGACTGACGCTGGTGGGTCGAG

ACCAGTCCTCCATGCAGCTGAGGACCCCTGGTGACCAGGTCCTGAATCTCACTATCCTTCAGGTCTTCCCGTTCACCTATGAGAGCAAGCGGATGGGCAT

CATCGTGCGG GATGAGTCCACGGGGGAAATCACGTTCTACATGAAGGGAGCAGACGTCGTCATGGCTGGCATTGTCCAGTACAACGACTGGCTGGAGGA

GGAG TGTGGCAACATGGCCCGGGAGGGACTACGTGTGCTGGTGGTAGCCAAGAAGTCCCTCACAGAGGAGCAGTACCAAGACTTTGAA GCCCGCTACG

TCCAGGCTAAGCTGAGTGTGCATGACCGCTCGCTGAAGGTGGCCACGGTGATCGAGAGCCTGGAGATGGAGATGGAGCTGCTGTGCCTGACTGGTGTGGA

GGACCAGCTGCAGGCAGATGTCAGGCCCACGCTGGAGACGCTGCGCAACGCTGGCATCAAG GTTTGGATGCTAACAGGGGACAAGCTGGAGACAGCCAC

GTGCACAGCCAAGAACGCACATCTGGTGACCAGAAACCAAGATATCCATGTTTTCCGACTG GTGACCAACCGCGGGGAGGCCCACCTGGAGCTGAATGC

CTTCCGTAGGAAGCATGACTGTGCCCTGGTCATCTCTGGAGACTCCCTGGAG GTTTGCCTCAAATACTATGAGTACGAGTTCATGGAACTGGCCTGCCA

GTGCCCGGCTGTGGTGTGCTGCCGCTGTGCCCCAACCCAGAAGGCCCAGATTGTTCGGCTGCTCCAGGAACGCACCGGGAAGCTCACCTGTGCAGTAG G

GGACGGAGGCAATGACGTCAGCATGATCCAGGAATCCGACTGCGGCGTGGGCGTGGAGGGCAAG GAAGGGAAGCAGGCCTCGCTGGCAGCGGACTTCTC

CATCACCCAGTTCAAGCATCTCGGCCGCTTGCTCATGGTGCACGGTCGGAACAGCTACAAGCGCTCGGCGGCCCTCAGTCAGTTTGTGATCCACAGGAGC

CTCTGCATCAGCACCATGCAG GCTGTCTTCTCGTCTGTGTTCTACTTTGCATCCGTTCCTCTCTACCAAGGCTTCCTGATCATTGG GTATTCTACCAT

CTACACGATGTTTCCCGTGTTCTCCCTGGTTTTGGACAAAGACGTGAAGTCGGAAGTCGCCATGTTGTATCCTGAGCTCTACAAGGACCTGCTTAAG GG

GCGGCCACTGTCCTACAAGACGTTCTTAATTTGGGTGTTAATCAGCATCTATCAAG GGAGCACCATCATGTACGGGGCGCTGCTGCTGTTCGAGTCGGA

GTTTGTACACATCGTGGCAATCTCCTTCACATCCCTCATCCTCACTGAGCTACTGATGGTGGCGCTCACCATCCAGACGTGGCACTGGCTCATGACAGTG

GCCGAGCTACTCAGCCTGGCCTGCTACATTGCCTCCCTGGTGTTCCTCCATGAGTTCATCG ATGTCTACTTCATTGCCACCCTGTCATTCCTCTGGAAG

GTGTCCGTCATCACCTTGGTCAGCTGTCTCCCCCTCTATGTCCTCAAGTACCTGCGGAGACGGTTCTCCCCACCCAGCTACTCGAAGCTCACTTCCTAAA

GCTGCAGGGCTGCCTCGGGCAGGGCCTCCGGCCTCCGGCGCTCTCCCAGGAGGAGGTCAAGTTCCACACGCACGAGCCGCCTCAGCTGGACGGTGCAGTC

ATGGCTGGCACATGAGGCTTCGCTGAGGCGACACTGGGCACCTAATGGGGATGGAACATTGGTGGAACCGGAGGGAGGGGCCTGAGAGCTGTACCTATCA

GAACCTTGGGTGCTAAGCTGTGCTGAGGGGGAAGACGTGGGACCGGATGGCCCGTCTGAGGTTTGTGGGGTCACTGTGCAAGCTTCCTTATGGTTTGAAC

CTCTTGTC
Translation
ITGVW - UNI25456 - WCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG VLFSQFRYFFNFYFLLLACSQFVPEMRLGAL

YTYWVPL - UNI30596 - GFVLAVTIIREAVEEIRCYVRDKEMNSQVYSRLTSRG - UNI18023 - - UNI30596 - - UNI30959 - GT

VKVKSSNIQVGDLILVEK - UNI13328 - - UNI18023 - - UNI30596 - - UNI30959 - NQRVPADMIFLRTSEKNG - UNI13328

 - - UNI21005 - - UNI30959 - GSCFLRTDQLDGETDWKLRLPVACTQRLPTAA - UNI21970 - DLLQIRSYVYAEEPNIDIHNFLGTF

TR - UNI21970 - EDSDPPISESLSIENTLWAGTVIASG GTVVGVVLYTGRELRSVMNTSDPRSK IGLFDLEVNCLTKILFGALVVVSLVMVALQ

HFAGRWYLQIIRFLLLFSNIIPIS SLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTG GTLTQNEMVFKRLHLGTVAYGLDSM

DEVQSHIFSIYTQ QSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQFEDSCRVYQASSPDE VALVQWTESVGLTL

VGRDQSSMQLRTPGDQVLNLTILQVFPFTYESKRMGIIVR DESTGEITFYMKGADVVMAGIVQYNDWLEEE CGNMAREGLRVLVVAKKSLTEEQYQDF

E ARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIK VWMLTGDKLETATCTAKNAHLVTRNQDIHVFRL VTNRGE

AHLELNAFRRKHDCALVISGDSLE VCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVG GDGGNDVSMIQESDCGVGVEGK EG

KQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQ AVFSSVFYFASVPLYQGFLIIG GYSTIYTMFPVFSLVLDKDVKSEVAM

LYPELYKDLLK GRPLSYKTFLIWVLISIYQG GSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEF

ID DVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKLTS
Transcript ENSMUST00000109171
Sequence
ATGCAGCTGGAGAGAGGGGTGGGATTGATGCCACAGGGTGTGTGGGGGTCCGAAAACCTGCCCACCTTCTCCCCCCAACCCCGGCCCGAAACTCGGGGGA

CCCCAGCGCGAGGCGCAGGTTGCAGCAGAGGAGGCAGGCTGTGCGCGCGAGTGGCCGCGGCGTGGAG - UNI25456 - - UNI35184 - GTGCTG

TGAGTGGCTGAGATGTTGCGGTGGAGGGGAGCCCAGGCCCCGTACTGTCTGGTTGGGACACCCCGAGAAGAGGGACCAGCGGTACCCTCGAAATGTCATC

AACAACCAGAAGTACAATTTCTTCACATTTCTTCCTGGG GTGTTGTTCAGCCAGTTCAGATACTTCTTCAACTTCTACTTCCTGCTTCTCGCCTGCTCG

CAGTTCGTCCCAGAGATGAGGCTTGGCGCCCTGTACACCTACTGGGTTCCTCTG - UNI30596 - GGCTTCGTGCTGGCTGTCACCATCATCCGTGA

GGCAGTAGAGGAGATCCGATGTTATGTGCGTGACAAGGAGATGAACTCCCAGGTCTACAGCCGGCTCACGTCACGAG - UNI18023 - - UNI3059

6 - - UNI30959 - GGACCGTGAAGGTGAAGAGTTCAAACATCCAGGTGGGAGACCTCATCCTTGTGGAAAAG - UNI13328 - - UNI18023

 - - UNI30596 - - UNI30959 - AACCAGCGGGTCCCTGCTGACATGATCTTCCTGAGGACGTCAGAGAAAAACG - UNI13328 - - UNI

21005 - - UNI30959 - GCTCTTGCTTCTTGCGCACGGATCAGCTGGATGGAGAGACAGACTGGAAGCTTCGGCTCCCGGTGGCCTGCACACAGAG

GCTTCCCACGGCTGCT - UNI21970 - GACCTCCTGCAGATTCGGTCCTATGTGTACGCTGAAGAGCCCAACATCGACATTCACAACTTCCTGGGGA

CTTTCACCAGG - UNI21970 - GAAGACAGTGACCCTCCGATCAGTGAGAGTCTGAGCATTGAGAACACGCTGTGGGCCGGCACCGTCATAGCATCA

G GCACTGTTGTAGGCGTTGTTCTCTACACTGGCAGAGAACTGCGGAGTGTCATGAATACTTCCGACCCCAGAAGTAAG ATTGGCCTGTTCGACCTGGA

GGTGAACTGCCTCACCAAGATCCTGTTTGGTGCGCTGGTGGTGGTGTCGCTGGTCATGGTGGCCCTGCAGCACTTTGCCGGCCGCTGGTACCTGCAGATC

ATCCGCTTCCTGCTCCTGTTTTCCAACATCATTCCTATCAG CTTGCGTGTGAACTTGGACATGGGCAAGATCGTGTACAGCTGGGTGATCCGCAGGGAT

TCCAAAATCCCCGGGACCGTGGTTCGTTCCAGCACAATTCCTGAGCAGCTGGGCAGGATTTCGTACTTGCTCACAGACAAGACAG GAACCCTGACCCAG

AATGAGATGGTGTTCAAGCGGCTGCACCTGGGTACGGTGGCCTACGGCCTGGACTCCATGGACGAAGTGCAGAGTCACATCTTCAGCATTTACACCCAG 

CAATCCCAGGATCCACCTGCTCAGAAGGGCCCCACGGTCACCACCAAGGTTCGGAGGACCATGAGCAGCCGTGTCCACGAGGCTGTGAAGGCCATTGCAC

TCTGCCACAACGTGACACCCGTGTACGAGTCCAATGGTGTGACGGACCAGGCTGAGGCTGAGAAGCAGTTTGAGGACTCCTGCCGAGTGTACCAGGCATC

CAGCCCGGATGAG GTGGCTCTGGTCCAGTGGACAGAAAGTGTGGGACTGACGCTGGTGGGTCGAGACCAGTCCTCCATGCAGCTGAGGACCCCTGGTGA

CCAGGTCCTGAATCTCACTATCCTTCAGGTCTTCCCGTTCACCTATGAGAGCAAGCGGATGGGCATCATCGTGCGG GATGAGTCCACGGGGGAAATCAC

GTTCTACATGAAGGGAGCAGACGTCGTCATGGCTGGCATTGTCCAGTACAACGACTGGCTGGAGGAGGAG TGTGGCAACATGGCCCGGGAGGGACTACG

TGTGCTGGTGGTAGCCAAGAAGTCCCTCACAGAGGAGCAGTACCAAGACTTTGAA GCCCGCTACGTCCAGGCTAAGCTGAGTGTGCATGACCGCTCGCT

GAAGGTGGCCACGGTGATCGAGAGCCTGGAGATGGAGATGGAGCTGCTGTGCCTGACTGGTGTGGAGGACCAGCTGCAGGCAGATGTCAGGCCCACGCTG

GAGACGCTGCGCAACGCTGGCATCAAG GTTTGGATGCTAACAGGGGACAAGCTGGAGACAGCCACGTGCACAGCCAAGAACGCACATCTGGTGACCAGA

AACCAAGATATCCATGTTTTCCGACTG GTGACCAACCGCGGGGAGGCCCACCTGGAGCTGAATGCCTTCCGTAGGAAGCATGACTGTGCCCTGGTCATC

TCTGGAGACTCCCTGGAG GTTTGCCTCAAATACTATGAGTACGAGTTCATGGAACTGGCCTGCCAGTGCCCGGCTGTGGTGTGCTGCCGCTGTGCCCCA

ACCCAGAAGGCCCAGATTGTTCGGCTGCTCCAGGAACGCACCGGGAAGCTCACCTGTGCAGTAG GGGACGGAGGCAATGACGTCAGCATGATCCAGGAA

TCCGACTGCGGCGTGGGCGTGGAGGGCAAG GAAGGGAAGCAGGCCTCGCTGGCAGCGGACTTCTCCATCACCCAGTTCAAGCATCTCGGCCGCTTGCTC

ATGGTGCACGGTCGGAACAGCTACAAGCGCTCGGCGGCCCTCAGTCAGTTTGTGATCCACAGGAGCCTCTGCATCAGCACCATGCAG GCTGTCTTCTCG

TCTGTGTTCTACTTTGCATCCGTTCCTCTCTACCAAGGCTTCCTGATCATTGG GTATTCTACCATCTACACGATGTTTCCCGTGTTCTCCCTGGTTTTG

GACAAAGACGTGAAGTCGGAAGTCGCCATGTTGTATCCTGAGCTCTACAAGGACCTGCTTAAG GGGCGGCCACTGTCCTACAAGACGTTCTTAATTTGG

GTGTTAATCAGCATCTATCAAG GGAGCACCATCATGTACGGGGCGCTGCTGCTGTTCGAGTCGGAGTTTGTACACATCGTGGCAATCTCCTTCACATCC

CTCATCCTCACTGAGCTACTGATGGTGGCGCTCACCATCCAGACGTGGCACTGGCTCATGACAGTGGCCGAGCTACTCAGCCTGGCCTGCTACATTGCCT

CCCTGGTGTTCCTCCATGAGTTCATCG ATGTCTACTTCATTGCCACCCTGTCATTCCTCTGGAAGGTGTCCGTCATCACCTTGGTCAGCTGTCTCCCCC

TCTATGTCCTCAAGTACCTGCGGAGACGGTTCTCCCCACCCAGCTACTCGAAGCTCACTTCCTAAAGCTGCAGGGCTGCCTCGGGCAGGGCCTCCGGCCT

CCGGCGCTCTCCCAGGAGGAGGTCAAGTTCCACACGCACGAGCCGCCTCAGCTGGACGGTGCAGTCATGGCTGGCACATGAGGCTTCGCTGAGGCGACAC

TGGGCACCTAATGGGGATGGAACATTGGTGGAACCGGAGGGAGGGGCCTGAGAGCTGTACCTATCAGAACCTTGGGTGCTAAGCTGTGCTGAGGGGGAAG

ACGTGGGACCGGATGGCCCGTCTGAGGTTTGTGGGGTCACTGTGCAAGCTTCCTTATGGTTTGAACCTCTTGTC
Translation
MQLERGVGLMPQGVWGSENLPTFSPQPRPETRGTPARGAGCSRGGRLCARVAAAWR - UNI25456 - - UNI35184 - RCCEWLRCCGGGEPRPR

TVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG VLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTYWVPL - UNI30596 - GFVLAVTIIREAVEE

IRCYVRDKEMNSQVYSRLTSRG - UNI18023 - - UNI30596 - - UNI30959 - GTVKVKSSNIQ - UNI13328 - - UNI18023 - 

- UNI30596 - - UNI30959 -  - UNI13328 - - UNI21005 - - UNI30959 -  - UNI21970 -  - UNI21970 -       

             
Transcript ENSMUST00000109170
Sequence
ATGAT - UNI25456 - GTGCTGTGAGTGGCTGAGATGTTGCGGTGGAGGGGAGCCCAGGCCCCGTACTGTCTGGTTGGGACACCCCGAGAAGAGGGA

CCAGCGGTACCCTCGAAATGTCATCAACAACCAGAAGTACAATTTCTTCACATTTCTTCCTGGG GTGTTGTTCAGCCAGTTCAGATACTTCTTCAACTT

CTACTTCCTGCTTCTCGCCTGCTCGCAGTTCGTCCCAGAGATGAGGCTTGGCGCCCTGTACACCTACTGGGTTCCTCTG - UNI30596 - GGCTTCG

TGCTGGCTGTCACCATCATCCGTGAGGCAGTAGAGGAGATCCGATGTTATGTGCGTGACAAGGAGATGAACTCCCAGGTCTACAGCCGGCTCACGTCACG

AG - UNI18023 - - UNI30596 - - UNI30959 - GGACCGTGAAGGTGAAGAGTTCAAACATCCAGGTGGGAGACCTCATCCTTGTGGAAAA

G - UNI13328 - - UNI18023 - - UNI30596 - - UNI30959 - AACCAGCGGGTCCCTGCTGACATGATCTTCCTGAGGACGTCAGAGA

AAAACG - UNI13328 - - UNI21005 - - UNI30959 - GCTCTTGCTTCTTGCGCACGGATCAGCTGGATGGAGAGACAGACTGGAAGCTTC

GGCTCCCGGTGGCCTGCACACAGAGGCTTCCCACGGCTGCT - UNI21970 - GACCTCCTGCAGATTCGGTCCTATGTGTACGCTGAAGAGCCCAAC

ATCGACATTCACAACTTCCTGGGGACTTTCACCAGG - UNI21970 - GAAGACAGTGACCCTCCGATCAGTGAGAGTCTGAGCATTGAGAACACGCT

GTGGGCCGGCACCGTCATAGCATCAG GCACTGTTGTAGGCGTTGTTCTCTACACTGGCAGAGAACTGCGGAGTGTCATGAATACTTCCGACCCCAGAAG

TAAG ATTGGCCTGTTCGACCTGGAGGTGAACTGCCTCACCAAGATCCTGTTTGGTGCGCTGGTGGTGGTGTCGCTGGTCATGGTGGCCCTGCAGCACTT

TGCCGGCCGCTGGTACCTGCAGATCATCCGCTTCCTGCTCCTGTTTTCCAACATCATTCCTATCAG CTTGCGTGTGAACTTGGACATGGGCAAGATCGT

GTACAGCTGGGTGATCCGCAGGGATTCCAAAATCCCCGGGACCGTGGTTCGTTCCAGCACAATTCCTGAGCAGCTGGGCAGGATTTCGTACTTGCTCACA

GACAAGACAG GAACCCTGACCCAGAATGAGATGGTGTTCAAGCGGCTGCACCTGGGTACGGTGGCCTACGGCCTGGACTCCATGGACGAAGTGCAGAGT

CACATCTTCAGCATTTACACCCAG CAATCCCAGGATCCACCTGCTCAGAAGGGCCCCACGGTCACCACCAAGGTTCGGAGGACCATGAGCAGCCGTGTC

CACGAGGCTGTGAAGGCCATTGCACTCTGCCACAACGTGACACCCGTGTACGAGTCCAATGGTGTGACGGACCAGGCTGAGGCTGAGAAGCAGTTTGAGG

ACTCCTGCCGAGTGTACCAGGCATCCAGCCCGGATGAG GTGGCTCTGGTCCAGTGGACAGAAAGTGTGGGACTGACGCTGGTGGGTCGAGACCAGTCCT

CCATGCAGCTGAGGACCCCTGGTGACCAGGTCCTGAATCTCACTATCCTTCAGGTCTTCCCGTTCACCTATGAGAGCAAGCGGATGGGCATCATCGTGCG

G GATGAGTCCACGGGGGAAATCACGTTCTACATGAAGGGAGCAGACGTCGTCATGGCTGGCATTGTCCAGTACAACGACTGGCTGGAGGAGGAG TGTG

GCAACATGGCCCGGGAGGGACTACGTGTGCTGGTGGTAGCCAAGAAGTCCCTCACAGAGGAGCAGTACCAAGACTTTGAA GCCCGCTACGTCCAGGCTA

AGCTGAGTGTGCATGACCGCTCGCTGAAGGTGGCCACGGTGATCGAGAGCCTGGAGATGGAGATGGAGCTGCTGTGCCTGACTGGTGTGGAGGACCAGCT

GCAGGCAGATGTCAGGCCCACGCTGGAGACGCTGCGCAACGCTGGCATCAAG GTTTGGATGCTAACAGGGGACAAGCTGGAGACAGCCACGTGCACAGC

CAAGAACGCACATCTGGTGACCAGAAACCAAGATATCCATGTTTTCCGACTG GTGACCAACCGCGGGGAGGCCCACCTGGAGCTGAATGCCTTCCGTAG

GAAGCATGACTGTGCCCTGGTCATCTCTGGAGACTCCCTGGAG GTTTGCCTCAAATACTATGAGTACGAGTTCATGGAACTGGCCTGCCAGTGCCCGGC

TGTGGTGTGCTGCCGCTGTGCCCCAACCCAGAAGGCCCAGATTGTTCGGCTGCTCCAGGAACGCACCGGGAAGCTCACCTGTGCAGTAG GGGACGGAGG

CAATGACGTCAGCATGATCCAGGAATCCGACTGCGGCGTGGGCGTGGAGGGCAAG GAAGGGAAGCAGGCCTCGCTGGCAGCGGACTTCTCCATCACCCA

GTTCAAGCATCTCGGCCGCTTGCTCATGGTGCACGGTCGGAACAGCTACAAGCGCTCGGCGGCCCTCAGTCAGTTTGTGATCCACAGGAGCCTCTGCATC

AGCACCATGCAG GCTGTCTTCTCGTCTGTGTTCTACTTTGCATCCGTTCCTCTCTACCAAGGCTTCCTGATCATTGG GTATTCTACCATCTACACGAT

GTTTCCCGTGTTCTCCCTGGTTTTGGACAAAGACGTGAAGTCGGAAGTCGCCATGTTGTATCCTGAGCTCTACAAGGACCTGCTTAAG GGGCGGCCACT

GTCCTACAAGACGTTCTTAATTTGGGTGTTAATCAGCATCTATCAAG GGAGCACCATCATGTACGGGGCGCTGCTGCTGTTCGAGTCGGAGTTTGTACA

CATCGTGGCAATCTCCTTCACATCCCTCATCCTCACTGAGCTACTGATGGTGGCGCTCACCATCCAGACGTGGCACTGGCTCATGACAGTGGCCGAGCTA

CTCAGCCTGGCCTGCTACATTGCCTCCCTGGTGTTCCTCCATGAGTTCATCG ATGTCTACTTCATTGCCACCCTGTCATTCCTCTGGAAGGTGTCCGTC

ATCACCTTGGTCAGCTGTCTCCCCCTCTATGTCCTCAAGTACCTGCGGAGACGGTTCTCCCCACCCAGCTACTCGAAGCTCACTTCCTAAAGCTGCAGGG

C
Translation
MM - UNI25456 - MCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG VLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTY

WVPL - UNI30596 - GFVLAVTIIREAVEEIRCYVRDKE - UNI18023 - - UNI30596 - - UNI30959 -  - UNI13328 - - UN

I18023 - - UNI30596 - - UNI30959 -  - UNI13328 - - UNI21005 - - UNI30959 -  - UNI21970 -  - UNI21970

 -                    
Transcript ENSMUST00000109169
Sequence
CGGGGCGGCGCGGAGGCCGCGGGGAGCGCAGGGGGCGCGGCGGGCGGCGACATGACGGACAGCATCCCGCTGCAGCCCGTGCGCCACAAGAAGCGGGTGG

ACAGTAGGCCGCGCGCGGG - UNI25456 - - UNI35184 - GTGCTGTGAGTGGCTGAGATGTTGCGGTGGAGGGGAGCCCAGGCCCCGTACTGT

CTGGTTGGGACACCCCGAGAAGAGGGACCAGCGGTACCCTCGAAATGTCATCAACAACCAGAAGTACAATTTCTTCACATTTCTTCCTGGG GTGTTGTT

CAGCCAGTTCAGATACTTCTTCAACTTCTACTTCCTGCTTCTCGCCTGCTCGCAGTTCGTCCCAGAGATGAGGCTTGGCGCCCTGTACACCTACTGGGTT

CCTCTG GGT
Translation
MTDSIPLQPVRHKKRVDSRPRAG - UNI25456 - - UNI35184 - GCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG 

VLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTYWVPL G

For any suggestions or comments, please send an email to unitrap@crg.es