Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027582 (Zgpat)
Chromosomal location
Chr 2: 181099633 - 181118333 (+)
Description
zinc finger, CCCH-type with G patch domain Gene [Source:MGI (curated);Acc:Zgpat-002]
RefSeq_dna
NM_144894 NM_001048148 NM_023684 
RefSeq_peptide
NP_001041613.1 NP_659143.1 NP_076173.1 
UniGene
Mm.272712 Mm.440138 
MGI
MGI:2449939 MGI:1919949 
Uniprot/SWISSPROT
Q8VDM1 Q9EQR5 
Uniprot/SPTREMBL
Q05DS2 Q69Z90 A2AU20 Q3TW85 A2AU22 A2AU23 Q3T9B9 A2AU25 A2AU24 
Human Ortholog
ENSG00000197114 (ZGPAT)
Omim not available
UniTrap UNI29900
Vector Insertion
Chr 2: 181115079 - 181115500
Public Clones E028E03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087416
Sequence
GCAGAAGGCTAGCGCGTGAGCTTGGCTGGCGAGGGCGGAAGCCCTTCTAGCCTGCGAGCGCCGGCCGGAGGTGGGGTTGCGGGCCGCAGAGGACGGGGCG

GGTGACGTGCAGGTCCCCCTCGGCGGAACCGCGGCCCTCCTCAGGCTCCCTAGCGGTTTTGGGGGCGGCGTTGCCCTGAGTTGTTCTTACTGCTCTTCCT

CCTGTTTTTGTCTGCGGTAAAGGTTCCGAATCCTGCCTGCTGGGTCGGGATGGACGAGGACAACCTAGAGACTGCCCTGCAGACCTACCGGGCCCAGCTG

CAGCAGGTAGAGCTGGCGCTCGGTGCTGGCCTAGACGCTTCTGAGCAGGCGGACCTGCGTCAGCTGCAGGGCGATCTAAAGGAGCTGATTGAGCTCACCG

AGGCCAGCCTGTTGTCGGTCAGAAAGAGCAAGCTGCTGTCTACAGTGGACCAGGAGAGCCCAGCTCAAGAGGATGCTGAGTACCTGGCTTTCCAGAAGGC

CATTGCGGAGGAAGTGGAAGCGCCCGGCGCCCCCTGCAATGACTCGGAGACGGCCCCTGGGAGCGAGGTGCAGCCGGGATCCACCTCCTCTGCACTGGAG

GAGGAGGAGGAGGACCCAGATCTGGAGGAACTGAGCGGTGCTAAAGTGAATGCCCCCTACTACAGCGCTTGGGGCACGCTGGAGTATCACAACGCTATGG

TAGTGGGCGCCGAAGAGGCGGAGGATGGTTCTGCGTGCGTCCGAGTCCTCTACCTATACCCTACCCACAAGTCCCTGAAGCCCTGTCCGTTCTTCCTGGA

GGGAAAGTGCCGGTTCAAGGAGAACTGCAG GTTCTCCCATGGGCAGGTGGTATCTGTGGATGAGCTGCGTCCCTTTCAGGATCCAGACTTAAGCTTACT

GCAGACTGGCTCTGCATGTCTGGCCAAGCACCAGGATGGCCTGTGGCACCCAGCACGGATCACTG ATGTGGACAATGGCTACTATACCGTTAAGTTTGA

CTCATTGCTGCTGAAGGAGGCTGTAGTGGAGGGGGACAGCATCCTGCCTCCTCTGCGCACTGAGGCTACAGAGTCATCTGACTCAGACACTGGTGATGCA

AGTGACTCCAGCTATGCCAGAG TGGTGGAACCAAGCACGGTGGACACTGGGACCTGCAGTTCTGCCTTTGCTGGCTGGGAGGTACACACACGGGGCATT

GGCTCCAAACTCCTCGTCAAGATGGGCTATGAGTTTGGCAAGG GTTTGGGCCGGCATGCAGAAGGCCGGGTGGAGCCCATCCATGCTGTAGTGTTGCCT

AGAGGGAAATCACTGGACCAGTGTGCAGAGATACTGCAGAAGAAGACAAAGCGAGGCCAGGCTGGGTCCAACAGGCCTCCAAAATGCCGGAGGAGTGGTA

GTAGACCTGAGGGCCGCCCACCCCCCCGGAATGTGTTTGACTTTTTGAATGAAAAACTGCAAAGCCAGGTTCCTGGGACCCCAGATGCTGGGGTGGATAC

CCCAGAGAGAAGGAACAAAGACATGTATCACGCCAGCAAGAGCGCCAAGCAGGCTTTGAGCCTGCAGCTCTTCCAGACTGAGGAGAAGATTGAGCGGACC

CAACGGGACATCCGGGGCATCCAGGAGGCCCTAACCCGGAACACTGGCCGGTAT - UNI29900 - TCATCCCTAGCCCCACGGCCTGCTAGCATGGA

TCTTCTGCATCCACGCTGGCTAGAGATGTCCAGGGGCAGCACCAGGTCTCAGGTACCCAACTCTGCCTTCCCACCACGGCAGCTGCCCAGGGCCCCTCCT

GCTGCTCCTGCAACTGCACCTTCTACTAGCTCTGAGGCCACTTATTCCAATGTGGGGCTGGCTGCAATTCCCAGGGCCAGCCTGGCTGCTAGCCCTGTGG

TGTGGGCTGGAACACAGCTGACCATTAGTTGTGCCAGGCTTGGTCCTGGGGCCGAATATGCCTGCATCCAGAAGCACAAAGGGACAGAGCAAGGCTGCCA

AGAATTGCAGCAGAAGGCTAAGGTGATCCCAGCTACTCAGGTA
Translation
RFWGRRCPELFLLLFLLFLSAVKVPNPACWVGMDEDNLETALQTYRAQLQQVELALGAGLDASEQADLRQLQGDLKELIELTEASLLSVRKSKLLSTVDQ

ESPAQEDAEYLAFQKAIAEEVEAPGAPCNDSETAPGSEVQPGSTSSALEEEEEDPDLEELSGAKVNAPYYSAWGTLEYHNAMVVGAEEAEDGSACVRVLY

LYPTHKSLKPCPFFLEGKCRFKENCR RFSHGQVVSVDELRPFQDPDLSLLQTGSACLAKHQDGLWHPARITD DVDNGYYTVKFDSLLLKEAVVEGDSI

LPPLRTEATESSDSDTGDASDSSYARV VVEPSTVDTGTCSSAFAGWEVHTRGIGSKLLVKMGYEFGKG GLGRHAEGRVEPIHAVVLPRGKSLDQCAEI

LQKKTKRGQAGSNRPPKCRRSGSRPEGRPPPRNVFDFLNEKLQSQVPGTPDAGVDTPERRNKDMYHASKSAKQALSLQLFQTEEKIERTQRDIRGIQEAL

TRNTGRY - UNI29900 - SSLAPRPASMDLLHPRWLEMSRGSTRSQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVGLAAIPRASLAASPVVW

AGTQLTISCARLGPGAEYACIQKHKGTEQGCQELQQKAKVIPATQV
Transcript ENSMUST00000116366
Sequence
GCAGAAGGCTAGCGCGTGAGCTTGGCTGGCGAGGGCGGAAGCCCTTCTAGCCTGCGAGCGCCGGCCGGAGGTGGGGTTGCGGGCCGCAGAGGACGGGGCG

GGTGACGTGCAGGTCCCCCTCGGCGGAACCGCGGCCCTCCTCAGGCTCCCTAGCGGTTTTGGGGGCGGCGTTGCCCTGAGTTGTTCTTACTGCTCTTCCT

CCTGTTTTTGTCTGCGGTAAAGGTTCCGAATCCTGCCTGCTGGGTCGGGATGGACGAGGACAACCTAGAGACTGCCCTGCAGACCTACCGGGCCCAGCTG

CAGCAGGTAGAGCTGGCGCTCGGTGCTGGCCTAGACGCTTCTGAGCAGGCGGACCTGCGTCAGCTGCAGGGCGATCTAAAGGAGCTGATTGAGCTCACCG

AGGCCAGCCTGTTGTCGGTCAGAAAGAGCAAGCTGCTGTCTACAGTGGACCAGGAGAGCCCAGCTCAAGAGGATGCTGAGTACCTGGCTTTCCAGAAGGC

CATTGCGGAGGAAGTGGAAGCGCCCGGCGCCCCCTGCAATGACTCGGAGACGGCCCCTGGGAGCGAGGTGCAGCCGGGATCCACCTCCTCTGCACTGGAG

GAGGAGGAGGAGGACCCAGATCTGGAGGAACTGAGCGGTGCTAAAGTGAATGCCCCCTACTACAGCGCTTGGGGCACGCTGGAGTATCACAACGCTATGG

TAGTGGGCGCCGAAGAGGCGGAGGATGGTTCTGCGTGCGTCCGAGTCCTCTACCTATACCCTACCCACAAGTCCCTGAAGCCCTGTCCGTTCTTCCTGGA

GGGAAAGTGCCGGTTCAAGGAGAACTGCAG GTTCTCCCATGGGCAGGTGGTATCTGTGGATGAGCTGCGTCCCTTTCAGGATCCAGACTTAAGCTTACT

GCAGACTGGCTCTGCATGTCTGGCCAAGCACCAGGATGGCCTGTGGCACCCAGCACGGATCACTG ATGTGGACAATGGCTACTATACCGTTAAGTTTGA

CTCATTGCTGCTGAAGGAGGCTGTAGTGGAGGGGGACAGCATCCTGCCTCCTCTGCGCACTGAGGCTACAGAGTCATCTGACTCAGACACTGGTGATGCA

AGTGACTCCAGCTATGCCAGAG TGGTGGAACCAAGCACGGTGGACACTGGGACCTGCAGTTCTGCCTTTGCTGGCTGGGAGGTACACACACGGGGCATT

GGCTCCAAACTCCTCGTCAAGATGGGCTATGAGTTTGGCAAGG GTTTGGGCCGGCATGCAGAAGGCCGGGTGGAGCCCATCCATGCTGTAGTGTTGCCT

AGAGGGAAATCACTGGACCAGTGTGCAGAGATACTGCAGAAGAAGACAAAGCGAGGCCAGGCTGGGTCCAACAGGCCTCCAAAATGCCGGAGGAGTGGTA

GTAGACCTGAGGGCCGCCCACCCCCCCGGAATGTGTTTGACTTTTTGAATGAAAAACTGCAAAGCCAGGTTCCTGGGACCCCAGATGCTGGGGTGGATAC

CCCAGAGAGAAGGAACAAAGACATGTATCACGCCAGCAAGAGCGCCAAGCAGGCTTTGAGCCTGCAGCTCTTCCAGACTGAGGAGAAGATTGAGCGGACC

CAACGGGACATCCGGGGCATCCAGGAGGCCCTAACCCGGAACACTGGCCG - UNI29900 - GCACAATATGACGACAGCCCATCTGCAGGAGAAGCT

GGAGGGAGCCCAGCGGCAGCTGGGTCAGCTGCGTGCTCAGGAGGCTGACCTACAGAGGAAACAGCGGAAGGCAGACACTCACAGGAAGATGACAGAGTTC

TAGCGGCCCTGCCTGTATTGTGGATAGAGCCCTGGGACCCAGCTCCAAACTGCCTTGGCAGAAAGACAGCTGTCACCCTGATGCCTAAACAGCACCTGGA

AGAGGAACCAGCCCCTTCTTAGGATGCCCCTTAATTAGCCTTGTCAGCCTAGAGTGTGAACACTGCTGAGTAGAGGTGGGACATCAGGGCTGATTTTGAA

CACTTATCTGCCCACCAAGCCCACCTACCAGTGTCTTGGGGTGTCTCCTTAGGACATTAAAGTGATTTCATCACAATTCTCTCAGTGGAGACTCAGCTGG

CTTCAGGATTTCTGGGGACACAGGGATCTGTGTAGGTCCTGGGAGTAGACAGGTGGGCAGTGGGAGTACCAAATGAGGCCACTGCCTCTGTCTAGGGTCC

AAGAGTCCAAGAGAAAAACATTCTCCCTTTTCCCTTCTCTGACCAAGTGGGTAAGAACCTAAGGTGGCTCTTCAGTCCCAGTACTCACAAGCAGGTAGGG

TGTGTGAGATGGAAACACCTTAGGAATACAGTCAGTGAGAAAAGCAGGCAGACCTGGCTTGGGTGGGTTTGGGGTTCATTTCTGGTTTTTGGCTGCCACG

ATAATCCATCCAGTTCACCTGCTTTGTTCACCTCATTAATGGGTATCTGCCTCATTGGGGTGGAGGGGACTGTGCTGGTCTTTGTGGTAATTGCCTAGTG

ATAGCATTAGCCATGATGAGGTGTGAGGAGAGCAGAGACTGTGGGAGCAACTGCGCAAGAGCTGTGTGGCTGCTGGGAGGTGCTCTGAGAAACACAGGAA

GTGAGGTGAGGCGTCACCAGCAGCCCACAAAGATCTTCCTGGCTGTCCTAGACAGGGCCAAGCAGCAAATCCCCGGTGGCCTCG GGCTCTCTTCCCTGT

TTCACAGGATGAGGCCACCAGTGCCTTCAGCCCCACTAGCTCTCTGGGTCCTGGGCTGCTTCTCCCTGCTCCTTTGGCTATGGGCACTGTGCACAGCCTG

CCACAG GAAGAGAGCTCAGAGGCAGCAAACTGGGCTGCAGGACAGTTTGGTACCAGTGGAAATG CCACTGCTGAGACAGACCCACCTCTGCTCCCTCA

GCAAGTCTGACACCAGACTGCATGAGCTGCACCGAGGCCCACGCTCCAGCATAG CCCCACGGCCTGCTAGCATGGATCTTCTGCATCCACGCTGGCTAG

AGATGTCCAGGGGCAGCACCAGGTCTCAGGTACCCAACTCTGCCTTCCCACCACGGCAGCTGCCCAGGGCCCCTCCTGCTGCTCCTGCAACTGCACCTTC

TACTAGCTCTGAGGCCACTTATTCCAATGTGGGGCTGGCTGCAATTCCCAGGGCCAGCCTGGCTGCTAGCCCTGTGGTGTGGGCTGGAACACAGCTGACC

ATTAGTTGTGCCAGGCTTGGTCCTGGGGCCGAATATGCCTGCATCCAGAAGCACAAAGGGACAGAGCAAGGCTGCCAAGAATTGCAGCAGAAGGCTAAGG

TGATCCCAGCTACTCAG ATGGACGTCCTATACTCTAGGGTTTGCAAGCCTAAAAGAAGAGACCCAAGACCCGTCACAGACCAGCTGAACCTGCAGGATG

GGAGAACAAGTCTGCCGCTTGGGAGTGATGTGGAGTACGAGGCCATCAATCTCAGGGGCCAGGATATGAAGCAAGGGCCCTTAGAAAATGTGTATGAAAG

CATCAAGGAGATGGGCCTGTGAGCAGCTCAGGCCTTACATCCTGTCTTTAACATGAGTTAGGAAGAGTACCAAGGCTTCTGCTTCAGGATGGTTTGATTG

CAGATCCTTCTGTGTCCTTCCACCTCCACAGCTGGCAGCACAGCTATCAGGGCCAGTCCTTGAGGCCTAATTAAACCTCTGTTC
Translation
MDEDNLETALQTYRAQLQQVELALGAGLDASEQADLRQLQGDLKELIELTEASLLSVRKSKLLSTVDQESPAQEDAEYLAFQKAIAEEVEAPGAPCNDSE

TAPGSEVQPGSTSSALEEEEEDPDLEELSGAKVNAPYYSAWGTLEYHNAMVVGAEEAEDGSACVRVLYLYPTHKSLKPCPFFLEGKCRFKENCR RFSHG

QVVSVDELRPFQDPDLSLLQTGSACLAKHQDGLWHPARITD DVDNGYYTVKFDSLLLKEAVVEGDSILPPLRTEATESSDSDTGDASDSSYARV VVEP

STVDTGTCSSAFAGWEVHTRGIGSKLLVKMGYEFGKG GLGRHAEGRVEPIHAVVLPRGKSLDQCAEILQKKTKRGQAGSNRPPKCRRSGSRPEGRPPPR

NVFDFLNEKLQSQVPGTPDAGVDTPERRNKDMYHASKSAKQALSLQLFQTEEKIERTQRDIRGIQEALTRNTGR - UNI29900 - RHNMTTAHLQEK

LEGAQRQLGQLRAQEADLQRKQRKADTHRKMTEF     
Transcript ENSMUST00000029105
Sequence
TTTCATAATGCACCATCAATTCGGAGTCCTGAAAAGCCCGTGGCGGCCTGCTCTGCTCCGCCTTCCTAAGGCTCCTCTTTCCGAACCCTCAACTCAGAAC

CAGGAAACGCGGCCGGCGACTTAAGTCTAGGAAGCGACCAGAGAGGCAGAGCTCCTGAGGAGGGTCGGCTTCGGCTTCCCGCCGCCGCCGGGCCCACGGA

GCCTGGGAACCAGCAGCTGAAGCCACTTCCGTCCCCCTGTTCCAGGACTTTAGAACCCCGGCCCCTCAGTCCAGCTGAGGCCCACCCGTACCTGCTCAGA

TCTTGGAGGAGGAGCCGCCGCCGCCGCCGCCGCCGCCGCCGCGTTCCTAACCCCACCGACCTCACGCTGACCCCTCACAGTGCCTGACGGAACAAGGAGC

GAAGGACGGAGCACGGGCGGAATCGCATCCCAGCGGCCCCCGCGCGCAG GTTCCGAATCCTGCCTGCTGGGTCGGGATGGACGAGGACAACCTAGAGAC

TGCCCTGCAGACCTACCGGGCCCAGCTGCAGCAGGTAGAGCTGGCGCTCGGTGCTGGCCTAGACGCTTCTGAGCAGGCGGACCTGCGTCAGCTGCAGGGC

GATCTAAAGGAGCTGATTGAGCTCACCGAGGCCAGCCTGTTGTCGGTCAGAAAGAGCAAGCTGCTGTCTACAGTGGACCAGGAGAGCCCAGCTCAAGAGG

ATGCTGAGTACCTGGCTTTCCAGAAGGCCATTGCGGAGGAAGTGGAAGCGCCCGGCGCCCCCTGCAATGACTCGGAGACGGCCCCTGGGAGCGAGGTGCA

GCCGGGATCCACCTCCTCTGCACTGGAGGAGGAGGAGGAGGACCCAGATCTGGAGGAACTGAGCGGTGCTAAAGTGAATGCCCCCTACTACAGCGCTTGG

GGCACGCTGGAGTATCACAACGCTATGGTAGTGGGCGCCGAAGAGGCGGAGGATGGTTCTGCGTGCGTCCGAGTCCTCTACCTATACCCTACCCACAAGT

CCCTGAAGCCCTGTCCGTTCTTCCTGGAGGGAAAGTGCCGGTTCAAGGAGAACTGCAG GTTCTCCCATGGGCAGGTGGTATCTGTGGATGAGCTGCGTC

CCTTTCAGGATCCAGACTTAAGCTTACTGCAGACTGGCTCTGCATGTCTGGCCAAGCACCAGGATGGCCTGTGGCACCCAGCACGGATCACTG ATGTGG

ACAATGGCTACTATACCGTTAAGTTTGACTCATTGCTGCTGAAGGAGGCTGTAGTGGAGGGGGACAGCATCCTGCCTCCTCTGCGCACTGAGGCTACAGA

GTCATCTGACTCAGACACTGGTGATGCAAGTGACTCCAGCTATGCCAGAG TGGTGGAACCAAGCACGGTGGACACTGGGACCTGCAGTTCTGCCTTTGC

TGGCTGGGAGGTACACACACGGGGCATTGGCTCCAAACTCCTCGTCAAGATGGGCTATGAGTTTGGCAAGG GTTTGGGCCGGCATGCAGAAGGCCGGGT

GGAGCCCATCCATGCTGTAGTGTTGCCTAGAGGGAAATCACTGGACCAGTGTGCAGAGATACTGCAGAAGAAGACAAAGCGAGGCCAGGCTGGGTCCAAC

AGGCCTCCAAAATGCCGGAGGAGTGGTAGTAGACCTGAGGGCCGCCCACCCCCCCGGAATGTGTTTGACTTTTTGAATGAAAAACTGCAAAGCCAGGTTC

CTGGGACCCCAGATGCTGGGGTGGATACCCCAGAGAGAAGGAACAAAGACATGTATCACGCCAGCAAGAGCGCCAAGCAGGCTTTGAGCCTGCAGCTCTT

CCAGACTGAGGAGAAGATTGAGCGGACCCAACGGGACATCCGGGGCATCCAGGAGGCCCTAACCCGGAACACTGGCCG - UNI29900 - GCACAATA

TGACGACAGCCCATCTGCAGGAGAAGCTGGAGGGAGCCCAGCGGCAGCTGGGTCAGCTGCGTGCTCAGGAGGCTGACCTACAGAGGAAACAGCGGAAGGC

AGACACTCACAGGAAGATGACAGAGTTCTAGCGGCCCTGCCTGTATTGTGGATAGAGCCCTGGGACCCAGCTCCAAACTGCCTTGGCAGAAAGACAGCTG

TCACCCTGATGCCTAAACAGCACCTGGAAGAGGAACCAGCCCCTTCTTAGGATGCCCCTTAATTAGCCTTGTCAGCCTAGAGTGTGAACACTGCTGAGTA

GAGGTGGGACATCAGGGCTGATTTTGAACACTTATCTGCCCACCAAGCCCACCTACCAGTGTCTTGGGGTGTCTCCTTAGGACATTAAAGTGATTTCATC

ACAATTCTCTCA
Translation
 MDEDNLETALQTYRAQLQQVELALGAGLDASEQADLRQLQGDLKELIELTEASLLSVRKSKLLSTVDQESPAQEDAEYLAFQKAIAEEVEAPGAPCNDS

ETAPGSEVQPGSTSSALEEEEEDPDLEELSGAKVNAPYYSAWGTLEYHNAMVVGAEEAEDGSACVRVLYLYPTHKSLKPCPFFLEGKCRFKENCR RFSH

GQVVSVDELRPFQDPDLSLLQTGSACLAKHQDGLWHPARITD DVDNGYYTVKFDSLLLKEAVVEGDSILPPLRTEATESSDSDTGDASDSSYARV VVE

PSTVDTGTCSSAFAGWEVHTRGIGSKLLVKMGYEFGKG GLGRHAEGRVEPIHAVVLPRGKSLDQCAEILQKKTKRGQAGSNRPPKCRRSGSRPEGRPPP

RNVFDFLNEKLQSQVPGTPDAGVDTPERRNKDMYHASKSAKQALSLQLFQTEEKIERTQRDIRGIQEALTRNTGR - UNI29900 - RHNMTTAHLQE

KLEGAQRQLGQLRAQEADLQRKQRKADTHRKMTEF
Transcript ENSMUST00000108807
Sequence
GGAAGTGCCCGGCGGAGGGCAGAAGGCTAGCGCGTGAGCTTGGCTGGCGAGGGCGGAAGCCCTTCTAGCCTGCGAGCGCCGGCCGGAGGTGGGGTTGCGG

GCCGCAGAGGACGGGGCGGGTGACGTGCAGGTCCCCCTCGGCGGAACCGCGGCCCTCCTCAGGCTCCCTAGCGGTTTTGGGGGCGGCGTTGCCCTGAGTT

GTTCTTACTGCTCTTCCTCCTGTTTTTGTCTGCGGTAAAGGTTCCGAATCCTGCCTGCTGGGTCGGGATGGACGAGGACAACCTAGAGACTGCCCTGCAG

ACCTACCGGGCCCAGCTGCAGCAGGTAGAGCTGGCGCTCGGTGCTGGCCTAGACGCTTCTGAGCAGGCGGACCTGCGTCAGCTGCAGGGCGATCTAAAGG

AGCTGATTGAGCTCACCGAGGCCAGCCTGTTGTCGGTCAGAAAGAGCAAGCTGCTGTCTACAGTGGACCAGGAGAGCCCAGCTCAAGAGGATGCTGAGTA

CCTGGCTTTCCAGAAGGCCATTGCGGAGGAAGTGGAAGCGCCCGGCGCCCCCTGCAATGACTCGGAGACGGCCCCTGGGAGCGAGGTGCAGCCGGGATCC

ACCTCCTCTGCACTGGAGGAGGAGGAGGAGGACCCAGATCTGGAGGAACTGAGCGGTGCTAAAGTGAATGCCCCCTACTACAGCGCTTGGGGCACGCTGG

AGTATCACAACGCTATGGTAGTGGGCGCCGAAGAGGCGGAGGATGGTTCTGCGTGCGTCCGAGTCCTCTACCTATACCCTACCCACAAGTCCCTGAAGCC

CTGTCCGTTCTTCCTGGAGGGAAAGTGCCGGTTCAAGGAGAACTGCAG GTTCTCCCATGGGCAGGTGGTATCTGTGGATGAGCTGCGTCCCTTTCAGGA

TCCAGACTTAAGCTTACTGCAGACTGGCTCTGCATGTCTGGCCAAGCACCAGGATGGCCTGTGGCACCCAGCACGGATCACTG ATGTGGACAATGGCTA

CTATACCGTTAAGTTTGACTCATTGCTGCTGAAGGAGGCTGTAGTGGAGGGGGACAGCATCCTGCCTCCTCTGCGCACTGAGGCTACAGAGTCATCTGAC

TCAGACACTGGTGATGCAAGTGACTCCAGCTATGCCAGAG TGGTGGAACCAAGCACGGTGGACACTGGGACCTGCAGTTCTGCCTTTGCTGGCTGGGAG

GTACACACACGGGGCATTGGCTCCAAACTCCTCGTCAAGATGGGCTATGAGTTTGGCAAGG GTTTGGGCCGGCATGCAGAAGGCCGGGTGGAGCCCATC

CATGCTGTAGTGTTGCCTAGAGGGAAATCACTGGACCAGTGTGCAGAGATACTGCAGAAGAAGACAAAGCGAGGCCAGGCTGGGTCCAACAGGCCTCCAA

AATGCCGGAGGAGTGGTAGTAGACCTGAGGGCCGCCCACCCCCCCGGAATGTGTTTGACTTTTTGAATGAAAAACTGCAAAGCCAGGTTCCTGGGACCCC

AGATGCTGGGGTGGATACCCCAGAGAGAAGGAACAAAGACATGTATCACGCCAGCAAGAGCGCCAAGCAGGCTTTGAGCCTGCAGCTCTTCCAGACTGAG

GAGAAGATTGAGCGGACCCAACGGGACATCCGGGGCATCCAGGAGGCCCTAACCCGGAACACTGGCCG - UNI29900 - GCACAATATGACGACAGC

CCATCTGCAGGAGAAGCTGGAGGGAGCCCAGCGGCAGCTGGGTCAGCTGCGTGCTCAGGAGGCTGACCTACAGAGGAAACAGCGGAAGGCAGACACTCAC

AGGAAGATGACAGAGTTCTAGCGGCCCTGCCTGTATTGTGGATAGAGCCCTGGGACCCAGCTCCAAACTGCCTTGGCAGAAAGACAGCTGTCACCCTGAT

GCCTAAACAGCACCTGGAAGAGGAACCAGCCCCTTCTTAGGATGCCCCTTAATTAGCCTTGTCAGCCTAGAGTGTGAACACTGCTGAGTAGAGGTGGGAC

ATCAGGGCTGATTTTGAACACTTATCTGCCCACCAAGCCCACCTACCAGTGTCTTGGGGTGTCTCCTTAGGACATTAAAGTGATTTCATC
Translation
MDEDNLETALQTYRAQLQQVELALGAGLDASEQADLRQLQGDLKELIELTEASLLSVRKSKLLSTVDQESPAQEDAEYLAFQKAIAEEVEAPGAPCNDSE

TAPGSEVQPGSTSSALEEEEEDPDLEELSGAKVNAPYYSAWGTLEYHNAMVVGAEEAEDGSACVRVLYLYPTHKSLKPCPFFLEGKCRFKENCR RFSHG

QVVSVDELRPFQDPDLSLLQTGSACLAKHQDGLWHPARITD DVDNGYYTVKFDSLLLKEAVVEGDSILPPLRTEATESSDSDTGDASDSSYARV VVEP

STVDTGTCSSAFAGWEVHTRGIGSKLLVKMGYEFGKG GLGRHAEGRVEPIHAVVLPRGKSLDQCAEILQKKTKRGQAGSNRPPKCRRSGSRPEGRPPPR

NVFDFLNEKLQSQVPGTPDAGVDTPERRNKDMYHASKSAKQALSLQLFQTEEKIERTQRDIRGIQEALTRNTGR - UNI29900 - RHNMTTAHLQEK

LEGAQRQLGQLRAQEADLQRKQRKADTHRKMTEF
Transcript ENSMUST00000108806
Sequence
GCAGAAGGCTAGCGCGTGAGCTTGGCTGGCGAGGGCGGAAGCCCTTCTAGCCTGCGAGCGCCGGCCGGAGGTGGGGTTGCGGGCCGCAGAGGACGGGGCG

GGTGACGTGCAGGTCCCCCTCGGCGGAACCGCGGCCCTCCTCAGGCTCCCTAGCGGTTTTGGGGGCGGCGTTGCCCTGAGTTGTTCTTACTGCTCTTCCT

CCTGTTTTTGTCTGCGGTAAAGGTTCCGAATCCTGCCTGCTGGGTCGGGATGGACGAGGACAACCTAGAGACTGCCCTGCAGACCTACCGGGCCCAGCTG

CAGCAGGTAGAGCTGGCGCTCGGTGCTGGCCTAGACGCTTCTGAGCAGGCGGACCTGCGTCAGCTGCAGGGCGATCTAAAGGAGCTGATTGAGCTCACCG

AGGCCAGCCTGTTGTCGGTCAGAAAGAGCAAGCTGCTGTCTACAGTGGACCAGGAGAGCCCAGCTCAAGAGGATGCTGAGTACCTGGCTTTCCAGAAGGC

CATTGCGGAGGAAGTGGAAGCGCCCGGCGCCCCCTGCAATGACTCGGAGACGGCCCCTGGGAGCGAGGTGCAGCCGGGATCCACCTCCTCTGCACTGGAG

GAGGAGGAGGAGGACCCAGATCTGGAGGAACTGAGCGGTGCTAAAGTGAATGCCCCCTACTACAGCGCTTGGGGCACGCTGGAGTATCACAACGCTATGG

TAGTGGGCGCCGAAGAGGCGGAGGATGGTTCTGCGTGCGTCCGAGTCCTCTACCTATACCCTACCCACAAGTCCCTGAAGCCCTGTCCGTTCTTCCTGGA

GGGAAAGTGCCGGTTCAAGGAGAACTGCAG GTTCTCCCATGGGCAGGTGGTATCTGTGGATGAGCTGCGTCCCTTTCAGGATCCAGACTTAAGCTTACT

GCAGACTGGCTCTGCATGTCTGGCCAAGCACCAGGATGGCCTGTGGCACCCAGCACGGATCACTG ATGTGGACAATGGCTACTATACCGTTAAGTTTGA

CTCATTGCTGCTGAAGGAGGCTGTAGTGGAGGGGGACAGCATCCTGCCTCCTCTGCGCACTGAGGCTACAGAGTCATCTGACTCAGACACTGGTGATGCA

AGTGACTCCAGCTATGCCAGAG TGGTGGAACCAAGCACGGTGGACACTGGGACCTGCAGTTCTGCCTTTGCTGGCTGGGAGGTACACACACGGGGCATT

GGCTCCAAACTCCTCGTCAAGATGGGCTATGAGTTTGGCAAGG GTTTGGGCCGGCATGCAGAAGGCCGGGTGGAGCCCATCCATGCTGTAGTGTTGCCT

AGAGGGAAATCACTGGACCAGTGTGCAGAGATACTGCAGAAGAAGACAAAGCGAGGCCAGGCTGGGTCCAACAGGCCTCCAAAATGCCGGAGGAGTGGTA

GTAGACCTGAGGGCCGCCCACCCCCCCGGAATGTGTTTGACTTTTTGAATGAAAAACTGCAAAGCCAGGTTCCTGGGACCCCAGATGCTGGGGTGGATAC

CCCAGAGAGAAGGAACAAAGACATGTATCACGCCAGCAAGAGCGCCAAGCAGGCTTTGAGCCTGCAGCTCTTCCAGACTGAGGAGAAGATTGAGCGGACC

CAACGGGACATCCGGGGCATCCAGGAGGCCCTAACCCGGAACACTGGCCG - UNI29900 - GAAGAGAGCTCAGAGGCAGCAAACTGGGCTGCAGGA

CAGTTTGGTACCAGTGGAAATG CCACTGCTGAGACAGACCCACCTCTGCTCCCTCAGCAAGTCTGACACCAGACTGCATGAGCTGCACCGAGGCCCACG

CTCCAGCATAG CCCCACGGCCTGCTAGCATGGATCTTCTGCATCCACGCTGGCTAGAGATGTCCAGGGGCAGCACCAGGTCTCAGGTACCCAACTCTGC

CTTCCCACCACGGCAGCTGCCCAGGGCCCCTCCTGCTGCTCCTGCAACTGCACCTTCTACTAGCTCTGAGGCCACTTATTCCAATGTGGGGCTGGCTGCA

ATTCCCAGGGCCAGCCTGGCTGCTAGCCCTGTGGTGTGGGCTGGAACACAGCTGACCATTAGTTGTGCCAGGCTTGGTCCTGGGGCCGAATATGCCTGCA

TCCAGAAGCACAAAGGGACAGAGCAAGGCTGCCAAGAATTGCAGCAGAAGGCTAAGGTGATCCCAGCTACTCAG ATGGACGTCCTATACTCTAGGGTTT

GCAAGCCTAAAAGAAGAGACCCAAGACCCGTCACAGACCAGCTGAACCTGCAGGATGGGAGAACAAGTCTGCCGCTTGGGAGTGATGTGGAGTACGAGGC

CATCAATCTCAGGGGCCAGGATATGAAGCAAGGGCCCTTAGAAAATGTGTATGAAAGCATCAAGGAGATGGGCCTGTGAGCAGCTCAGGCCTTACATCCT

GTCTTTAACATGAGTTAGGAAGAGTACCAAGGCTTCTGCTTCAGGATGGTTTGATTGCAGATCCTTCTGTGTCCTTCCACCTCCACAGCTGGCAGCACAG

CTATCAGGGCCAGTCCTTGAGGCCTAATTAAACCTCTGTTC
Translation
    MYHASKSAKQALSLQLFQTEEKIERTQRDIRGIQEALTRNTGR - UNI29900 - RKRAQRQQTGLQDSLVPVEM PLLRQTHLCSLSKSDTRL

HELHRGPRSSIA APRPASMDLLHPRWLEMSRGSTRSQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVGLAAIPRASLAASPVVWAGTQLTISCAR

LGPGAEYACIQKHKGTEQGCQELQQKAKVIPATQ MDVLYSRVCKPKRRDPRPVTDQLNLQDGRTSLPLGSDVEYEAINLRGQDMKQGPLENVYESIKEM

GL
Transcript ENSMUST00000108805
Sequence
GCAGAAGGCTAGCGCGTGAGCTTGGCTGGCGAGGGCGGAAGCCCTTCTAGCCTGCGAGCGCCGGCCGGAGGTGGGGTTGCGGGCCGCAGAGGACGGGGCG

GGTGACGTGCAGGTCCCCCTCGGCGGAACCGCGGCCCTCCTCAGGCTCCCTAGCGGTTTTGGGGGCGGCGTTGCCCTGAGTTGTTCTTACTGCTCTTCCT

CCTGTTTTTGTCTGCGGTAAAGGTTCCGAATCCTGCCTGCTGGGTCGGGATGGACGAGGACAACCTAGAGACTGCCCTGCAGACCTACCGGGCCCAGCTG

CAGCAGGTAGAGCTGGCGCTCGGTGCTGGCCTAGACGCTTCTGAGCAGGCGGACCTGCGTCAGCTGCAGGGCGATCTAAAGGAGCTGATTGAGCTCACCG

AGGCCAGCCTGTTGTCGGTCAGAAAGAGCAAGCTGCTGTCTACAGTGGACCAGGAGAGCCCAGCTCAAGAGGATGCTGAGTACCTGGCTTTCCAGAAGGC

CATTGCGGAGGAAGTGGAAGCGCCCGGCGCCCCCTGCAATGACTCGGAGACGGCCCCTGGGAGCGAGGTGCAGCCGGGATCCACCTCCTCTGCACTGGAG

GAGGAGGAGGAGGACCCAGATCTGGAGGAACTGAGCGGTGCTAAAGTGAATGCCCCCTACTACAGCGCTTGGGGCACGCTGGAGTATCACAACGCTATGG

TAGTGGGCGCCGAAGAGGCGGAGGATGGTTCTGCGTGCGTCCGAGTCCTCTACCTATACCCTACCCACAAGTCCCTGAAGCCCTGTCCGTTCTTCCTGGA

GGGAAAGTGCCGGTTCAAGGAGAACTGCAG GTTCTCCCATGGGCAGGTGGTATCTGTGGATGAGCTGCGTCCCTTTCAGGATCCAGACTTAAGCTTACT

GCAGACTGGCTCTGCATGTCTGGCCAAGCACCAGGATGGCCTGTGGCACCCAGCACGGATCACTG ATGTGGACAATGGCTACTATACCGTTAAGTTTGA

CTCATTGCTGCTGAAGGAGGCTGTAGTGGAGGGGGACAGCATCCTGCCTCCTCTGCGCACTGAGGCTACAGAGTCATCTGACTCAGACACTGGTGATGCA

AGTGACTCCAGCTATGCCAGAG TGGTGGAACCAAGCACGGTGGACACTGGGACCTGCAGTTCTGCCTTTGCTGGCTGGGAGGTACACACACGGGGCATT

GGCTCCAAACTCCTCGTCAAGATGGGCTATGAGTTTGGCAAGG GTTTGGGCCGGCATGCAGAAGGCCGGGTGGAGCCCATCCATGCTGTAGTGTTGCCT

AGAGGGAAATCACTGGACCAGTGTGCAGAGATACTGCAGAAGAAGACAAAGCGAGGCCAGGCTGGGTCCAACAGGCCTCCAAAATGCCGGAGGAGTGGTA

GTAGACCTGAGGGCCGCCCACCCCCCCGGAATGTGTTTGACTTTTTGAATGAAAAACTGCAAAGCCAGGTTCCTGGGACCCCAGATGCTGGGGTGGATAC

CCCAGAGAGAAGGAACAAAGACATGTATCACGCCAGCAAGAGCGCCAAGCAGGCTTTGAGCCTGCAGCTCTTCCAGACTGAGGAGAAGATTGAGCGGACC

CAACGGGACATCCGGGGCATCCAGGAGGCCCTAACCCGGAACACTGGCCG - UNI29900 - GCACAATATGACGACAGCCCATCTGCAGGAGAAGCT

GGAGGGAGCCCAGCGGCAGCTGGGTCAGCTGCGTGCTCAGGAGGCTGACCTACAGAGGAAACAGCGGAAGGCAGACACTCACAGGAAGATGACAGAGTTC

TAGCGGCCCTGCCTGTATTGTGGATAGAGCCCTGGGACCCAGCTCCAAACTGCCTTGGCAGAAAGACAGCTGTCACCCTGATGCCTAAACAGCACCTGGA

AGAGGAACCAGCCCCTTCTTAGGATGCCCCTTAATTAGCCTTGTCAGCCTAGAGTGTGAACACTGCTGAGTAGAGGTGGGACATCAGGGCTGATTTTGAA

CACTTATCTGCCCACCAAGCCCACCTACCAGTGTCTTGGGGTGTCTCCTTAGGACATTAAAGTGATTTCATCACAATTCTCTCAGTGGAGACTCAGCTGG

CTTCAGGATTTCTGGGGACACAGGGATCTGTGTAGGTCCTGGGAGTAGACAGGTGGGCAGTGGGAGTACCAAATGAGGCCACTGCCTCTGTCTAGGGTCC

AAGAGTCCAAGAGAAAAACATTCTCCCTTTTCCCTTCTCTGACCAAGTGGGTAAGAACCTAAGGTGGCTCTTCAGTCCCAGTACTCACAAGCAGGTAGGG

TGTGTGAGATGGAAACACCTTAGGAATACAGTCAGTGAGAAAAGCAGGCAGACCTGGCTTGGGTGGGTTTGGGGTTCATTTCTGGTTTTTGGCTGCCACG

ATAATCCATCCAGTTCACCTGCTTTGTTCACCTCATTAATGGGTATCTGCCTCATTGGGGTGGAGGGGACTGTGCTGGTCTTTGTGGTAATTGCCTAGTG

ATAGCATTAGCCATGATGAGGTGTGAGGAGAGCAGAGACTGTGGGAGCAACTGCGCAAGAGCTGTGTGGCTGCTGGGAGGTGCTCTGAGAAACACAGGAA

GTGAGGTGAGGCGTCACCAGCAGCCCACAAAGATCTTCCTGGCTGTCCTAGACAGGGCCAAGCAGCAAATCCCCGGTGGCCTCG GGCTCTCTTCCCTGT

TTCACAGGATGAGGCCACCAGTGCCTTCAGCCCCACTAGCTCTCTGGGTCCTGGGCTGCTTCTCCCTGCTCCTTTGGCTATGGGCACTGTGCACAGCCTG

CCACAG GAAGAGAGCTCAGAGGCAGCAAACTGGGCTGCAGGACAGTTTGGTACCAGTGGAAATG CCACTGCTGAGACAGACCCACCTCTGCTCCCTCA

GCAAGTCTGACACCAGACTGCATGAGCTGCACCGAGGCCCACGCTCCAGCATAG CCCCACGGCCTGCTAGCATGGATCTTCTGCATCCACGCTGGCTAG

AGATGTCCAGGGGCAGCACCAGGTCTCAGGTACCCAACTCTGCCTTCCCACCACGGCAGCTGCCCAGGGCCCCTCCTGCTGCTCCTGCAACTGCACCTTC

TACTAGCTCTGAGGCCACTTATTCCAATGTGGGGCTGGCTGCAATTCCCAGGGCCAGCCTGGCTGCTAGCCCTGTGGTGTGGGCTGGAACACAGCTGACC

ATTAGTTGTGCCAGGCTTGGTCCTGGGGCCGAATATGCCTGCATCCAGAAGCACAAAGGGACAGAGCAAGGCTGCCAAGAATTGCAGCAGAAGGCTAAGG

TGATCCCAGCTACTCAG ATGGACGTCCTATACTCTAGGGTTTGCAAGCCTAAAAGAAGAGACCCAAGACCCGTCACAGACCAGCTGAACCTGCAGGATG

GGAGAACAAGTCTGCCGCTTGGGAGTGATGTGGAGTACGAGGCCATCAATCTCAGGGGCCAGGATATGAAGCAAGGGCCCTTAGAAAATGTGTATGAAAG

CATCAAGGAGATGGGCCTGTGAGCAGCTCAGGCCTTACATCCTGTCTTTAACATGAGTTAGGAAGAGTACCAAGGCTTCTGCTTCAGGATGGTTTGATTG

CAGATCCTTCTGTGTCCTTCCACCTCCACAGCTGGCAGCACAGCTATCAGGGCCAGTCCTTGAGGCCTAATTAAACCTCTGTTC
Translation
     - UNI29900 -  MRPPVPSAPLALWVLGCFSLLLWLWALCTACHR RKRAQRQQTGLQDSLVPVEM PLLRQTHLCSLSKSDTRLHELHRGPR

SSIA APRPASMDLLHPRWLEMSRGSTRSQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVGLAAIPRASLAASPVVWAGTQLTISCARLGPGAEYA

CIQKHKGTEQGCQELQQKAKVIPATQ MDVLYSRVCKPKRRDPRPVTDQLNLQDGRTSLPLGSDVEYEAINLRGQDMKQGPLENVYESIKEMGL
Transcript ENSMUST00000048077
Sequence
GAGGAGAGCAGAGACTGTGGGAGCAACTGCGCAAGAGCTGTGTGGCTGCTGGGAGGTGCTCTGAGAAACACAGGAAGTGAGGTGAGGCGTCACCAGCAGC

CCACAAAGATCTTCCTGGCTGTCCTAGACAGGGCCAAGCAGCAAATCCCCGGTGGCCTCGGTAAGTGCTCCCTCACCCTTTATCCTGGGCCAGCCCCCAA

GCCTCTCCATGCTCTGGGGTCTGGGAGGGTTAGTCCCTGCCTGGTTAGGCCATTGATAACTTGGCTGTAGCCAGGTTAGTCAGCTTGGGCCCACTCAGTG

AAAGAAGCCTACACTCCAAGCCTGAACAGACAGGCCCTCACCTCAGAAGGCTGTTGTTCACCCCAATTTTACTTACCTTTAACGTCTGGGTGAGACCCTA

ATCAGCTCTGCAAAGGGTAACTCCAGGGAAGCCCCAGAGCCCCGGGAAGTGTGGAGTAGGGTGGGAGTACGTGGCCCTCATAGCAGCTCCTCCTGTTCAT

TGACACACACCTCCCCCACCCACCCTTTCTGTAGTGAGTAGTCTAGGAAGATTGCCTGACACAGGGGTCACTCTGTGGGCATTGGTGGCCGGAGGTGAGA

CCTGTGGTCTGTGGCTCAGAGTCAGAGTGAAGTCAGAGATTCCCCAGGTGATGGGCTTGAGCTCCAGTTATACACCCTTGTTCAGTTGAGGTCATAGCTA

CCCTGGCCATGCTCCTCTATCTCCATCTCCATTCCTGATAACTAACAGGGATAGGCAGAGCACTTCTTACCAGGAACCCTAGCTAGAGAGGGAAAGGTGG

GTCCCCCTAGAGCACGGCAAAAATGCAAGGCTTGGGGGTTTCCGGTGTGCTGAGTCAACCAGGGAGAAGGAACCCACTAGTGGGCAAGATCTGCAAGTAG

GCTGCAGCTGTACACTGCTCTCGCAGCCAGCCCCCAGTGCTCATCTCTTCTGTCCCCAGGGCTCTCTTCCCTGTTTCACAGGATGAGGCCACCAGTGCCT

TCAGCCCCACTAGCTCTCTGGGTCCTGGGCTGCTTCTCCCTGCTCCTTTGGCTATGGGCACTGTGCACAGCCTGCCACAG GAAGAGAGCTCAGAGGCAG

CAAACTGGGCTGCAGGACAGTTTGGTACCAGTGGAAATG CCACTGCTGAGACAGACCCACCTCTGCTCCCTCAGCAAGTCTGACACCAGACTGCATGAG

CTGCACCGAGGCCCACGCTCCAGCATAG CCCCACGGCCTGCTAGCATGGATCTTCTGCATCCACGCTGGCTAGAGATGTCCAGGGGCAGCACCAGGTCT

CAGGTACCCAACTCTGCCTTCCCACCACGGCAGCTGCCCAGGGCCCCTCCTGCTGCTCCTGCAACTGCACCTTCTACTAGCTCTGAGGCCACTTATTCCA

ATGTGGGGCTGGCTGCAATTCCCAGGGCCAGCCTGGCTGCTAGCCCTGTGGTGTGGGCTGGAACACAGCTGACCATTAGTTGTGCCAGGCTTGGTCCTGG

GGCCGAATATGCCTGCATCCAGAAGCACAAAGGGACAGAGCAAGGCTGCCAAGAATTGCAGCAGAAGGCTAAGGTGATCCCAGCTACTCAG ATGGACGT

CCTATACTCTAGGGTTTGCAAGCCTAAAAGAAGAGACCCAAGACCCGTCACAGACCAGCTGAACCTGCAGGATGGGAGAACAAGTCTGCCGCTTGGGAGT

GATGTGGAGTACGAGGCCATCAATCTCAGGGGCCAGGATATGAAGCAAGGGCCCTTAGAAAATGTGTATGAAAGCATCAAGGAGATGGGCCTGTGAGCAG

CTCAGGCCTTACATCCTGTCTTTAACATGAGTTAGGAAGAGTACCAAGGCTTCTGCTTCAGGATGGTTTGATTGCAGATCCTTCTGTGTCCTTCCACCTC

CACAGCTGGCAGCACAGCTATCAGGGCCAGTCCTTGAGGCCTAATTAAACCTCTGTTCAATAA
Translation
MRPPVPSAPLALWVLGCFSLLLWLWALCTACHR RKRAQRQQTGLQDSLVPVEM PLLRQTHLCSLSKSDTRLHELHRGPRSSIA APRPASMDLLHPRW

LEMSRGSTRSQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVGLAAIPRASLAASPVVWAGTQLTISCARLGPGAEYACIQKHKGTEQGCQELQQKA

KVIPATQ MDVLYSRVCKPKRRDPRPVTDQLNLQDGRTSLPLGSDVEYEAINLRGQDMKQGPLENVYESIKEMGL
Transcript ENSMUST00000108804
Sequence
GAGGAGAGCAGAGACTGTGGGAGCAACTGCGCAAGAGCTGTGTGGCTGCTGGGAGGTGCTCTGAGAAACACAGGAAGTGAGGTGAGGCGTCACCAGCAGC

CCACAAAGATCTTCCTGGCTGTCCTAGACAGGGCCAAGCAGCAAATCCCCGGTGGCCTCGGTAAGTGCTCCCTCACCCTTTATCCTGGGCCAGCCCCCAA

GCCTCTCCATGCTCTGGGGTCTGGGAGGGTTAGTCCCTGCCTGGTTAGGCCATTGATAACTTGGCTGTAGCCAGGTTAGTCAGCTTGGGCCCACTCAGTG

AAAGAAGCCTACACTCCAAGCCTGAACAGACAGGCCCTCACCTCAGAAGGCTGTTGTTCACCCCAATTTTACTTACCTTTAACGTCTGGGTGAGACCCTA

ATCAGCTCTGCAAAGGGTAACTCCAGGGAAGCCCCAGAGCCCCGGGAAGTGTGGAGTAGGGTGGGAGTACGTGGCCCTCATAGCAGCTCCTCCTGTTCAT

TGACACACACCTCCCCCACCCACCCTTTCTGTAGTGAGTAGTCTAGGAAGATTGCCTGACACAGGGGTCACTCTGTGGGCATTGGTGGCCGGAGGTGAGA

CCTGTGGTCTGTGGCTCAGAGTCAGAGTGAAGTCAGAGATTCCCCAGGTGATGGGCTTGAGCTCCAGTTATACACCCTTGTTCAGTTGAGGTCATAGCTA

CCCTGGCCATGCTCCTCTATCTCCATCTCCATTCCTGATAACTAACAGGGATAGGCAGAGCACTTCTTACCAGGAACCCTAGCTAGAGAGGGAAAGGTGG

GTCCCCCTAGAGCACGGCAAAAATGCAAGGCTTGGGGGTTTCCGGTGTGCTGAGTCAACCAGGGAGAAGGAACCCACTAGTGGGCAAGATCTGCAAGTAG

GCTGCAGCTGTACACTGCTCTCGCAGCCAGCCCCCAGTGCTCATCTCTTCTGTCCCCAGGGCTCTCTTCCCTGTTTCACAGGATGAGGCCACCAGTGCCT

TCAGCCCCACTAGCTCTCTGGGTCCTGGGCTGCTTCTCCCTGCTCCTTTGGCTATGGGCACTGTGCACAGCCTGCCACAG GAAGAGAGCTCAGAGGCAG

CAAACTGGGCTGCAGGACAGTTTGGTACCAGTGGAAATG CCACTGCTGAGACAGACCCACCTCTGCTCCCTCAGCAAGTCTGACACCAGACTGCATGAG

CTGCACCGAGGCCCACGCTCCAGCATAG ATGGACGTCCTATACTCTAGGGTTTGCAAGCCTAAAAGAAGAGACCCAAGACCCGTCACAGACCAGCTGAA

CCTGCAGGATGGGAGAACAAGTCTGCCGCTTGGGAGTGATGTGGAGTACGAGGCCATCAATCTCAGGGGCCAGGATATGAAGCAAGGGCCCTTAGAAAAT

GTGTATGAAAGCATCAAGGAGATGGGCCTGTGAGCAGCTCAGGCCTTACATCCTGTCTTTAACATGAGTTAGGAAGAGTACCAAGGCTTCTGCTTCAGGA

TGGTTTGATTGCAGATCCTTCTGTGTCCTTCCACCTCCACAGCTGGCAGCACAGCTATCAGGGCCAGTCCTTGAGGCCTAATTAAACCTCTGTTC
Translation
MRPPVPSAPLALWVLGCFSLLLWLWALCTACHR RKRAQRQQTGLQDSLVPVEM PLLRQTHLCSLSKSDTRLHELHRGPRSSID DGRPIL

For any suggestions or comments, please send an email to unitrap@crg.es