Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027610 (Gss)
Chromosomal location
Chr 2: 155388923 - 155418466 (-)
Description
glutathione synthetase Gene [Source:MGI (curated);Acc:Gss-001]
RefSeq_dna
NM_008180 
RefSeq_peptide
NP_032206.1 
UniGene
Mm.252316 
MGI
MGI:95852 
Uniprot/SWISSPROT
P51855 
Uniprot/SPTREMBL
A2AQN7 A2AQN9 Q3TF63 Q3TWM2 Q3UEE2 Q541E2 Q8R436 
Human Ortholog
ENSG00000100983 (GSS)
Omim 231900 - GLUTATHIONE SYNTHETASE DEFICIENCY OF ERYTHROCYTES, HEMOLYTIC ANEMIA  266130 - GLUTATHIONE SYNTHETASE DEFICIENCY  
UniTrap UNI16926
Vector Insertion
Chr 2: 155413313 - 155418429
Public Clones (ggtc)
Private Clones OST452213 (lexicon) OST405043 (lexicon) OST379735 (lexicon) OST376904 (lexicon)
OST344989 (lexicon) OST317771 (lexicon) OST304479 (lexicon) OST287751 (lexicon)
OST265347 (lexicon) OST232511 (lexicon) OST212148 (lexicon) OST145192 (lexicon)
OST125908 (lexicon) OST57751 (lexicon) OST25690 (lexicon) OST13444 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22362
Vector Insertion
Chr 2: 155404524 - 155407623
Public Clones not available
Private Clones OST299273 (lexicon) OST285189 (lexicon) OST218019 (lexicon) OST209000 (lexicon)
OST188689 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24727
Vector Insertion
Chr 2: 155404165 - 155404447
Public Clones not available
Private Clones OST208929 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16619
Vector Insertion
Chr 2: 155393624 - 155397254
Public Clones not available
Private Clones OST456835 (lexicon) OST288365 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27923
Vector Insertion
Chr 2: 155390686 - 155392538
Public Clones not available
Private Clones OST43779 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079691
Sequence
GGAGTTTGAGCTTGGCGAGCAGCTGGACAACGAGCGA - UNI16926 - GTTGGGATGGCTACCAGCTGGGGCAGCATCTTGCAGGATGAGAAGCAGC

TCGAAGAACTGGCAAAGCAGGCCATAGACAGGGCCCTGGCCGAGGGCGTGTTGCTGAGGTCCGCACAGCATCCCAGCTCCTCCGAC GTGGTGACGTATG

CCCCATTCACGCTTTTCCCCTCACCAGTACCCAGTGCTCTGCTGGAGCAGGCCTATGCTGTGCAGATGGACTTCAACATACTGGTGGATGCTGTCAGCCA

GAACCCAGCCTTCCTGGAGCAAACACTGTCTAG - UNI22362 - CACCATCAAAAAGGACGACTATACTGCCCGTCTCTTTGATATCTACAAGCAAG

TCCTGAAAGAGGGCATTGCCCAG - UNI24727 - ACCGTGTTCCTGGGCCTGAATCGCTCAGATTACATGTTCCAGTGCGGCGCAGACGGCTCCAAA

GCCCTGAAACAGATCGAGATCAACACTATCTCTGCCAGCTTTGGGGGCCTGGCCTCCCGGACTCCAGCTGTGCACCG ACACGTTCTCAATGTCCTGAAT

AAGACCAAAGAAGCTTCCAAGATCCTGTCCAATAACCCCAGCAAGGGACTGGCCCTGGGGATCGCCAAAGCCTGGGAGCTCTATGGCTCAGCTAA TGCG

GTGGTGCTACTGATTGCTCAAGAGAAGGAAAGGAACATATTTGACCAGCGTGCCGTAGAGAACGAGCTGCTAGACAG GAAGATCCATGTCATCCGTGGA

AGATTTGAAGATGTCTCTGAAAGGGGTTCTCTGGACCAAAACCGAAGGCTGTTTAT GGATGACCAGGAAGTTGCTGTGGTGTACTTCCGAGATGGCTAC

ATGCCCAGTCAGTATAATTCACAG - UNI16619 - AACTGGGAAGCACGCCTGATGCTAGAGAGATCTCGTGCTGCCAAGTGTCCAGACATTGCCAT

ACAGCTGGCTGGGACTAAGAAGGTGCAGCAGGAACTGAGCAGGGTGGGTCTGCTGGAAGCGCTGCTCCCGGGCCAGCCTGAGGCTGTGGCCCGCCTCCGA

GCCACCTTTGCTGGCCTCTATTCACTGGACATG GGTGAAGAAGGGGACCAGGCCATTGCTGAGGCCCTTGCTGCTCCTAGCCACTTTGTGCTGAAGCCC

CAGAGAGAGGGTGGAG - UNI27923 - GTAACAACTTATACGGGGAGGAAATGGTACAAGCTCTGGAGCAGCTGAAGGACAGTGAGGAGAGAGCCTC

CTACATCCTCATGGAGAAGATTGAACCTGAGCCTTTTAGGAATTGCTTGCTACGGCCTGGCAGCCCTGCCCAAGTGGTCCAGTGTATCTCGGAGCTGGGT

ATTTTTGGAGTCTATGTCAG ACAGGGAACAACACTGGTGATGAACAAGCATGTGGGGCACCTGCTTCGAACCAAAGCCGTGGAGCATGCAGACGGAGGT

GTGGCGGCAGGAGTGGCAGTCCTGGACAACCCCTACCCTGTGTGAAGACGCCATCTGGACTTCACTCAGGAGGCCTTCTATCCCCTGTACTTGGCACTCC

TCTTCTGAGGGGTTGCCCCTGTCCCTATCTTAGGGGAGCTTGTCTCTTCCATAGACCTCCAAAGCTTCAGGGAAGGGAAAACCCAGGGTATCTTCCCTCA

GCAGCCTTCCAGCCGAGGACCAGAAAAGCTATGATTCCATTAGAAGACTTCTGGAGGTCCCCAGATCTTTGGAGTGTGGGAATGGAAGCTGCTTTGAGGC

AAAGGCTCATAAACCCTGCAAGTCTTCATGGTCTTCTCACCAGCCTTTCCAGCAGGTTCTAGTGCCTTGACCTGGGGTAGGACCGAGTGAAGGAGGAAGA

GGGTAAAAGGGCACAGACTTCCCCAGCTCTGCCCTAAATAAAATAACAATGCTG
Translation
 - UNI16926 - MATSWGSILQDEKQLEELAKQAIDRALAEGVLLRSAQHPSSSD VVTYAPFTLFPSPVPSALLEQAYAVQMDFNILVDAVSQNPAF

LEQTLSS - UNI22362 - STIKKDDYTARLFDIYKQVLKEGIAQ - UNI24727 - TVFLGLNRSDYMFQCGADGSKALKQIEINTISASFGGLA

SRTPAVHR RHVLNVLNKTKEASKILSNNPSKGLALGIAKAWELYGSAN NAVVLLIAQEKERNIFDQRAVENELLDR RKIHVIRGRFEDVSERGSLDQ

NRRLFM MDDQEVAVVYFRDGYMPSQYNSQ - UNI16619 - NWEARLMLERSRAAKCPDIAIQLAGTKKVQQELSRVGLLEALLPGQPEAVARLRAT

FAGLYSLDM GEEGDQAIAEALAAPSHFVLKPQREGGG - UNI27923 - GNNLYGEEMVQALEQLKDSEERASYILMEKIEPEPFRNCLLRPGSPAQ

VVQCISELGIFGVYVR RQGTTLVMNKHVGHLLRTKAVEHADGGVAAGVAVLDNPYPV

For any suggestions or comments, please send an email to unitrap@crg.es